| Basic Information | |
|---|---|
| Family ID | F052507 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 142 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MDMVTPPVVADLPTEVAAGMVERDGGLLDDDVTVAGTCFMIKTPL |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 142 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.92 % |
| % of genes near scaffold ends (potentially truncated) | 15.49 % |
| % of genes from short scaffolds (< 2000 bps) | 80.28 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.254 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment (16.197 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.394 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (41.549 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 6.85% β-sheet: 2.74% Coil/Unstructured: 90.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 142 Family Scaffolds |
|---|---|---|
| PF04073 | tRNA_edit | 51.41 |
| PF00582 | Usp | 7.04 |
| PF01339 | CheB_methylest | 3.52 |
| PF00970 | FAD_binding_6 | 2.82 |
| PF11154 | DUF2934 | 1.41 |
| PF02743 | dCache_1 | 1.41 |
| PF03098 | An_peroxidase | 1.41 |
| PF05973 | Gp49 | 0.70 |
| PF03783 | CsgG | 0.70 |
| PF13936 | HTH_38 | 0.70 |
| PF01618 | MotA_ExbB | 0.70 |
| PF00813 | FliP | 0.70 |
| PF04539 | Sigma70_r3 | 0.70 |
| PF01850 | PIN | 0.70 |
| PF04134 | DCC1-like | 0.70 |
| PF07992 | Pyr_redox_2 | 0.70 |
| PF03705 | CheR_N | 0.70 |
| PF00571 | CBS | 0.70 |
| PF01569 | PAP2 | 0.70 |
| PF00175 | NAD_binding_1 | 0.70 |
| PF13426 | PAS_9 | 0.70 |
| PF00196 | GerE | 0.70 |
| PF02604 | PhdYeFM_antitox | 0.70 |
| PF00072 | Response_reg | 0.70 |
| PF01297 | ZnuA | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
|---|---|---|---|
| COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 7.04 |
| COG1352 | Methylase of chemotaxis methyl-accepting proteins | Signal transduction mechanisms [T] | 1.41 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 1.41 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.70 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.70 |
| COG1462 | Curli biogenesis system outer membrane secretion channel CsgG | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.70 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.70 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.70 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.70 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.25 % |
| Unclassified | root | N/A | 7.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_11496146 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300004281|Ga0066397_10122685 | Not Available | 568 | Open in IMG/M |
| 3300005167|Ga0066672_10056395 | All Organisms → cellular organisms → Bacteria | 2274 | Open in IMG/M |
| 3300005176|Ga0066679_10431920 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 862 | Open in IMG/M |
| 3300005180|Ga0066685_10376582 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 986 | Open in IMG/M |
| 3300005439|Ga0070711_100784484 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 807 | Open in IMG/M |
| 3300005445|Ga0070708_100166253 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2058 | Open in IMG/M |
| 3300005451|Ga0066681_10330987 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300005467|Ga0070706_100445840 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300005468|Ga0070707_100000008 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 179935 | Open in IMG/M |
| 3300005518|Ga0070699_100172341 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1918 | Open in IMG/M |
| 3300005518|Ga0070699_100343442 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1344 | Open in IMG/M |
| 3300005526|Ga0073909_10116307 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300005526|Ga0073909_10139249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1001 | Open in IMG/M |
| 3300005546|Ga0070696_100181040 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300005552|Ga0066701_10129769 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1501 | Open in IMG/M |
| 3300005554|Ga0066661_10225692 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1161 | Open in IMG/M |
| 3300005561|Ga0066699_10977411 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 587 | Open in IMG/M |
| 3300005569|Ga0066705_10044040 | All Organisms → cellular organisms → Bacteria | 2476 | Open in IMG/M |
| 3300005575|Ga0066702_10143581 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300005586|Ga0066691_10892541 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 523 | Open in IMG/M |
| 3300005827|Ga0074478_1940460 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1027 | Open in IMG/M |
| 3300005829|Ga0074479_10997205 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300005829|Ga0074479_11002634 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 551 | Open in IMG/M |
| 3300005829|Ga0074479_11090344 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 6198 | Open in IMG/M |
| 3300005833|Ga0074472_10468961 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300005833|Ga0074472_10874327 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2807 | Open in IMG/M |
| 3300006794|Ga0066658_10157897 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300006844|Ga0075428_101789785 | Not Available | 640 | Open in IMG/M |
| 3300006846|Ga0075430_100086343 | All Organisms → cellular organisms → Bacteria | 2626 | Open in IMG/M |
| 3300007258|Ga0099793_10366585 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 705 | Open in IMG/M |
| 3300009012|Ga0066710_101008376 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1285 | Open in IMG/M |
| 3300009012|Ga0066710_103935093 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 556 | Open in IMG/M |
| 3300009088|Ga0099830_11542169 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 553 | Open in IMG/M |
| 3300009100|Ga0075418_12295820 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 589 | Open in IMG/M |
| 3300009157|Ga0105092_10167744 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300009527|Ga0114942_1255086 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300009777|Ga0105164_10026651 | All Organisms → cellular organisms → Bacteria | 3217 | Open in IMG/M |
| 3300010047|Ga0126382_10626201 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300010391|Ga0136847_11355232 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 1322 | Open in IMG/M |
| 3300010391|Ga0136847_12148156 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 688 | Open in IMG/M |
| 3300011397|Ga0137444_1007748 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1359 | Open in IMG/M |
| 3300011414|Ga0137442_1084291 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 681 | Open in IMG/M |
| 3300011419|Ga0137446_1004238 | All Organisms → cellular organisms → Bacteria | 2416 | Open in IMG/M |
| 3300011424|Ga0137439_1097398 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 642 | Open in IMG/M |
| 3300011437|Ga0137429_1193396 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 636 | Open in IMG/M |
| 3300011443|Ga0137457_1057255 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1156 | Open in IMG/M |
| 3300011444|Ga0137463_1206379 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 736 | Open in IMG/M |
| 3300012146|Ga0137322_1009883 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1206 | Open in IMG/M |
| 3300012152|Ga0137347_1090557 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 545 | Open in IMG/M |
| 3300012160|Ga0137349_1039977 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 802 | Open in IMG/M |
| 3300012203|Ga0137399_10046416 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 3124 | Open in IMG/M |
| 3300012225|Ga0137434_1075150 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 537 | Open in IMG/M |
| 3300012226|Ga0137447_1084406 | Not Available | 619 | Open in IMG/M |
| 3300012232|Ga0137435_1114596 | Not Available | 815 | Open in IMG/M |
| 3300012685|Ga0137397_10136129 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae | 1815 | Open in IMG/M |
| 3300012922|Ga0137394_10258886 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae | 1488 | Open in IMG/M |
| 3300012925|Ga0137419_10021471 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 3781 | Open in IMG/M |
| 3300012944|Ga0137410_11131909 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 671 | Open in IMG/M |
| 3300014873|Ga0180066_1027602 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1068 | Open in IMG/M |
| 3300014883|Ga0180086_1142537 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 624 | Open in IMG/M |
| 3300015241|Ga0137418_10995392 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 607 | Open in IMG/M |
| 3300015252|Ga0180075_1030596 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 821 | Open in IMG/M |
| 3300015256|Ga0180073_1097406 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 633 | Open in IMG/M |
| 3300018031|Ga0184634_10039908 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 1900 | Open in IMG/M |
| 3300018031|Ga0184634_10483341 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 555 | Open in IMG/M |
| 3300018052|Ga0184638_1001778 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 6519 | Open in IMG/M |
| 3300018053|Ga0184626_10006456 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 4487 | Open in IMG/M |
| 3300018055|Ga0184616_10168555 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 815 | Open in IMG/M |
| 3300018056|Ga0184623_10207498 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 900 | Open in IMG/M |
| 3300018056|Ga0184623_10385212 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 621 | Open in IMG/M |
| 3300018059|Ga0184615_10106846 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1576 | Open in IMG/M |
| 3300018063|Ga0184637_10630686 | Not Available | 599 | Open in IMG/M |
| 3300018063|Ga0184637_10649146 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 586 | Open in IMG/M |
| 3300018063|Ga0184637_10683511 | Not Available | 564 | Open in IMG/M |
| 3300018071|Ga0184618_10008011 | All Organisms → cellular organisms → Bacteria | 3083 | Open in IMG/M |
| 3300018074|Ga0184640_10423623 | Not Available | 596 | Open in IMG/M |
| 3300018075|Ga0184632_10010270 | All Organisms → cellular organisms → Bacteria | 3924 | Open in IMG/M |
| 3300018077|Ga0184633_10007905 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 4998 | Open in IMG/M |
| 3300018078|Ga0184612_10273000 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 871 | Open in IMG/M |
| 3300018078|Ga0184612_10479129 | Not Available | 613 | Open in IMG/M |
| 3300018079|Ga0184627_10429084 | Not Available | 687 | Open in IMG/M |
| 3300018082|Ga0184639_10210949 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1030 | Open in IMG/M |
| 3300018084|Ga0184629_10058982 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1778 | Open in IMG/M |
| 3300018084|Ga0184629_10169559 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300018084|Ga0184629_10320974 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 815 | Open in IMG/M |
| 3300018084|Ga0184629_10360445 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 765 | Open in IMG/M |
| 3300018469|Ga0190270_11501059 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 723 | Open in IMG/M |
| 3300019249|Ga0184648_1285575 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300019249|Ga0184648_1493651 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 576 | Open in IMG/M |
| 3300019259|Ga0184646_1519050 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1325 | Open in IMG/M |
| 3300019360|Ga0187894_10002968 | All Organisms → cellular organisms → Bacteria | 19537 | Open in IMG/M |
| 3300019487|Ga0187893_10106436 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 2445 | Open in IMG/M |
| 3300019866|Ga0193756_1026153 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 819 | Open in IMG/M |
| 3300019883|Ga0193725_1149716 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 504 | Open in IMG/M |
| 3300019997|Ga0193711_1030735 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 672 | Open in IMG/M |
| 3300020004|Ga0193755_1013439 | All Organisms → cellular organisms → Bacteria | 2690 | Open in IMG/M |
| 3300020004|Ga0193755_1032990 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1711 | Open in IMG/M |
| 3300020059|Ga0193745_1003876 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 3140 | Open in IMG/M |
| 3300020065|Ga0180113_1299688 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 787 | Open in IMG/M |
| 3300021073|Ga0210378_10025067 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
| 3300021081|Ga0210379_10064143 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300021090|Ga0210377_10168660 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1416 | Open in IMG/M |
| 3300021090|Ga0210377_10212042 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1228 | Open in IMG/M |
| 3300022534|Ga0224452_1139158 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300022694|Ga0222623_10225942 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300025325|Ga0209341_11059713 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 589 | Open in IMG/M |
| 3300025906|Ga0207699_10948997 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 635 | Open in IMG/M |
| 3300025910|Ga0207684_10074994 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 2874 | Open in IMG/M |
| 3300025910|Ga0207684_10240164 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1563 | Open in IMG/M |
| 3300025916|Ga0207663_10846028 | Not Available | 730 | Open in IMG/M |
| 3300025922|Ga0207646_10000010 | All Organisms → cellular organisms → Bacteria | 421163 | Open in IMG/M |
| 3300025922|Ga0207646_10184963 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1882 | Open in IMG/M |
| 3300026530|Ga0209807_1159010 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 851 | Open in IMG/M |
| 3300026542|Ga0209805_1453336 | Not Available | 501 | Open in IMG/M |
| 3300026548|Ga0209161_10384930 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 619 | Open in IMG/M |
| 3300027643|Ga0209076_1201203 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 546 | Open in IMG/M |
| 3300027722|Ga0209819_10110196 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 961 | Open in IMG/M |
| 3300028536|Ga0137415_10003357 | All Organisms → cellular organisms → Bacteria | 15902 | Open in IMG/M |
| 3300028803|Ga0307281_10055622 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1254 | Open in IMG/M |
| 3300028803|Ga0307281_10439994 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 503 | Open in IMG/M |
| 3300031576|Ga0247727_10014784 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 12908 | Open in IMG/M |
| 3300031576|Ga0247727_10020763 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 9997 | Open in IMG/M |
| 3300031576|Ga0247727_10517485 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 921 | Open in IMG/M |
| 3300031720|Ga0307469_12106266 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 548 | Open in IMG/M |
| 3300031820|Ga0307473_10052478 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 1941 | Open in IMG/M |
| 3300031820|Ga0307473_10400678 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 899 | Open in IMG/M |
| 3300031873|Ga0315297_10624447 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 904 | Open in IMG/M |
| 3300031997|Ga0315278_10018111 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 6635 | Open in IMG/M |
| 3300032163|Ga0315281_11709129 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 610 | Open in IMG/M |
| 3300032164|Ga0315283_10997423 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 886 | Open in IMG/M |
| 3300032180|Ga0307471_100442809 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1437 | Open in IMG/M |
| 3300032256|Ga0315271_10930681 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 750 | Open in IMG/M |
| 3300033811|Ga0364924_041197 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 968 | Open in IMG/M |
| 3300033811|Ga0364924_132483 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300034115|Ga0364945_0038948 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1302 | Open in IMG/M |
| 3300034155|Ga0370498_010916 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1891 | Open in IMG/M |
| 3300034178|Ga0364934_0010436 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 3273 | Open in IMG/M |
| 3300034354|Ga0364943_0025986 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1840 | Open in IMG/M |
| 3300034417|Ga0364941_062263 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 854 | Open in IMG/M |
| 3300034690|Ga0364923_0014163 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1759 | Open in IMG/M |
| 3300034773|Ga0364936_009735 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1510 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 16.20% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 11.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.15% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.34% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 5.63% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 5.63% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 4.23% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.82% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 2.11% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.11% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.41% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.41% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.41% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.41% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.41% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.70% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.70% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005827 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBA | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011397 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2 | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300011424 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012146 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2 | Environmental | Open in IMG/M |
| 3300012152 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2 | Environmental | Open in IMG/M |
| 3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
| 3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015252 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D | Environmental | Open in IMG/M |
| 3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034155 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| 3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
| 3300034773 | Sediment microbial communities from East River floodplain, Colorado, United States - 4_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_114961462 | 3300000891 | Soil | MMTPPVMASLPAEAAAGMIEGDGGVLDNDATAVGAYFMIKAPL* |
| Ga0066397_101226851 | 3300004281 | Tropical Forest Soil | SLSAREMDMEIPPGATDLPTEVACGWFEEGGGLLANDVNVVGICFMIKTLR* |
| Ga0066672_100563952 | 3300005167 | Soil | MAIPPVVADLPTEVASGWIEQEGVLLDDDVIVVGICFMIKTSL* |
| Ga0066679_104319202 | 3300005176 | Soil | MAIPPVVADLPTEFASGWIEKDGLLLDDDVIVVGICFMIKTQL* |
| Ga0066685_103765821 | 3300005180 | Soil | MDMAIPPVVADLPTEVASGWIEKDGLLLDDDVIVVGICFMIKTQL* |
| Ga0070711_1007844842 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTPPLVIDLPTEIISGVVEGDGGLLDDDLTVAGTCFMIKTPL* |
| Ga0070708_1001662534 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTPPVVADIRQRPAAGTVERNGGLPDDDVTVARTCFMIKAPL* |
| Ga0066681_103309872 | 3300005451 | Soil | MDMAIPPVVADLPTEVASGWIEQEGVLLDDDVIVVGICFMIKTSL* |
| Ga0070706_1004458401 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MDMVTPPVVADIRQRPAAGTVERNGGLPDDDVTVARTCFMIKAPL* |
| Ga0070707_100000008159 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MDMVTPPLVIDLPTEIISGVVERDGGLLDDDLTVAGTCFMIKTPL* |
| Ga0070699_1001723415 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTPPLVIDLPTEIISGVVERDGGLLDDDLTVAGTCFMIKTPL* |
| Ga0070699_1003434421 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | NEFSVREMDMVTPPVVADLPTEVGCWNGERDGELLDDDLIVAGTCFMIKVPL* |
| Ga0073909_101163071 | 3300005526 | Surface Soil | MDMVTPPVVADLPTEVAAGTVERDGGLLDDDVTVEGCFMIKTPL* |
| Ga0073909_101392492 | 3300005526 | Surface Soil | MPPVVADLPMEVASGWVENDGVLLDDDVTVVGMCFMIKTLL* |
| Ga0070696_1001810404 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPVVADLPVEVASGWVENDEVLLDDNVTVVGMCLMIKTLL* |
| Ga0066701_101297693 | 3300005552 | Soil | MAIPPVVADLPTEVASGWIEKDGVLLDDDVIVVGICFMIKTQL* |
| Ga0066661_102256921 | 3300005554 | Soil | MAIPPVVADLPTEVASGWIEKDGLLLDDDVIVVGICFMI |
| Ga0066699_109774112 | 3300005561 | Soil | MAIPPVVADLPTEVASGWIEKDGLLLDDDVIVVGICFMIKTQL* |
| Ga0066705_100440403 | 3300005569 | Soil | VREMDMAIPPVVADLPTEVASGWIEKDGLLLDDDVIVVGICFMIKTQL* |
| Ga0066702_101435812 | 3300005575 | Soil | MAISPVVADLPTEVASGWIEQEGVLLDDDVIVVGICFMIKTQL* |
| Ga0066691_108925411 | 3300005586 | Soil | MDMAIPPLVADLPTEFASGWIEKDGLLLDDDVIVVGICFMIKTQL* |
| Ga0074478_19404603 | 3300005827 | Sediment (Intertidal) | CSRSRYSLSVCEMEMAKPPMVADLQTEVASGWIEKRGGLFDEDVMVTGMCFVIKTLL* |
| Ga0074479_109972054 | 3300005829 | Sediment (Intertidal) | MDMVTPPVVDWFPAEVCDGMIEGDGGLFDDDKTMEGTCFMTKAPLRS* |
| Ga0074479_110026342 | 3300005829 | Sediment (Intertidal) | MDMVTPPVVADLPTEVAAGMVKGDAGLLDDDVTVAGTCSMIKTLL* |
| Ga0074479_110903443 | 3300005829 | Sediment (Intertidal) | MEMAKPPMVADLQTEVASGWIEKRGGLFDEDVMVTGMCFVIKTLL* |
| Ga0074472_104689614 | 3300005833 | Sediment (Intertidal) | VVADIPAEVAAGMVEWDGKLLDNDVTVEGAYFMIKIPL* |
| Ga0074472_108743271 | 3300005833 | Sediment (Intertidal) | MEMAKPPMVADLQTEVASGWIEKRGGLFDKDVMVTGMCFVIKTLL* |
| Ga0066658_101578972 | 3300006794 | Soil | MAIPPVVADLPTEVASGWVEKDGVLLDDDVIVVGICFMIKTQL* |
| Ga0075428_1017897853 | 3300006844 | Populus Rhizosphere | MDMEIPPGATDLPTEVACGWTEESGGLLADDVNVVGICFMIKTLR* |
| Ga0075430_1000863433 | 3300006846 | Populus Rhizosphere | MDMAAPPVVADLLTGVASEVAGRDRGPLDDDVTVVGKCSMIKALR* |
| Ga0099793_103665851 | 3300007258 | Vadose Zone Soil | MDMVTPPMVADLPAEVAAGMVERDGGLLDNDVTVAGTCFMIKAPL* |
| Ga0066710_1010083762 | 3300009012 | Grasslands Soil | MAIPPVVADLPTEVASGWIEKDGVLLDDEVIVVGICFMIKTQL |
| Ga0066710_1039350932 | 3300009012 | Grasslands Soil | DLPTEVASGWIEKDGVLLDDDVIVVGICFMIKTQL |
| Ga0099830_115421691 | 3300009088 | Vadose Zone Soil | MAIPPVVADLPTEVTSGWIEKDRGLLDDGVTVVGTRFMIKTPL* |
| Ga0075418_122958202 | 3300009100 | Populus Rhizosphere | MEIPPGATDLPTEVACGWIEEGGGLLADDVNVVGICFMIK |
| Ga0105092_101677441 | 3300009157 | Freshwater Sediment | MDMVTPPVVADLPTEVAAGMVERDGRLLDDDVTVVGTYFMIKTPL* |
| Ga0114942_12550862 | 3300009527 | Groundwater | MDMVTPPVVDWFPAEVCDGMIEGDGGLFDDDKTMKGTCFMTKAPLRS* |
| Ga0105164_100266513 | 3300009777 | Wastewater | MDTVAPPVVADLPTEVAAGMAERGGGLLEDDVTVAGTCFMIKTPL* |
| Ga0126382_106262012 | 3300010047 | Tropical Forest Soil | MEIPPGATDLPTEVACGWIEEGGGLLANDVNVVGICFMIKTLR* |
| Ga0136847_113552322 | 3300010391 | Freshwater Sediment | MVAPPVVADLPAEVAAGMVERGEGLFVDDVTVVGTCFMIKAPL* |
| Ga0136847_121481562 | 3300010391 | Freshwater Sediment | MDIVTPPVVADLPTEVAAGMVERDGGLLDDDVTVAGTCFMIKAPL* |
| Ga0137444_10077482 | 3300011397 | Soil | MDMVTPPVVADLPTEVAAGMVERDEGLLDDDVTVAGTCFMIKTPL* |
| Ga0137442_10842911 | 3300011414 | Soil | MDMVTPPVVADLPTEVAAGMVERDGGLLDDDVTVAGTCFMIKAPL* |
| Ga0137446_10042383 | 3300011419 | Soil | MDMVTPPVVADLPTEVAAGMVEREEGLLDDDVTVAGTCFMIKTPL* |
| Ga0137439_10973981 | 3300011424 | Soil | MDMVTPPMVADLPTEVAAGMVERDGRLLDDDVTVAGTCFMIKAPL* |
| Ga0137429_11933961 | 3300011437 | Soil | MVTPPVVADLPAEVAAGMVERDGGLLDDDVTVVGNASHDQ |
| Ga0137457_10572552 | 3300011443 | Soil | MDMVTPPVVADLPTEVAAGMVERDEGLLDDDMTVAGTCFMIKAPL* |
| Ga0137463_12063793 | 3300011444 | Soil | MAIPPVVADLPMEVASGWVLNDGVLLDDDVPVVGMCFMIETLL* |
| Ga0137322_10098831 | 3300012146 | Soil | MGMVTPPVVADLPTEVAAGMVERDEGLLDDDVTVAGTCFMIKTPL* |
| Ga0137347_10905572 | 3300012152 | Soil | MDMVTPPVVADLPTEVAAGMVERDGGLLDDDVTVAGTCFMIKTPL* |
| Ga0137349_10399772 | 3300012160 | Soil | MDMVTPPVVADLPTEVAAGMVERDEGLLDDDMTVAGTCFMIKTPL* |
| Ga0137399_100464162 | 3300012203 | Vadose Zone Soil | MDMVIPPMVADLPAEVAAGMVERDGGLLDNDVTVAGTCFMIKVPL* |
| Ga0137434_10751502 | 3300012225 | Soil | MDMVTPPVVADLPTEVAAGMVERDEGLLDDDVTVAGTCFMIKAPL* |
| Ga0137447_10844061 | 3300012226 | Soil | IVTPPVVADLPTEVAAGMVERDGGLLDDDVTVAGTCFMIKAPL* |
| Ga0137435_11145962 | 3300012232 | Soil | MDMVTPPMVADLPTEVAAGMVERDEGLLDDDVTVAGTCFMIKTPL* |
| Ga0137397_101361293 | 3300012685 | Vadose Zone Soil | MGMVTPPMVADLPAEVAAGMVEREGGLLDNDVTAAGTCFMIKTPL* |
| Ga0137394_102588863 | 3300012922 | Vadose Zone Soil | MGMVTPPMVADLPAEVAAGMVERDGGLLDNDVTVAGTCFMIKAPL* |
| Ga0137419_100214712 | 3300012925 | Vadose Zone Soil | MDMVTPPMVADLPAEVAAGMVEKDGGLLDNDVTVAGTCFMIKVPL* |
| Ga0137410_111319091 | 3300012944 | Vadose Zone Soil | VADLPAEVAAGMVERDGGLLDNDVTVAGTCFMIKAPL* |
| Ga0180066_10276022 | 3300014873 | Soil | MDMVTPPVVADLPTEVAAGMVERDGRLFDDDVTVAGTCFMVKAPL* |
| Ga0180086_11425372 | 3300014883 | Soil | TPPVVADLPTEVAAGMVERDGGLLDNDVIVAGTYFMIMAPL* |
| Ga0137418_109953921 | 3300015241 | Vadose Zone Soil | MDMAIPPVVADLPTEVASGWIEQEGILVDDDVIVVGICFMIKTQL* |
| Ga0180075_10305961 | 3300015252 | Soil | MDMVTPPVVADLPTEVAAGMVERDGGLLDNDVTVAGTCFMIKTPL* |
| Ga0180073_10974061 | 3300015256 | Soil | MDMVTPPVVADLSTEVAAGMVERDGGLLDDDVTVAGTCFMIKAPL* |
| Ga0184634_100399082 | 3300018031 | Groundwater Sediment | MVAPPVVADLPAEVAAGMVERGEGLFVDDVTVVGTCFMIKAPL |
| Ga0184634_104833412 | 3300018031 | Groundwater Sediment | MDMVTPPVVADLPTEVAAGMVERDEGLLDDDVTVAGTCFMIK |
| Ga0184638_10017786 | 3300018052 | Groundwater Sediment | MDMVTPPVVADLTTEVAAGMVERDGGLLDDDVTAAGTCFMIKTPL |
| Ga0184626_100064562 | 3300018053 | Groundwater Sediment | MDMVTPPVVADLPTEVAAGMVERDGGLLDDDVTAAGTCFMIKTPL |
| Ga0184616_101685553 | 3300018055 | Groundwater Sediment | MDMVTPPVVADLPTEVAAGMVERDEGLLDDDVTVAGTCFMIKTPL |
| Ga0184623_102074982 | 3300018056 | Groundwater Sediment | MDMVTPPMVADLPTEVAAGMVERDGGLLDDDVTVAGTCFMIKAPL |
| Ga0184623_103852122 | 3300018056 | Groundwater Sediment | MAIPPVVADLPTEVASGWIARDGVLLDDDVTVVGMCFMIKTLL |
| Ga0184615_101068461 | 3300018059 | Groundwater Sediment | MDMVTPPVVADLPTEVAAGTVERDGELLDDDVTAAGCFMIKTPL |
| Ga0184637_106306861 | 3300018063 | Groundwater Sediment | MDMVTPPVVADLPTEIAAGMVERDEGMLDDDVTVAGTCFMIKAPL |
| Ga0184637_106491462 | 3300018063 | Groundwater Sediment | MDMVTPPMVADLPTEVAAGMVEKDGGLLDDDVIVAGTCFMIKVPL |
| Ga0184637_106835111 | 3300018063 | Groundwater Sediment | SRYALSVREMDMVTPPVVADLPTEVAAGMVERDEGLLDDDVTVAGTCFMIKAPL |
| Ga0184618_100080113 | 3300018071 | Groundwater Sediment | MDMVTPPVVADLSTEVAAGMVERDGGLLDDDVTVAGTCFMIKAPL |
| Ga0184640_104236231 | 3300018074 | Groundwater Sediment | MDMVAPPVVADLPAEVAAGMVERGEGLFVDDVTVVGTCFMIKAPL |
| Ga0184632_100102704 | 3300018075 | Groundwater Sediment | MAIPPVVADLPTEVASGWIARDAVLLDDDVTVVGMCFMIKTPL |
| Ga0184633_100079054 | 3300018077 | Groundwater Sediment | MDMVTPPVVADLTTEVAARMVEGDGGLLENDVTVAGTCFMIKTPL |
| Ga0184612_102730001 | 3300018078 | Groundwater Sediment | MDMVTPPVVADLPTEIAAGMVERGRGLLDDDVTVAGTCFMIKAPR |
| Ga0184612_104791292 | 3300018078 | Groundwater Sediment | PPVVADLPTEVAAGMVERDGRLLDDDVIVAGTCFMIKAPL |
| Ga0184627_104290841 | 3300018079 | Groundwater Sediment | ADLPTEVAAGMVERDEGLLDDDVTVAGTCFMIKAPL |
| Ga0184639_102109492 | 3300018082 | Groundwater Sediment | MDMVTPPVVADLSTEVAAGMVERDGGLLDDDVTVAGTCFMIKTPL |
| Ga0184629_100589821 | 3300018084 | Groundwater Sediment | MDMVTPPMVADLPTEVAVGMVEKDGGLLDDDVIEAGTCFMIKVPL |
| Ga0184629_101695592 | 3300018084 | Groundwater Sediment | MDMVTPPMVADLPTEVAARMVERDGRLLDDDVTVAGTYFMIKTPL |
| Ga0184629_103209741 | 3300018084 | Groundwater Sediment | MAMPPVVADLPLKVASGWVENDGVLLDDDVTVVGMCFMIKTPR |
| Ga0184629_103604451 | 3300018084 | Groundwater Sediment | MDMVTPPVVADLPTEVVAGMVERDEGLLDDDVTVAGTCFMIKTPL |
| Ga0190270_115010591 | 3300018469 | Soil | MDMVTPPVVADLPTEVAAGMVEREGRLLDDDVTVVGTYFMIKTPL |
| Ga0184648_12855751 | 3300019249 | Groundwater Sediment | MDMVTPPMVADLPTEVAVGMVGKDGGLLDDDVIEAGTCFMIKIPL |
| Ga0184648_14936511 | 3300019249 | Groundwater Sediment | MDMVTPPVVADLPTEVAAGMVERDGGLLDDDVTVAGTCFMIKAPL |
| Ga0184646_15190501 | 3300019259 | Groundwater Sediment | MDMVTPPMVADLPTEVAAGMVERDGGLLDDDVTVAGTYFMIMTPL |
| Ga0187894_1000296817 | 3300019360 | Microbial Mat On Rocks | MDMVTPPVVADLPAEVAAGMVERGGGMLDDDVTVGGVRVS |
| Ga0187893_101064361 | 3300019487 | Microbial Mat On Rocks | MDMVTPPMVADLPAEVAAGMVERDGGLFDNDVTVAGTCFMIKAPL |
| Ga0193756_10261533 | 3300019866 | Soil | MDMVTPPVVADLPAEVAAGMVERDGGLLDNDVTVAGTCFMIKAPL |
| Ga0193725_11497162 | 3300019883 | Soil | MPPVVADLPMEVASGWVENDGVLLDDDVTVVGMCFMIKTL |
| Ga0193711_10307351 | 3300019997 | Soil | MPPVVADLPMEVASGWVENDGVLLDDDVTVVGMCFMIKTLL |
| Ga0193755_10134392 | 3300020004 | Soil | MPPVVADLPMEVASGWVENDGVLLDDDVTVVGMCFMIKTPL |
| Ga0193755_10329904 | 3300020004 | Soil | MVTPPVMADLPTEVAAGTVERDGGLLDDDVTGRGVS |
| Ga0193745_10038765 | 3300020059 | Soil | MPPVVADLPMEVASGWVENDGVLLDDDVTVVGMCFMIEILL |
| Ga0180113_12996882 | 3300020065 | Groundwater Sediment | MDMVTPPVVADLPTEVASGMVERDRRLLDDDVTVVGTYFMIKTPL |
| Ga0210378_100250675 | 3300021073 | Groundwater Sediment | MAIPPVVADLPTEVASGWIARDGVLLDDDVTVVGMCFMIKTPL |
| Ga0210379_100641432 | 3300021081 | Groundwater Sediment | MAIPPVVADLPTEVASGWIEKDGVLLDDDVTVVGMCFMIKTPR |
| Ga0210377_101686604 | 3300021090 | Groundwater Sediment | MDMVTPPVVADLPTEVAAGMVERDGELLDDDVTAAGCFMIKTPL |
| Ga0210377_102120424 | 3300021090 | Groundwater Sediment | MAIPPVVADLPTEVASGWIEKDGVLLDDDVTVVGMCFMIKTPL |
| Ga0224452_11391581 | 3300022534 | Groundwater Sediment | PPVVADLPTEVASGWIARDGVLLDDDVTVVGMCFMIKTPL |
| Ga0222623_102259421 | 3300022694 | Groundwater Sediment | MDMAIPPVVADLPTEVASGWIARDGVLLDDDVTVVGMCFMIKTPL |
| Ga0209341_110597132 | 3300025325 | Soil | MDMVTPPVVADLSTEVAAGMVERDGGLLDNDVTVAGTCFMIKAPL |
| Ga0207699_109489972 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTPPLVIDLPTEIISGVVEGDGGLLDDDLTVAGTCFMIKTSL |
| Ga0207684_100749941 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDMVTPPVVADIRQRPAAGTVERNGGLPDDDVTVARTCFMIKAPL |
| Ga0207684_102401642 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDMVTPPLVIDLPTEIISGVVERDGGLLDDDLTVAGTCFMIKTPL |
| Ga0207663_108460282 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VRAMDMVTPPLVIDLPTEIISGVVERDGGLLDDDLTVAGTCFMIKTPL |
| Ga0207646_1000001025 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTPPLVIDLPTEIISGVVERDGGLLDDDLTVAGTCFMIKTPL |
| Ga0207646_101849632 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTPPVVADIRQRPAAGTVERNGGLPDDDVTVARTCFMIKAPL |
| Ga0209807_11590102 | 3300026530 | Soil | MDMAIPPVVADLPTEVASGWIEKDGLLLDDDVIVVGICFMIKTQL |
| Ga0209805_14533362 | 3300026542 | Soil | VVADLPTEVASGWIEKDGLLLDDDVIVVGICFMIKTQL |
| Ga0209161_103849301 | 3300026548 | Soil | MAIPPVVADLPTEVASGWVEKDGVLLDDDVIVVGICFMIKTQL |
| Ga0209076_12012031 | 3300027643 | Vadose Zone Soil | MDMVTPPMVADLPAEVAAGMVERDGGLLDNDVTVAGTCFMIKAPL |
| Ga0209819_101101961 | 3300027722 | Freshwater Sediment | MDMVTPPVVADLPTEVAAGMVERDGRLLDDDVTVVGTYFMIKTPL |
| Ga0137415_1000335719 | 3300028536 | Vadose Zone Soil | MDMVIPPMVADLPAEVAAGMVERDGGLLDNDVTVAGTCFMIKVPL |
| Ga0307281_100556221 | 3300028803 | Soil | MVTPPVVADLPTEVAAGTVERDGGLLDDDVTVAGCS |
| Ga0307281_104399942 | 3300028803 | Soil | MDMVTPPMVADLPTEVAAGMVERDGRLLDDDVTVAGTYF |
| Ga0247727_100147845 | 3300031576 | Biofilm | MDMVTPPVVADLTTEVAAGMVERDGGVLDVDVTVAGTCFMIKTPL |
| Ga0247727_1002076313 | 3300031576 | Biofilm | MDTVAPPVVADLPTEVAAGMVERGGGLLDDDVTVRGTCFMIKSPL |
| Ga0247727_105174852 | 3300031576 | Biofilm | MDMVTPPVVADLPTEVAAGMVERGGGLLDDDVTIAGTCFMIKTPL |
| Ga0307469_121062662 | 3300031720 | Hardwood Forest Soil | DLPAEVAAGMVERDGGLLDNDVTVAGTCFMIKAPL |
| Ga0307473_100524783 | 3300031820 | Hardwood Forest Soil | MDMVTPPVVADLPTEVAAGTVERDGGLLDDDVTVEGCFMIKTPL |
| Ga0307473_104006781 | 3300031820 | Hardwood Forest Soil | MAVPPVVADLPLKVASGWVENDGVLLDDGVIVVGMCFMIKTLL |
| Ga0315297_106244471 | 3300031873 | Sediment | MDMGTPPVVADLLTEVAAGMVERDGGLLDDDVTVAGTCFMIKTPL |
| Ga0315278_100181113 | 3300031997 | Sediment | MDMGTPPVVADLLTEVAAGMVERDGGLLDDDVTVPGTCFMINTPL |
| Ga0315281_117091292 | 3300032163 | Sediment | MDMVAPPVVADLPTEVASGMVERDGGLLDNDVTGAETCFMIKAPL |
| Ga0315283_109974233 | 3300032164 | Sediment | MDMGTPPVVADLLTEVAAGMVERDGGLLDDDVTVPG |
| Ga0307471_1004428091 | 3300032180 | Hardwood Forest Soil | MAMPPVVADLPMEVASGWAENDGVLLDDDVTVVGMCFMIKTPL |
| Ga0315271_109306812 | 3300032256 | Sediment | MVAPPVVADLPTEVASGMVERDGGLLDNDVTGAETCFMIKAPL |
| Ga0364924_041197_732_869 | 3300033811 | Sediment | MDMVTPPVVADLPTEVAAGMVEKDGGLLDDDVTVAGTYFMIKTPL |
| Ga0364924_132483_214_351 | 3300033811 | Sediment | MDMVTPPMVADLPTEVAAGMVERDGRLLDDDVTVAGTCFMIKAPL |
| Ga0364945_0038948_2_136 | 3300034115 | Sediment | MDMVTPPVVADLPTEVAAGMVERDEGLLDDDVNVAGTCFMIKAPL |
| Ga0370498_010916_957_1094 | 3300034155 | Untreated Peat Soil | MDIVTPPVVADLPREVAAGMVERDGGLLDDDVTVAGTCFMIKAPL |
| Ga0364934_0010436_395_532 | 3300034178 | Sediment | MDMVTPPVVADLPTEVAAGMVERDEGLLDDDVNVAGTCFMIKAPR |
| Ga0364943_0025986_1700_1837 | 3300034354 | Sediment | MDMVTPPVVADLPTEVAIGMVERDGRLLDDDVTVVGTYFMIKTPL |
| Ga0364941_062263_668_805 | 3300034417 | Sediment | MDMVTPPVVADLPTEVAAGMVERDEGLLDDDMTVAGTCFMIKAPL |
| Ga0364923_0014163_1587_1724 | 3300034690 | Sediment | MDMVTPPVVADLPTEVAAGMVEKDGGLLDDDVTVAGTYFMIKAPL |
| Ga0364936_009735_99_236 | 3300034773 | Sediment | MDMVTPPVVADLPTEVAAGMVERDGGLLDDDVTVAGTCFMIKTPL |
| ⦗Top⦘ |