| Basic Information | |
|---|---|
| Family ID | F052449 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 142 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MAGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDQLRRR |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 142 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 56.34 % |
| % of genes near scaffold ends (potentially truncated) | 42.25 % |
| % of genes from short scaffolds (< 2000 bps) | 89.44 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (14.789 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.549 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.268 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 142 Family Scaffolds |
|---|---|---|
| PF02780 | Transketolase_C | 59.86 |
| PF07883 | Cupin_2 | 2.82 |
| PF04542 | Sigma70_r2 | 2.11 |
| PF08548 | Peptidase_M10_C | 0.70 |
| PF11177 | DUF2964 | 0.70 |
| PF14015 | DUF4231 | 0.70 |
| PF13520 | AA_permease_2 | 0.70 |
| PF13466 | STAS_2 | 0.70 |
| PF04545 | Sigma70_r4 | 0.70 |
| PF07676 | PD40 | 0.70 |
| PF03793 | PASTA | 0.70 |
| PF01176 | eIF-1a | 0.70 |
| PF02618 | YceG | 0.70 |
| PF01619 | Pro_dh | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.11 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 2.11 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 2.11 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 2.11 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 0.70 |
| COG1559 | Endolytic transglycosylase MltG, terminates peptidoglycan polymerization | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
| COG2931 | Ca2+-binding protein, RTX toxin-related | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.00 % |
| Unclassified | root | N/A | 50.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 14.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 8.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.23% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.82% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.11% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.11% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.11% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.11% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.11% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.41% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.70% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.70% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_09030842 | 2228664021 | Soil | MSGVLIVSAVLALGGVVVWIVLLLWAAREDGRDQERRDGVRRD |
| ICChiseqgaiiDRAFT_06259031 | 3300000033 | Soil | VTAILVFSTVVAMIGIVAWIVFLLWAAREDGRDQERRDQALAEVDGS |
| ICChiseqgaiiFebDRAFT_107802133 | 3300000363 | Soil | MAGILILSAVLALGGAVVWIALLLWAAREDGRDQKRRDQLRRR* |
| JGI10216J12902_1006734062 | 3300000956 | Soil | SFGNNRDMREILIAAVFVSLAGVVAYIGLLLWAAREDGREQRRRDSLRGR* |
| JGI10216J12902_1049722123 | 3300000956 | Soil | MAGILILSAVLAIGGVVVWIALLLWAAREDGRDQERRDGLRRD* |
| JGI10216J12902_1128031722 | 3300000956 | Soil | VREILIISAALSLAGAFAYIALLLWAAREDGRDQQRREWLRGR* |
| JGI24738J21930_101082032 | 3300002075 | Corn Rhizosphere | MAGILILSAVLALGGXVVWIALLLWAAREDGRXQERRDQLRRR* |
| Ga0055467_101017772 | 3300003996 | Natural And Restored Wetlands | MTGILILSAVLALGGAVVWIALLLWAAREDGRDQERRDELHGH* |
| Ga0062593_1018393111 | 3300004114 | Soil | VMSGILIVSAVLALGGVVVWIVLLLWAAREDGRDQERRDGVRRD* |
| Ga0062593_1031144302 | 3300004114 | Soil | MTGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDELRGH* |
| Ga0062590_1013890312 | 3300004157 | Soil | MSGILIVSAVLALGGVVVWIVLLLWAAREDGRDQERRDAARRD* |
| Ga0063356_1009638092 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VREILIIFAALSLAGALVYLGLLLWAAREDGRDQQRREWLRGR* |
| Ga0063356_1014520412 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDELREH* |
| Ga0063356_1023661892 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDELRGP* |
| Ga0066815_100049701 | 3300005164 | Soil | MAGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDQLRRR* |
| Ga0070658_101000182 | 3300005327 | Corn Rhizosphere | MTGILILSAVVALGGVVVWIALLLWAAREDGRDQERRDELRGH* |
| Ga0070658_102628451 | 3300005327 | Corn Rhizosphere | MAGILILSAVLALGGAVVWIALLLWAAREDGRDQERRDQLRRR* |
| Ga0070690_1001322031 | 3300005330 | Switchgrass Rhizosphere | LIVSAVLALGGVVVWIALLLWAAREDGRDQERRDQLRRR* |
| Ga0066388_1007014782 | 3300005332 | Tropical Forest Soil | VREILVVSALLGLVGVAVWIALLVWAARADGRDQERRDRLRPR* |
| Ga0070682_1002125981 | 3300005337 | Corn Rhizosphere | TGILILSAVVALGGVVVWIALLLWAAREDGRDQERRDELRGH* |
| Ga0068868_1000626137 | 3300005338 | Miscanthus Rhizosphere | MAGILVLSAVLALGGAVVWIALLLWAAREDGRDQERRDQLRRR* |
| Ga0070660_1011393342 | 3300005339 | Corn Rhizosphere | MAWILIVSAVLALGGVVVWIVLLLWAAREDGRDQERRDAARRD* |
| Ga0070691_103005281 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | RRFPRRIRWDTRMMAGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDRLRRP* |
| Ga0070692_101011881 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | IRWDTRVMAGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDQLRRR* |
| Ga0070674_1000282241 | 3300005356 | Miscanthus Rhizosphere | SCPEPRRIRWDTRVMSGILIVSAVLALGGVVVWIALLLWAAREDGRDQERRDQLRRR* |
| Ga0070659_1010063461 | 3300005366 | Corn Rhizosphere | LPRRIRWDTRVMSGILIVSAVLALGGVVVWIVLLLWAAREDGRDQERRDELRGH* |
| Ga0070703_101820691 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGILILSAVLALGGVVVWIVLLLWAAREDGRDQERRDRLRRP* |
| Ga0070701_102772951 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | PPGWDTRVMAGILILSAVLALGGAVVWIALLLWAAREDGRDQERRDQLRRR* |
| Ga0070700_1014619541 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDRLRRP* |
| Ga0070694_1006444772 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VMAGILILSAVLALGGAVVWIALLLWAAREDGRDQERRDQLRRR* |
| Ga0070663_1000695761 | 3300005455 | Corn Rhizosphere | MSGILIVSAVLALGGVVVWIALLLWAAREDGRDQERRDQLRRR* |
| Ga0070685_113924912 | 3300005466 | Switchgrass Rhizosphere | LIVSAVLALGGVVVWIVLLLWAAREDGRDQERRDALRRD* |
| Ga0070684_1002929582 | 3300005535 | Corn Rhizosphere | ILILSAVVALGGVVVWIALLLWAAREDGRDQERRDELRGH* |
| Ga0070684_1003106412 | 3300005535 | Corn Rhizosphere | MSGILIVSAVLALGGVVVWIVLLLWAAREDGRDQERRDGVRRD* |
| Ga0070686_1016092221 | 3300005544 | Switchgrass Rhizosphere | RVRWDTRVMAGILILSAVLALGGAVVWIALLLWAAREDGRDQERRDQLRRR* |
| Ga0070693_1001534721 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | GWDTRVMAGILILSAVLALGGAVVWIALLLWAAREDGRDQERRDQLRRR* |
| Ga0070664_1008535482 | 3300005564 | Corn Rhizosphere | RLPRRIRWDTRVMSGILIVSAVLALGGVVVWIVLLLWAAREDGRDQERRDGVRRD* |
| Ga0068856_1016649461 | 3300005614 | Corn Rhizosphere | MAGILILSAVLALGGAVVWIALLLWAAREDGRDQERRDQLHRR* |
| Ga0068864_1009679842 | 3300005618 | Switchgrass Rhizosphere | MAWILIVSAVLALGGVVVWIVLLLWAAREDGRDQERRDGLRRD* |
| Ga0068866_108969652 | 3300005718 | Miscanthus Rhizosphere | MRELVIVSAALSLAGALVYIALLLWAAREDGRDQARREWLRGR* |
| Ga0068860_1003286521 | 3300005843 | Switchgrass Rhizosphere | ILVLSAVLALGGAVVWIALLLWAAREDGRDQERRDQLRRR* |
| Ga0075428_1002521243 | 3300006844 | Populus Rhizosphere | MIVSAFVGLAGVLVWIGLLVWAAREDGRDQRRRDYLRGR* |
| Ga0068865_1004803951 | 3300006881 | Miscanthus Rhizosphere | LRPFGCDTRGMTGILILSAVVALGGVVVWIALLLWAAREDGRDQERRDELRGH* |
| Ga0068865_1021589452 | 3300006881 | Miscanthus Rhizosphere | MRELVIVSAALSLAGSLVYIALLLWAAREDGRDQARREWLRGR* |
| Ga0079216_106725901 | 3300006918 | Agricultural Soil | VSAVLSLAGVLVYLGLLLWAAREDGRDQARRDWLRGR* |
| Ga0079218_100244902 | 3300007004 | Agricultural Soil | VSVGGFRPPRAGQNSRVRELMIVSAVLSLATVLVYLGLLLWAAREDGRDQARRDWLRGR* |
| Ga0105240_111349982 | 3300009093 | Corn Rhizosphere | MSGILIVSAVLALGGVVVWIALLLWAAREDGRDQERRDELRGH* |
| Ga0111539_100431222 | 3300009094 | Populus Rhizosphere | MMAGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDRLRRP* |
| Ga0105245_105778062 | 3300009098 | Miscanthus Rhizosphere | MMAGILILSAVLARGGVVVWIALLLWAAREDGRDQERRDRLRRP* |
| Ga0105237_115883122 | 3300009545 | Corn Rhizosphere | MAGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDQPVVAETTR* |
| Ga0105238_100647466 | 3300009551 | Corn Rhizosphere | MTGILILSAVVALAGVVVWIALLLWAAREDGRDQERRDELR |
| Ga0105249_106730021 | 3300009553 | Switchgrass Rhizosphere | MAWILIVSAVLALGGVVVWIVLLLWAAREDGRDQERRDALRRD* |
| Ga0134125_105049903 | 3300010371 | Terrestrial Soil | MTGILILSTVVALGGVVVWIALLLWAAREDGRDQERRDELRGH* |
| Ga0134123_109187371 | 3300010403 | Terrestrial Soil | PRRIRWDTRVMAGILILSAVLALGGVVVWIALLLWAARQDGRDQERRDQLRRR* |
| Ga0134123_134753732 | 3300010403 | Terrestrial Soil | MRELVIVSAVLSLAGALAYIALLLWAAREDGRDQARREWLRGR* |
| Ga0127502_105465593 | 3300011333 | Soil | MIVSAVLSLATVLVYLGLLLWAAREDGRDQARRDWLRGR* |
| Ga0137326_11066292 | 3300011417 | Soil | VREILIISAALSLAGAFVYIALLLWAAREDGRDQQRREWLRGR* |
| Ga0157291_102839092 | 3300012902 | Soil | VTGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDELREH* |
| Ga0157302_100149693 | 3300012915 | Soil | MEYSGVMTGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDELRGP* |
| Ga0164241_100220607 | 3300012943 | Soil | MTGILILFAVLALGGVVVWIVLLLWAAREDGRDQERRDQLRGP* |
| Ga0164241_104335952 | 3300012943 | Soil | MTGSLILSAVLALGGVVVWIVLLLWAAREDGRDQERRDQLRDH* |
| Ga0164241_114437362 | 3300012943 | Soil | MEYSGVMTGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDQLRGH* |
| Ga0164302_101773493 | 3300012961 | Soil | MAGILILSAVLALGGVVVWISLLLWAAREDGRDQERRDQLRRR* |
| Ga0157373_109833801 | 3300013100 | Corn Rhizosphere | MAGILILSAVLALGGVVVSIALLLWAAREDGRDQERRDRLRRP* |
| Ga0157371_103224483 | 3300013102 | Corn Rhizosphere | MREALAISAVVGLLTVLVWIALLLWAAREDGRDQERRDR |
| Ga0157378_126001781 | 3300013297 | Miscanthus Rhizosphere | MTGILILSAVVALGGVVVWIALLLWAAREDGRDQGRRDELRGH |
| Ga0163162_118539891 | 3300013306 | Switchgrass Rhizosphere | MTGILILSPVVALGGNNVWIALLLWAAREDGRDQERRDELRGH* |
| Ga0157380_133848472 | 3300014326 | Switchgrass Rhizosphere | MAGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDQLRRP* |
| Ga0157377_101636305 | 3300014745 | Miscanthus Rhizosphere | MTGILIMSAVVALGGVVVWIALLLWAAREDGRDQERRDELRGH* |
| Ga0132258_100713083 | 3300015371 | Arabidopsis Rhizosphere | VREVLAISALIGLLGVVVWIALLLWAAREDGRDQERRNRDLPPR* |
| Ga0132258_111444054 | 3300015371 | Arabidopsis Rhizosphere | MTGILVLSAVLAVGGVVVWIALLLWAAREDGRDQERRDELQNR* |
| Ga0132258_112750372 | 3300015371 | Arabidopsis Rhizosphere | MIVSAFVGLAGVVLWIGLLLWAAREDGRDQQRRDYLRGR* |
| Ga0190266_103345992 | 3300017965 | Soil | VREILIISAALSLAGAFVYIALLLWAAREDGRDQQRREWLRGR |
| Ga0190268_104674092 | 3300018466 | Soil | VREILIISAALSLVGAFVYIALLLWAAREDGRDQQRREWLRGR |
| Ga0190268_120240452 | 3300018466 | Soil | VREIMIISAALGLAGALVYIALLLWAAREDGRDQERREWLRGR |
| Ga0190270_101684732 | 3300018469 | Soil | VREALIISAALSLAGAFVYIALLLWAAREDGRDQQRREWLRGR |
| Ga0190270_127657952 | 3300018469 | Soil | VREILIISAALSLAGALVYIALLLWAAREDGRDQQRREWLRGR |
| Ga0190271_103340343 | 3300018481 | Soil | VREILIISAVLSLAGAFVYIALLLWAAREDGRDQQRREWLRGR |
| Ga0190271_106472822 | 3300018481 | Soil | VREILIISAALSLAGAIVYIALLLWAAREDGRDQHRREWLRGR |
| Ga0190271_111140233 | 3300018481 | Soil | MIVSAVLSLAGVLVYLGLLLWAAREDGRDQARRDWLRGR |
| Ga0173481_100120335 | 3300019356 | Soil | MSGILIVSAVLALGGVVVWIVLLLWAAREDGRDQERRDAARRD |
| Ga0173482_105518172 | 3300019361 | Soil | MIVSAFVGLAGVLVWIGLLVWAAREDGRDQRRRDYLRGR |
| Ga0173479_100130602 | 3300019362 | Soil | MTGILILSAVVALGGVVVWIALLLWAAREDGRDQERRDELRGH |
| Ga0206353_116074052 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | SAVVALGGVVVWIALLLWAAREDGRDQERRDELRGH |
| Ga0247792_10128441 | 3300022880 | Soil | MTGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDELRGP |
| Ga0247787_10092901 | 3300022893 | Soil | TRGMTGILILSAVVALGGVVVWIALLLWAAREDGRDQERRDELRGH |
| Ga0247788_10470801 | 3300022901 | Soil | MSGILIVSAVLALGGVVVWIVLLLWAAREDGRDQERRDGVRRD |
| Ga0247790_101718302 | 3300022915 | Soil | VTAILVFSTVVAMLGIVVWIVFLLWAAREDGRDQEQRDRALA |
| Ga0207682_100570312 | 3300025893 | Miscanthus Rhizosphere | MAGILVLSAVLALGGAVVWIALLLWAAREDGRDQERRDQLRRR |
| Ga0207642_103730521 | 3300025899 | Miscanthus Rhizosphere | MAGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDQLRRR |
| Ga0207642_105776562 | 3300025899 | Miscanthus Rhizosphere | MRELVIVSAALSLAGALVYIALLLWAAREDGRDQARREWLRGR |
| Ga0207647_101501115 | 3300025904 | Corn Rhizosphere | MMAGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDRL |
| Ga0207643_102421272 | 3300025908 | Miscanthus Rhizosphere | MAGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDRLRRP |
| Ga0207643_104970621 | 3300025908 | Miscanthus Rhizosphere | GRLPRRIRWDTRVMAWILIVSAVLALGGVVVWIVLLLWAAREDGRDQERRDALRRD |
| Ga0207654_114204002 | 3300025911 | Corn Rhizosphere | CDTRGMTGILILSAVVALGGVVVWIALLLWAAREDGRDQERRDELRGH |
| Ga0207707_104868821 | 3300025912 | Corn Rhizosphere | VTEVLIFSTVVALVGIVVWIVLLLWAAREDGRDQERRDRAGAT |
| Ga0207707_107947321 | 3300025912 | Corn Rhizosphere | ILILSAVVALGGVVVWIALLLWAAREDGRDQERRDELRGH |
| Ga0207657_100515592 | 3300025919 | Corn Rhizosphere | MAGILILSAVLALGGAVVWIALLLWAAREDGRDQERRDQLRRR |
| Ga0207694_102183042 | 3300025924 | Corn Rhizosphere | MAGILILSAVLALGGAVVWIALLLGAAREDGRDQERRDQLRRR |
| Ga0207659_101018371 | 3300025926 | Miscanthus Rhizosphere | IRWDTRVMAGILVLSAVLALGGAVVWIALLLWAAREDGRDQERRDQLRRR |
| Ga0207687_103578562 | 3300025927 | Miscanthus Rhizosphere | TGILILSAVVALGGVVVWIALLLWAAREDGRDQERRDELRGH |
| Ga0207687_105060071 | 3300025927 | Miscanthus Rhizosphere | SHAPPGWDTRVMAGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDQLRRR |
| Ga0207687_106530522 | 3300025927 | Miscanthus Rhizosphere | PRRIRWDTRVMSGILIVSAVLALGGVVVWIVLLLWAAREDGRDQERRDGVRRD |
| Ga0207701_105876693 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGILILSAVLTLGGVVVWIALLLWAAREDGRDQERRDELRGH |
| Ga0207701_114504772 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | AASGGILGVMAGILILSAVLALGGAVVWIALLLWAAREDGRDQERRDQLRRR |
| Ga0207669_111083312 | 3300025937 | Miscanthus Rhizosphere | MRELVIVSAALSLAGSLVYIALLLWAAREDGRDQARREWLRGR |
| Ga0207704_101787342 | 3300025938 | Miscanthus Rhizosphere | MTGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDELRGH |
| Ga0207711_120812222 | 3300025941 | Switchgrass Rhizosphere | GILVLSAVLALGGAVVWIALLLWAAREDGRDQERRDQLRRR |
| Ga0207689_110165981 | 3300025942 | Miscanthus Rhizosphere | LIVSAVLALGGVVVWIVLLLWAAREDGRDQERRDAARRD |
| Ga0207679_105883271 | 3300025945 | Corn Rhizosphere | ILIVSAVLALGGVVVWIVLLLWAAREDGRDQERRDGVRRD |
| Ga0207712_105757702 | 3300025961 | Switchgrass Rhizosphere | MMAGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDRLRRP |
| Ga0207640_105616654 | 3300025981 | Corn Rhizosphere | MAGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDQ |
| Ga0207677_100696802 | 3300026023 | Miscanthus Rhizosphere | VMAGILILSAVLALGGAVVWIALLLWAAREDGRDQERRDQLRRR |
| Ga0207677_103337572 | 3300026023 | Miscanthus Rhizosphere | MAGILILSAALALGGVVVWIALLLWAAREDGRDQERRDQLRRR |
| Ga0207708_110004331 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | IRWDTRVMSGILIVSAVLALGGVVVWIVLLLWAARGDGRDQERRDAARRD |
| Ga0207641_107336731 | 3300026088 | Switchgrass Rhizosphere | RIRWDTRVMAGILILSAVLALGGAVVWIALLLWAAREDGRDQERRDQLRRR |
| Ga0209485_12828231 | 3300027691 | Agricultural Soil | VSAVLSLAGVLVYLGLLLWAAREDGRDQARRDWLRGR |
| Ga0209966_10354305 | 3300027695 | Arabidopsis Thaliana Rhizosphere | MTGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDELREH |
| Ga0207428_106420921 | 3300027907 | Populus Rhizosphere | IRWDTRVMAWILIVSAVLALGGVVVWIVLLLWAAREDGRDQERRDGLRRD |
| Ga0268264_111371883 | 3300028381 | Switchgrass Rhizosphere | GCDTRGMTGILILSAVVALGGVVVWIALLLWAAREDGRDQERRDELRGH |
| Ga0247828_101216702 | 3300028587 | Soil | VREILIIFAALSLAGALVYLGLLLWAAREDGRDQQRREWLRGR |
| Ga0247822_105890082 | 3300028592 | Soil | VREILIISAALSLAGALVYLALLLWAAREDGRDQQRREWLRGR |
| Ga0247822_106691141 | 3300028592 | Soil | WDTRVMTAILILSAVVALGGVVVWIALLLWAAREDGRDQKRRDQTRN |
| Ga0247820_108934951 | 3300028597 | Soil | IMAGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDRLRRP |
| Ga0247820_114471932 | 3300028597 | Soil | MTAILILSALVTLGGVVVWIALLLWAAREDGRDQKRRDQTRNY |
| Ga0247824_101768522 | 3300028809 | Soil | RSPVREILIIFAALSLAGALVYLGLLLWAAREDGRDQQRREWLRGR |
| Ga0247825_102601472 | 3300028812 | Soil | MTAILILSALVALGGVVVWIALLLWAAREDGRDQKRRDQTRN |
| Ga0247826_111715261 | 3300030336 | Soil | VQEILIISAALSLAGALVYIALLLWAAREDGRDQQRRDWLRGR |
| Ga0310887_102565491 | 3300031547 | Soil | MIVSAFVGLAGVLVWIGLLLWAAREDGRDQQRREYLRGR |
| Ga0310907_100216992 | 3300031847 | Soil | MVILSAVLALGGVVVWIALLLWAAREDGRDQERRDQLRRR |
| Ga0310907_102808592 | 3300031847 | Soil | VREILFISAALSLAGALVYLALLLWAAREDGRDQQRREWLRGR |
| Ga0308175_1008475861 | 3300031938 | Soil | RESRCDTQVVTGVLILSAALALGGVVVWIVLLLWAAREDGRDQERRDELRGH |
| Ga0310884_110095602 | 3300031944 | Soil | WDTRIMAGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDRLRRP |
| Ga0308176_104698382 | 3300031996 | Soil | VTGVLILSAVLALGGVVVWIVLLLWAAREDGRDQERRDELRGH |
| Ga0307416_1037494681 | 3300032002 | Rhizosphere | VREILIASAFLSLAGVLAYIGLLLWAAREDGRDQQRRDWLRGR |
| Ga0310890_103992132 | 3300032075 | Soil | KRRFPRRIRWDTRIMAGILILSAVLALGGVVVWIALLLWAAREDGRDQERRDRLRRP |
| Ga0310890_117192982 | 3300032075 | Soil | MRELVIVSAALGLAGALAYIALLLWAAREDGRDQARREWLRGR |
| Ga0310889_101114542 | 3300032179 | Soil | RVMAGILVLSAVLALGGAVVWIALLLWAAREDGRDQERRDQLRRR |
| Ga0310889_102352331 | 3300032179 | Soil | MRELVIVSAVLSLAGALAYIALLLWAAREDGRDQARREWLRGR |
| Ga0247829_117097902 | 3300033550 | Soil | GNNRPMRELVIVSAALSLAGSLVYIALLLWAAREDGRDQARREWLRGR |
| Ga0247830_104325591 | 3300033551 | Soil | VQEILIISAALSLAGALVYIALLLWAAREDGRDQQRRDWL |
| Ga0247830_107088591 | 3300033551 | Soil | ILILSAVVALGGVVVWIALLLWAAREDGRDQKRRDQTRN |
| ⦗Top⦘ |