| Basic Information | |
|---|---|
| Family ID | F052467 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 142 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VNPEERELARKNNVWGWSLLALALVLALGTAAVGLIYNAVSSY |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 142 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 66.20 % |
| % of genes near scaffold ends (potentially truncated) | 26.76 % |
| % of genes from short scaffolds (< 2000 bps) | 89.44 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.394 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.268 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.352 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.479 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.34% β-sheet: 0.00% Coil/Unstructured: 43.66% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 142 Family Scaffolds |
|---|---|---|
| PF14026 | DUF4242 | 49.30 |
| PF01040 | UbiA | 28.87 |
| PF01425 | Amidase | 7.75 |
| PF13191 | AAA_16 | 2.11 |
| PF00115 | COX1 | 1.41 |
| PF01189 | Methyltr_RsmB-F | 0.70 |
| PF02615 | Ldh_2 | 0.70 |
| PF13442 | Cytochrome_CBB3 | 0.70 |
| PF03575 | Peptidase_S51 | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
|---|---|---|---|
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 7.75 |
| COG0144 | 16S rRNA C967 or C1407 C5-methylase, RsmB/RsmF family | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.39 % |
| Unclassified | root | N/A | 17.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_21761 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300000956|JGI10216J12902_101282606 | All Organisms → cellular organisms → Bacteria | 3135 | Open in IMG/M |
| 3300001686|C688J18823_11084652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 507 | Open in IMG/M |
| 3300002568|C688J35102_119444673 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300002568|C688J35102_119539152 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300002568|C688J35102_119914640 | Not Available | 812 | Open in IMG/M |
| 3300002568|C688J35102_120901614 | All Organisms → cellular organisms → Bacteria | 2150 | Open in IMG/M |
| 3300004114|Ga0062593_100760557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 956 | Open in IMG/M |
| 3300004114|Ga0062593_101123650 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300004157|Ga0062590_101849972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 621 | Open in IMG/M |
| 3300004643|Ga0062591_100463153 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300004643|Ga0062591_100946696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 813 | Open in IMG/M |
| 3300005093|Ga0062594_100126254 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
| 3300005093|Ga0062594_100173357 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300005093|Ga0062594_103056913 | Not Available | 523 | Open in IMG/M |
| 3300005186|Ga0066676_10210123 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300005186|Ga0066676_10865781 | Not Available | 608 | Open in IMG/M |
| 3300005332|Ga0066388_100241553 | All Organisms → cellular organisms → Bacteria | 2442 | Open in IMG/M |
| 3300005332|Ga0066388_100459604 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
| 3300005332|Ga0066388_103413243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 811 | Open in IMG/M |
| 3300005356|Ga0070674_100848009 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300005365|Ga0070688_100897809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 699 | Open in IMG/M |
| 3300005435|Ga0070714_101617759 | Not Available | 633 | Open in IMG/M |
| 3300005436|Ga0070713_102472404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
| 3300005440|Ga0070705_100916466 | Not Available | 706 | Open in IMG/M |
| 3300005445|Ga0070708_101095195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 746 | Open in IMG/M |
| 3300005445|Ga0070708_102047556 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005471|Ga0070698_101566199 | Not Available | 611 | Open in IMG/M |
| 3300005526|Ga0073909_10013207 | All Organisms → cellular organisms → Bacteria | 2558 | Open in IMG/M |
| 3300005526|Ga0073909_10014747 | All Organisms → cellular organisms → Bacteria | 2443 | Open in IMG/M |
| 3300005535|Ga0070684_100711153 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300005536|Ga0070697_100520838 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300005549|Ga0070704_100488678 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300005553|Ga0066695_10886107 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005558|Ga0066698_10732749 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005617|Ga0068859_101405220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 770 | Open in IMG/M |
| 3300005713|Ga0066905_102239509 | Not Available | 510 | Open in IMG/M |
| 3300005718|Ga0068866_11131525 | Not Available | 562 | Open in IMG/M |
| 3300005764|Ga0066903_100037955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 5617 | Open in IMG/M |
| 3300005764|Ga0066903_100283563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2600 | Open in IMG/M |
| 3300005764|Ga0066903_100377583 | All Organisms → cellular organisms → Bacteria | 2314 | Open in IMG/M |
| 3300005764|Ga0066903_104373880 | Not Available | 755 | Open in IMG/M |
| 3300006804|Ga0079221_11762388 | Not Available | 506 | Open in IMG/M |
| 3300009090|Ga0099827_10077852 | All Organisms → cellular organisms → Bacteria | 2580 | Open in IMG/M |
| 3300009098|Ga0105245_11521196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 720 | Open in IMG/M |
| 3300009137|Ga0066709_101615471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 927 | Open in IMG/M |
| 3300009148|Ga0105243_11462443 | Not Available | 706 | Open in IMG/M |
| 3300009176|Ga0105242_10138826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2107 | Open in IMG/M |
| 3300009545|Ga0105237_11674895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
| 3300009553|Ga0105249_11148072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 847 | Open in IMG/M |
| 3300009840|Ga0126313_10123809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1927 | Open in IMG/M |
| 3300009840|Ga0126313_11889006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
| 3300010036|Ga0126305_10753666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 660 | Open in IMG/M |
| 3300010039|Ga0126309_10147557 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300010044|Ga0126310_10497335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 890 | Open in IMG/M |
| 3300010044|Ga0126310_10614347 | Not Available | 812 | Open in IMG/M |
| 3300010045|Ga0126311_10482228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 967 | Open in IMG/M |
| 3300010147|Ga0126319_1556558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 817 | Open in IMG/M |
| 3300010326|Ga0134065_10494299 | Not Available | 508 | Open in IMG/M |
| 3300010335|Ga0134063_10437973 | Not Available | 646 | Open in IMG/M |
| 3300010359|Ga0126376_11494212 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300010366|Ga0126379_11364505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 815 | Open in IMG/M |
| 3300010375|Ga0105239_13578727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 505 | Open in IMG/M |
| 3300010398|Ga0126383_12982559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 553 | Open in IMG/M |
| 3300011003|Ga0138514_100022790 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300012014|Ga0120159_1003028 | All Organisms → cellular organisms → Bacteria | 8777 | Open in IMG/M |
| 3300012204|Ga0137374_10063243 | All Organisms → cellular organisms → Bacteria | 3698 | Open in IMG/M |
| 3300012204|Ga0137374_10212445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1655 | Open in IMG/M |
| 3300012204|Ga0137374_10323336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1255 | Open in IMG/M |
| 3300012204|Ga0137374_10351047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1189 | Open in IMG/M |
| 3300012204|Ga0137374_11279417 | Not Available | 507 | Open in IMG/M |
| 3300012212|Ga0150985_103568344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 978 | Open in IMG/M |
| 3300012212|Ga0150985_120935994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 641 | Open in IMG/M |
| 3300012350|Ga0137372_10001432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 23017 | Open in IMG/M |
| 3300012353|Ga0137367_10118091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1949 | Open in IMG/M |
| 3300012353|Ga0137367_10261205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1244 | Open in IMG/M |
| 3300012355|Ga0137369_10227815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1423 | Open in IMG/M |
| 3300012355|Ga0137369_10474274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 889 | Open in IMG/M |
| 3300012355|Ga0137369_10629416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 743 | Open in IMG/M |
| 3300012360|Ga0137375_11065798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 630 | Open in IMG/M |
| 3300012362|Ga0137361_11959806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
| 3300012469|Ga0150984_112906863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 627 | Open in IMG/M |
| 3300012469|Ga0150984_116286869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 549 | Open in IMG/M |
| 3300012532|Ga0137373_10096153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2602 | Open in IMG/M |
| 3300012955|Ga0164298_10338026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 948 | Open in IMG/M |
| 3300012955|Ga0164298_11588345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 514 | Open in IMG/M |
| 3300012957|Ga0164303_11162192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 562 | Open in IMG/M |
| 3300012960|Ga0164301_11433886 | Not Available | 566 | Open in IMG/M |
| 3300012960|Ga0164301_11521221 | Not Available | 552 | Open in IMG/M |
| 3300012989|Ga0164305_10306785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1175 | Open in IMG/M |
| 3300013772|Ga0120158_10241468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 910 | Open in IMG/M |
| 3300014150|Ga0134081_10285420 | Not Available | 588 | Open in IMG/M |
| 3300015265|Ga0182005_1136386 | Not Available | 706 | Open in IMG/M |
| 3300015371|Ga0132258_13021734 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300015373|Ga0132257_103294006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 588 | Open in IMG/M |
| 3300016422|Ga0182039_10981350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300017997|Ga0184610_1253559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 584 | Open in IMG/M |
| 3300018061|Ga0184619_10272741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 777 | Open in IMG/M |
| 3300018072|Ga0184635_10223792 | Not Available | 748 | Open in IMG/M |
| 3300018431|Ga0066655_10597417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 743 | Open in IMG/M |
| 3300018482|Ga0066669_11638777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 589 | Open in IMG/M |
| 3300019362|Ga0173479_10374485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 677 | Open in IMG/M |
| 3300021344|Ga0193719_10358073 | Not Available | 606 | Open in IMG/M |
| 3300025899|Ga0207642_10632243 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300025922|Ga0207646_10303983 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300025922|Ga0207646_10645786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 948 | Open in IMG/M |
| 3300025922|Ga0207646_10849504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 811 | Open in IMG/M |
| 3300025922|Ga0207646_11221407 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300025927|Ga0207687_11368195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 608 | Open in IMG/M |
| 3300025933|Ga0207706_11739175 | Not Available | 501 | Open in IMG/M |
| 3300025934|Ga0207686_11045666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 664 | Open in IMG/M |
| 3300025937|Ga0207669_11210328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 640 | Open in IMG/M |
| 3300025937|Ga0207669_11645771 | Not Available | 548 | Open in IMG/M |
| 3300025938|Ga0207704_11462844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300025939|Ga0207665_10813389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 739 | Open in IMG/M |
| 3300025944|Ga0207661_10691900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 938 | Open in IMG/M |
| 3300026075|Ga0207708_10558197 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300026075|Ga0207708_11489023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300026121|Ga0207683_11092480 | Not Available | 740 | Open in IMG/M |
| 3300026327|Ga0209266_1126015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1080 | Open in IMG/M |
| 3300027821|Ga0209811_10068555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1237 | Open in IMG/M |
| 3300027821|Ga0209811_10354550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 568 | Open in IMG/M |
| 3300027882|Ga0209590_10014682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3799 | Open in IMG/M |
| 3300028381|Ga0268264_11077320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 812 | Open in IMG/M |
| 3300028716|Ga0307311_10262686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 515 | Open in IMG/M |
| 3300028720|Ga0307317_10054196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1289 | Open in IMG/M |
| 3300028771|Ga0307320_10382449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 564 | Open in IMG/M |
| 3300028807|Ga0307305_10076691 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
| 3300028828|Ga0307312_11124071 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300028875|Ga0307289_10183788 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300031421|Ga0308194_10198191 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300031543|Ga0318516_10424436 | Not Available | 765 | Open in IMG/M |
| 3300031544|Ga0318534_10110075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1580 | Open in IMG/M |
| 3300031668|Ga0318542_10426181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
| 3300031799|Ga0318565_10466747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
| 3300031821|Ga0318567_10661806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 593 | Open in IMG/M |
| 3300031938|Ga0308175_100644641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1145 | Open in IMG/M |
| 3300031938|Ga0308175_101620385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 724 | Open in IMG/M |
| 3300031996|Ga0308176_11571791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 701 | Open in IMG/M |
| 3300031996|Ga0308176_12350925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
| 3300032008|Ga0318562_10094632 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300032074|Ga0308173_10672742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 944 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.63% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.11% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.11% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.11% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.41% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.41% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.41% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.41% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.41% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.70% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.70% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.70% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.70% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_03373800 | 2199352025 | Soil | VNDQERELAHKNNVFGWSLFALALVLGLGTAAIALIYNAVSSY |
| JGI10216J12902_1012826062 | 3300000956 | Soil | VNDQERELAHKNNVFGWSLFALALVLALGTAAIALIYNAVSSY* |
| C688J18823_110846521 | 3300001686 | Soil | GAALRRHGGGRSLNPEERELARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY* |
| C688J35102_1194446732 | 3300002568 | Soil | MNPEERELARKNNVWGWSLLALVLVLALGTAAVGLIYNAVSSY* |
| C688J35102_1195391522 | 3300002568 | Soil | LNPEERELARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY* |
| C688J35102_1199146402 | 3300002568 | Soil | VNPEERELARKNNVWGWSLLALAIVLALGTAAVGLIYNAVSSY* |
| C688J35102_1209016143 | 3300002568 | Soil | VTPEERELARKNNALGWSLFALAVVLTLGTVAVALVYNAVSSS* |
| Ga0062593_1007605572 | 3300004114 | Soil | MNDQERELAHKNNVFGWSLFALALVLGLGTAAIALIYNAVSSY* |
| Ga0062593_1011236502 | 3300004114 | Soil | VSDEERELAHKNNVLGWSLFALALVLGLGTAAVALIFNAVSSY* |
| Ga0062590_1018499722 | 3300004157 | Soil | VNEEERELAHKNNVWGWSLFALALVLGLGTAAIALIFNAVSSY* |
| Ga0062591_1004631531 | 3300004643 | Soil | VNEEERELAHKNNVWGWSLFALALVLALGTVAVALIYNAVASS* |
| Ga0062591_1009466963 | 3300004643 | Soil | VNPEERELSRKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY* |
| Ga0062594_1001262542 | 3300005093 | Soil | LTPEEREIARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY* |
| Ga0062594_1001733573 | 3300005093 | Soil | VNPEERELARRNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY* |
| Ga0062594_1030569131 | 3300005093 | Soil | VNVDEERELAHKNNVWGWSLFALALVLGLGTVAVALIYNAVASS* |
| Ga0066676_102101233 | 3300005186 | Soil | ALRRDGGGRPVTPDERELAKTNNVWGWSLLALAVVIALGTVAVALIYDAVASY* |
| Ga0066676_108657812 | 3300005186 | Soil | LNPEERELARKNNVWGWSLLALAIVLALGTVAVGLIYNSVSSY* |
| Ga0066388_1002415532 | 3300005332 | Tropical Forest Soil | VTPDERELAKTNNVWGWSLLALAVVIGLGTVAVGLIYNAVSSY* |
| Ga0066388_1004596041 | 3300005332 | Tropical Forest Soil | EERELARKNNVLGWSLLALAIVLALGTVAVGLIYNAVSSS* |
| Ga0066388_1034132432 | 3300005332 | Tropical Forest Soil | VTPEERELARKNNVLGWSLLVLAIVLALGTVAVGLIYNAVSSN* |
| Ga0070674_1008480092 | 3300005356 | Miscanthus Rhizosphere | VNDQERELARRNNAFGWSLFALALALGLGTVAIALIYNAVSSY* |
| Ga0070688_1008978093 | 3300005365 | Switchgrass Rhizosphere | VTPEEQELARKNNALGWSLFALAVVLALGTIAVALIYDAVASS* |
| Ga0070714_1016177592 | 3300005435 | Agricultural Soil | VNGDERELARRNNVLGWSLLALAIVLALGTVAVGLIYNAVANG* |
| Ga0070713_1024724041 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VNPEERELARRNNTLGWSLLALAIVLALGTVAVGLIYNAVSSY* |
| Ga0070705_1009164662 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VNDQERELAHKNNVLGWSLFALALVLGLGTAAVALIYNAVSSY* |
| Ga0070708_1010951953 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPEERELARKNNVMGWSLFALALVIGLGTAAVALIYNAISSS* |
| Ga0070708_1020475562 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VNDEERELAHKNNVLGWSLFALAIVLGLGTAAVALIYNAVSSY* |
| Ga0070698_1015661991 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VNDQERELAHKNNVLGWSLFALAIVLGLGTAAVALIYNAVSSY* |
| Ga0073909_100132072 | 3300005526 | Surface Soil | VTPEERELSRRNNVLGWSLLALAVVLALGTVAVGLIFNAVSSS* |
| Ga0073909_100147473 | 3300005526 | Surface Soil | VNDQERELAHKNNVFGWSLFALALVLGLGTAAIALIYNAVSSY* |
| Ga0070684_1007111531 | 3300005535 | Corn Rhizosphere | VSPEEQELARKNNALGWSLFALAVVLALGTIAVALIYDAVASS* |
| Ga0070697_1005208382 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VNGDERELAHKNNVLGWSLFALALVLGLGTAAVALIFNAVSSY* |
| Ga0070704_1004886783 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQRSANSDEQTERDLARRNNVLGWSLFALALVLGLGTAAVALIFNAVSSS* |
| Ga0066695_108861072 | 3300005553 | Soil | VTPDERELAKTNNVWGWSLLALAVVIALGTVAVALIYDAVASY* |
| Ga0066698_107327492 | 3300005558 | Soil | VTEDEREVATRNNVLGWSLLALALVLGLGTAAVALIFNAVSSY* |
| Ga0068859_1014052203 | 3300005617 | Switchgrass Rhizosphere | ARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY* |
| Ga0066905_1022395092 | 3300005713 | Tropical Forest Soil | MTPEERELARKNNVLGWSLLALAIVLALGTVAVGLIYNAVSSN* |
| Ga0068866_111315252 | 3300005718 | Miscanthus Rhizosphere | VNEQERELARRNNAFGWSLFALALVLGLGTVAIALIYNAVSSY* |
| Ga0066903_1000379552 | 3300005764 | Tropical Forest Soil | VTPEEREIARRNNVWGWSLLAFAIVLALGTVAIGLIYNAVSSY* |
| Ga0066903_1002835633 | 3300005764 | Tropical Forest Soil | VTPEERDLARRNNVLGWSLLALAIVLALGTVAVGLIYNAVANG* |
| Ga0066903_1003775833 | 3300005764 | Tropical Forest Soil | MDEERELAHRNNVLGWSLLALAIVLALGTVAVGLIYNAVANG* |
| Ga0066903_1043738802 | 3300005764 | Tropical Forest Soil | VTRPAMTPEEQALARKNNVWGWSLLALAVVIALGTVAVALIYNSIAGS* |
| Ga0079221_117623881 | 3300006804 | Agricultural Soil | VNHPEERELARRNNVLGWSLLALAIVLALGTVAVALIYNAVATG* |
| Ga0099827_100778522 | 3300009090 | Vadose Zone Soil | VNEAERELARKNNVLGWSLFALALVLGLGTVAVALIFNAVSSY* |
| Ga0105245_115211963 | 3300009098 | Miscanthus Rhizosphere | ELARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY* |
| Ga0066709_1016154712 | 3300009137 | Grasslands Soil | VTEDGREVATRNNVLGWSLLALALVLGLGTAAVALIFNAVSSY* |
| Ga0105243_114624432 | 3300009148 | Miscanthus Rhizosphere | VNDQERELARRNNAFGWSLFALALVLGLGTVAIALIYNAVSSY* |
| Ga0105242_101388263 | 3300009176 | Miscanthus Rhizosphere | LTPEEREIARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSN* |
| Ga0105237_116748952 | 3300009545 | Corn Rhizosphere | VTPEEQELARRNNVWGWSLFALAVVLALGTAAIALIYNAVSGS* |
| Ga0105249_111480722 | 3300009553 | Switchgrass Rhizosphere | LTPEEQELARKNNALGWSLFALAVVLALGTIAVALIYNAVSSS* |
| Ga0126313_101238093 | 3300009840 | Serpentine Soil | VNPEERELARKNNVWGWSLLALALVLALGTAAVGLIYNAVSSY* |
| Ga0126313_118890062 | 3300009840 | Serpentine Soil | VTPEERELARKNNVWGWSLLALAILLALGTAAVGLIYNAVSSY* |
| Ga0126305_107536662 | 3300010036 | Serpentine Soil | VTPEERELARKNNVWGWSLLALAIVLALGTAAVGLIYNAVSSY* |
| Ga0126309_101475572 | 3300010039 | Serpentine Soil | MTPEEQEVARRNNVWGWSLFVLAVVLGLGTAAVALIYNAVSSY* |
| Ga0126310_104973353 | 3300010044 | Serpentine Soil | VNEREREIAGKNNVLGWSLLALAVVLGLGTAAVALIFNAVSSY* |
| Ga0126310_106143471 | 3300010044 | Serpentine Soil | VTSEEREIAARNNVWGWWLFALALVLGLGTVAVAFIFNAVSSY* |
| Ga0126311_104822283 | 3300010045 | Serpentine Soil | VNEHERELARKNNVWGWSLLALALVLGLGTAAVALIFNAVSSY* |
| Ga0126319_15565582 | 3300010147 | Soil | VNDQERELARRNNAFGWSLFALALLLGLGTVAIALIYNAVSSY* |
| Ga0134065_104942991 | 3300010326 | Grasslands Soil | VTPDERELAKTNNVWGWSLLALAVVIALGTVAVALIYDAVACY* |
| Ga0134063_104379731 | 3300010335 | Grasslands Soil | LNPEERELARKNNVWGWSLLALAIVLALGTVAVGLIYNSISSY* |
| Ga0126376_114942122 | 3300010359 | Tropical Forest Soil | MTPEEQELARKNNVWGWSLFALAVVLALGTTAIALIYNAVASS* |
| Ga0126379_113645052 | 3300010366 | Tropical Forest Soil | VTEPVHDEREIARRNNVLGWSLLALAIVLCLGTVAVAFIYNAVSSY* |
| Ga0105239_135787272 | 3300010375 | Corn Rhizosphere | PLNPEERELARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY* |
| Ga0126383_129825592 | 3300010398 | Tropical Forest Soil | PVTPEERDLARRNNVLGWSLLALAIVLALGTVAVGLIYNAVANG* |
| Ga0138514_1000227902 | 3300011003 | Soil | VNDAERELARKNNVLGWSLFALALVLGLGTVAVALIFNAVSSY* |
| Ga0120159_10030287 | 3300012014 | Permafrost | VNEEERALARRNNVLGWSLFALALVLGLGTAAVALIFNAVSNS* |
| Ga0137374_100632433 | 3300012204 | Vadose Zone Soil | VNDQERELARRNNIWGWSLLALALVLGLGTAAVALIYNAVSSS* |
| Ga0137374_102124451 | 3300012204 | Vadose Zone Soil | VNEQERELARKNNVWGWSLFALALVLGLGTAAVALIFNAVSSS* |
| Ga0137374_103233361 | 3300012204 | Vadose Zone Soil | RELARKNNVWGWSLFALALVLGLGTAAVALIFNAVSSS* |
| Ga0137374_103510472 | 3300012204 | Vadose Zone Soil | VTENERDLARKNNVWGWSLFALALVLGLGTAAVALIFNAVSSY* |
| Ga0137374_112794171 | 3300012204 | Vadose Zone Soil | VNDEDLARKNNVWGWSLFALALVLGLGTAAVALIFNAV |
| Ga0150985_1035683442 | 3300012212 | Avena Fatua Rhizosphere | MNPEERELSRKNNVWGWSLLALTIVLALGTAAVGLIYNAVSSY* |
| Ga0150985_1209359943 | 3300012212 | Avena Fatua Rhizosphere | ELARKNNVWGWSLLALVLVLALGTAAVGLIYNAVSSY* |
| Ga0137372_1000143224 | 3300012350 | Vadose Zone Soil | VNEHERELARENNVWGWSLFALALVLGLGTAAVALIFNAVSSY* |
| Ga0137367_101180912 | 3300012353 | Vadose Zone Soil | VNDQERELARRNNIWGWSLLALALVLGLCTAAVALIYNAVSSS* |
| Ga0137367_102612051 | 3300012353 | Vadose Zone Soil | VTKNERDLARKNNVWGWSLFALALVLGLGTAAVALIFNAVSSY* |
| Ga0137369_102278153 | 3300012355 | Vadose Zone Soil | VTKNERDLARKNNVWGWSLFALALVLGLGTAAVALIFNA |
| Ga0137369_104742743 | 3300012355 | Vadose Zone Soil | GVGRAVTKNERDLARKNNVWGWSLFALALVLGLGTAAVALIFNAVSSS* |
| Ga0137369_106294163 | 3300012355 | Vadose Zone Soil | VNDEDLARKNNVWGWSLFALALALGLGTAAVALIFNAVSSY* |
| Ga0137375_110657981 | 3300012360 | Vadose Zone Soil | NERDLARKNNVWGWSLFALALVLGLGTAAVALIFNAVSSY* |
| Ga0137361_119598061 | 3300012362 | Vadose Zone Soil | EERTLAHKNNVLGWSLFTLAIVLGLGTAAVALIYNALSSY* |
| Ga0150984_1129068631 | 3300012469 | Avena Fatua Rhizosphere | LARKNNVWGWSLLALVLVLALGTAAVGLIYNAVSSY* |
| Ga0150984_1162868691 | 3300012469 | Avena Fatua Rhizosphere | LARKNNVWGWSLLALAIVLALGTAAVGLIYNAVSSY* |
| Ga0137373_100961533 | 3300012532 | Vadose Zone Soil | RDGVGRAVTKNERDLARKNNVWGWSLFALALVLGLGTAAVALIFNAVSSY* |
| Ga0164298_103380263 | 3300012955 | Soil | RDGGRRSVTPEERELSRRNNVLGWSLLALAVVLALGTVAVGLIFNAVSSS* |
| Ga0164298_115883451 | 3300012955 | Soil | EEQELARRNNALGWSLFALAVVLALGTVAVALIYNAVSNS* |
| Ga0164303_111621923 | 3300012957 | Soil | LSRRNNVLGWSLLALAVVLALGTVAVGLIFNAVSSS* |
| Ga0164301_114338862 | 3300012960 | Soil | VSPEEQKLARKNNALGWSLFALAVVLALGTIAVALIYDAVASS* |
| Ga0164301_115212212 | 3300012960 | Soil | LSPEEQELARRNNALGWSLFALAVVLALGTVAVALIYNAVSNS* |
| Ga0164305_103067852 | 3300012989 | Soil | LSPEEQELARRNNALGWSLFALAVVLALGTIAVALIYDAVASS* |
| Ga0120158_102414683 | 3300013772 | Permafrost | VNEEERALARRNNVLGWSLFALALVLGLGTAAVALIFNAVSSS* |
| Ga0134081_102854201 | 3300014150 | Grasslands Soil | LNPEERELARKNNVWGWSLLALAIVLALGTVAVGLI |
| Ga0182005_11363862 | 3300015265 | Rhizosphere | LTPEEQELARKNNALGWSLFALALVLALGTVAVALIYDAVASS* |
| Ga0132258_130217342 | 3300015371 | Arabidopsis Rhizosphere | VNVDEERELAHKNNVWGWSLFALALAIALGTVAVALIYNAVASS* |
| Ga0132257_1032940061 | 3300015373 | Arabidopsis Rhizosphere | MTPEEQELARKNNALGWSLFALAVVLALGTVAVALIYNAVSSS* |
| Ga0182039_109813502 | 3300016422 | Soil | RRPVTPEDRELAHKNNVLGWSLLAFAIVLALATVAIGLIFNAVSSY |
| Ga0184610_12535592 | 3300017997 | Groundwater Sediment | VNDQERELAHKNNVWGWSLFALALVLGLGTAAVALIFNAVSSY |
| Ga0184619_102727413 | 3300018061 | Groundwater Sediment | NDAERELARKNNVLGWSLFALAVVLGLGTVAVALIFNALASY |
| Ga0184635_102237922 | 3300018072 | Groundwater Sediment | MNDQERELAHKNNVFGWSLFALALVLGLGTAAIALIYNAVSSY |
| Ga0066655_105974172 | 3300018431 | Grasslands Soil | LNPEERELARKNNVWGWSLLALAIVLALGTVAVGLIYNSVSSY |
| Ga0066669_116387772 | 3300018482 | Grasslands Soil | CIPGAALRRHGGGRPLNPEERELARKNNVWGWSLLALAIVLALGTVAVGLIYNSVSSY |
| Ga0173479_103744853 | 3300019362 | Soil | MTPEEQELARKNNALGWSLFALAVVLALGTVAVALIYNAVSSS |
| Ga0193719_103580732 | 3300021344 | Soil | VREDEREIARRNNVLGWSLFALAIVLGLGTAAVGLIFNALSSY |
| Ga0207642_106322432 | 3300025899 | Miscanthus Rhizosphere | VNEQERELARRNNAFGWSLFALALVLGLGTVAIALIYNAVSSY |
| Ga0207646_103039832 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VNDEERELAHKNNVLGWSLFALAIVLGLGTAAVALIYNAVSSY |
| Ga0207646_106457862 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VNGDERELAHKNNVLGWSLLALALVLGLGTAAVALIFNAVSSY |
| Ga0207646_108495042 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VNDQERELAHKNNVLGWWLFALALVLGLGTAAVALIYNAVSSY |
| Ga0207646_112214072 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPEERELARKNNVMGWSLFALALVIGLGTAAVALIYNAISSS |
| Ga0207687_113681953 | 3300025927 | Miscanthus Rhizosphere | ELARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY |
| Ga0207706_117391752 | 3300025933 | Corn Rhizosphere | VNDQERELARRNNAFGWSLFALALVLGLGTVAIALIYNAVSSY |
| Ga0207686_110456661 | 3300025934 | Miscanthus Rhizosphere | ARRNNAFGWSLFALALVLGLGTVAIALIYNAVSSY |
| Ga0207669_112103281 | 3300025937 | Miscanthus Rhizosphere | VNDQERELARRNNAFGWSLFALALALGLGTVAIALIYNAVSSY |
| Ga0207669_116457711 | 3300025937 | Miscanthus Rhizosphere | LTPEEREIARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSN |
| Ga0207704_114628442 | 3300025938 | Miscanthus Rhizosphere | VRRHGGRRSVNPDERELARKNNVWGWSLLALAIVLALGTAAVGLIYNAVSSY |
| Ga0207665_108133891 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ERELARRNNVLGWSLFALAIVLALGTVAVGLIYNAVANG |
| Ga0207661_106919002 | 3300025944 | Corn Rhizosphere | VNPEERELARRNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY |
| Ga0207708_105581972 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VNVDEERELARKNNVWGWSLFALALVLGLGTVAVALIYNAVASS |
| Ga0207708_114890232 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LPRAALRRHGGGRPLNPEERELARKNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY |
| Ga0207683_110924802 | 3300026121 | Miscanthus Rhizosphere | VNPDERELARKNNVWGWSLLALAIVLALGTAAVGLIYNAVSSY |
| Ga0209266_11260152 | 3300026327 | Soil | VTPDERELAKTNNVWGWSLLALAVVIALGTVAVALIYDAVASY |
| Ga0209811_100685553 | 3300027821 | Surface Soil | LRRDGGRRPVTPEERELSRRNNVLGWSLLALAVVLALGTVAVGLIFNAVSSS |
| Ga0209811_103545502 | 3300027821 | Surface Soil | VNDQERELAHRNNVFGWWLFALALILGLGTAAVALIYNAVSSY |
| Ga0209590_100146823 | 3300027882 | Vadose Zone Soil | VNEAERELARKNNVLGWSLFALALVLGLGTVAVALIFNAVSSY |
| Ga0268264_110773202 | 3300028381 | Switchgrass Rhizosphere | VSPEEQELARKNNALGWSLFALAVVLALGTIAVALIYDAVASS |
| Ga0307311_102626862 | 3300028716 | Soil | VNDAERELARKNNVLGWSLFALAVVLGLGTVAVALIFNALASY |
| Ga0307317_100541963 | 3300028720 | Soil | VPMTPEEQELARKNNALGWSLFALAVVLALGTVAVALIYNAVSSS |
| Ga0307320_103824491 | 3300028771 | Soil | ALRPDGGGRPVTPEEREIARRNNVWGWSLLALAIVLALGTVAVGLIYNAVSSY |
| Ga0307305_100766913 | 3300028807 | Soil | VNDAERELARKNNVLGWSLFALALVLGLGTVAVALIFNAVASY |
| Ga0307312_111240712 | 3300028828 | Soil | VNDAERELARKNNVLGWSLFALALVLGLGTVAVALIFNAVSNS |
| Ga0307289_101837881 | 3300028875 | Soil | LNPEERELARKNNVWGWSLLALVLVLALGTAAVGLIYNA |
| Ga0308194_101981912 | 3300031421 | Soil | VNDAERELARKNNVLGWSLFALAVVLGLGTVAVALIFNAVSSY |
| Ga0318516_104244362 | 3300031543 | Soil | VTRPAMTPEEQALARKNNVWGWSLLALAVVIALGTVAVALIYNSIAG |
| Ga0318534_101100753 | 3300031544 | Soil | VTPEDRELAHKNNVLGWSLLAFAIVLALATVAIGLIFNAVSSY |
| Ga0318542_104261812 | 3300031668 | Soil | VTRPAMTPEEQALARKNNVWGWSLLALAVVIALGTVAVALIYNSIAGS |
| Ga0318565_104667472 | 3300031799 | Soil | AVTRPAMTPEEQALARKNNVWGWSLLALAVVIALGTVAVALIYNSIAGS |
| Ga0318567_106618061 | 3300031821 | Soil | LAHKNNVLGWSLLAFAIVLALATVAIGLIFNAVSSY |
| Ga0308175_1006446412 | 3300031938 | Soil | VNPEERELARKNNVWGWSLLALAIALALGTAAVGLIYNAVSSY |
| Ga0308175_1016203853 | 3300031938 | Soil | VNPEERELARRNNVWGWSLLALAIVLALGTVAIGYIFNAVSSY |
| Ga0308176_115717913 | 3300031996 | Soil | VNPEERELSRKNNVWGWSLLALAVVLALGTAAVGLIYNAVSSY |
| Ga0308176_123509252 | 3300031996 | Soil | VTPEEREVARKNNALGWSLFALAVVLTLGTVAVALVYNAVSGS |
| Ga0318562_100946323 | 3300032008 | Soil | MTPEEQALARKNNVWGWSLLALAVVIALGTVAVALIYNSIAGS |
| Ga0308173_106727422 | 3300032074 | Soil | VNPEERELSRKNNVWGWSLLALAIVLALGTAAVGLIYNAVSSY |
| ⦗Top⦘ |