| Basic Information | |
|---|---|
| Family ID | F052415 |
| Family Type | Metagenome |
| Number of Sequences | 142 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKWLLVIFMLLPGSSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 142 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 45.77 % |
| % of genes near scaffold ends (potentially truncated) | 55.63 % |
| % of genes from short scaffolds (< 2000 bps) | 66.90 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (52.817 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (46.479 % of family members) |
| Environment Ontology (ENVO) | Unclassified (73.944 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (79.577 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 10.26% β-sheet: 23.08% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 142 Family Scaffolds |
|---|---|---|
| PF13759 | 2OG-FeII_Oxy_5 | 7.75 |
| PF00959 | Phage_lysozyme | 7.04 |
| PF16778 | Phage_tail_APC | 5.63 |
| PF07603 | DUF1566 | 3.52 |
| PF13884 | Peptidase_S74 | 2.82 |
| PF09374 | PG_binding_3 | 2.11 |
| PF00041 | fn3 | 1.41 |
| PF01370 | Epimerase | 1.41 |
| PF01583 | APS_kinase | 0.70 |
| PF02012 | BNR | 0.70 |
| PF08291 | Peptidase_M15_3 | 0.70 |
| PF06739 | SBBP | 0.70 |
| PF13469 | Sulfotransfer_3 | 0.70 |
| PF00166 | Cpn10 | 0.70 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.70 |
| PF12810 | Gly_rich | 0.70 |
| PF05838 | Glyco_hydro_108 | 0.70 |
| PF02311 | AraC_binding | 0.70 |
| PF07460 | NUMOD3 | 0.70 |
| PF13392 | HNH_3 | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.70 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.70 |
| COG3926 | Lysozyme family protein | General function prediction only [R] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.13 % |
| Unclassified | root | N/A | 28.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_108947080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300002408|B570J29032_109169368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300002408|B570J29032_109314622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium | 686 | Open in IMG/M |
| 3300002835|B570J40625_100011075 | Not Available | 16312 | Open in IMG/M |
| 3300003277|JGI25908J49247_10032983 | Not Available | 1451 | Open in IMG/M |
| 3300003277|JGI25908J49247_10037063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
| 3300003393|JGI25909J50240_1009409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2387 | Open in IMG/M |
| 3300005525|Ga0068877_10705799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300005527|Ga0068876_10367293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
| 3300005527|Ga0068876_10414549 | Not Available | 749 | Open in IMG/M |
| 3300005527|Ga0068876_10601189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
| 3300005528|Ga0068872_10452119 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 694 | Open in IMG/M |
| 3300005581|Ga0049081_10002985 | Not Available | 6385 | Open in IMG/M |
| 3300005581|Ga0049081_10051092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1565 | Open in IMG/M |
| 3300005582|Ga0049080_10134665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
| 3300005942|Ga0070742_10215370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300006030|Ga0075470_10002162 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6110 | Open in IMG/M |
| 3300006920|Ga0070748_1339593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300007603|Ga0102921_1244811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300007708|Ga0102859_1135078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300007735|Ga0104988_10568 | Not Available | 18009 | Open in IMG/M |
| 3300008107|Ga0114340_1006032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7903 | Open in IMG/M |
| 3300008266|Ga0114363_1087281 | Not Available | 1149 | Open in IMG/M |
| 3300008266|Ga0114363_1099398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1049 | Open in IMG/M |
| 3300008267|Ga0114364_1011400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4044 | Open in IMG/M |
| 3300008267|Ga0114364_1031735 | All Organisms → Viruses → Predicted Viral | 2062 | Open in IMG/M |
| 3300008267|Ga0114364_1037771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1830 | Open in IMG/M |
| 3300008267|Ga0114364_1086124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1015 | Open in IMG/M |
| 3300008448|Ga0114876_1021977 | Not Available | 3287 | Open in IMG/M |
| 3300008448|Ga0114876_1200460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300009068|Ga0114973_10428259 | Not Available | 690 | Open in IMG/M |
| 3300009164|Ga0114975_10573833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300009180|Ga0114979_10134222 | All Organisms → Viruses → Predicted Viral | 1519 | Open in IMG/M |
| 3300009194|Ga0114983_1124919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300010160|Ga0114967_10036251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3243 | Open in IMG/M |
| 3300010885|Ga0133913_10022153 | Not Available | 16973 | Open in IMG/M |
| 3300010885|Ga0133913_10703362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2644 | Open in IMG/M |
| 3300010885|Ga0133913_13023318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1120 | Open in IMG/M |
| 3300011113|Ga0151517_1658 | Not Available | 11603 | Open in IMG/M |
| 3300011115|Ga0151514_10873 | Not Available | 12236 | Open in IMG/M |
| 3300011334|Ga0153697_1029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 44915 | Open in IMG/M |
| 3300011334|Ga0153697_1311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15760 | Open in IMG/M |
| 3300012013|Ga0153805_1074845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300013004|Ga0164293_10552334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 754 | Open in IMG/M |
| 3300013005|Ga0164292_10268538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter xylosoxidans | 1179 | Open in IMG/M |
| 3300013372|Ga0177922_10008390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300015050|Ga0181338_1006568 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1960 | Open in IMG/M |
| 3300015050|Ga0181338_1021292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1013 | Open in IMG/M |
| 3300017701|Ga0181364_1030571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
| 3300017716|Ga0181350_1007057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3226 | Open in IMG/M |
| 3300017716|Ga0181350_1008837 | Not Available | 2895 | Open in IMG/M |
| 3300017716|Ga0181350_1036932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1330 | Open in IMG/M |
| 3300017716|Ga0181350_1060427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
| 3300017716|Ga0181350_1068325 | Not Available | 916 | Open in IMG/M |
| 3300017716|Ga0181350_1108797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
| 3300017722|Ga0181347_1005224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4320 | Open in IMG/M |
| 3300017722|Ga0181347_1006721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3787 | Open in IMG/M |
| 3300017722|Ga0181347_1190209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300017736|Ga0181365_1165160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300017754|Ga0181344_1000622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13862 | Open in IMG/M |
| 3300017761|Ga0181356_1043707 | All Organisms → Viruses → Predicted Viral | 1566 | Open in IMG/M |
| 3300017761|Ga0181356_1093409 | Not Available | 987 | Open in IMG/M |
| 3300017761|Ga0181356_1204516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300017761|Ga0181356_1212855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300017761|Ga0181356_1245790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300017766|Ga0181343_1078719 | Not Available | 947 | Open in IMG/M |
| 3300017774|Ga0181358_1020468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2649 | Open in IMG/M |
| 3300017774|Ga0181358_1025405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2339 | Open in IMG/M |
| 3300017774|Ga0181358_1032027 | All Organisms → Viruses → Predicted Viral | 2054 | Open in IMG/M |
| 3300017774|Ga0181358_1099149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1046 | Open in IMG/M |
| 3300017777|Ga0181357_1019074 | Not Available | 2729 | Open in IMG/M |
| 3300017777|Ga0181357_1302161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300017778|Ga0181349_1006099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5074 | Open in IMG/M |
| 3300017778|Ga0181349_1053053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1587 | Open in IMG/M |
| 3300017778|Ga0181349_1125750 | Not Available | 941 | Open in IMG/M |
| 3300017778|Ga0181349_1203587 | Not Available | 683 | Open in IMG/M |
| 3300017780|Ga0181346_1196552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
| 3300017784|Ga0181348_1016402 | Not Available | 3182 | Open in IMG/M |
| 3300017784|Ga0181348_1023484 | All Organisms → Viruses → Predicted Viral | 2618 | Open in IMG/M |
| 3300017784|Ga0181348_1043316 | Not Available | 1860 | Open in IMG/M |
| 3300017784|Ga0181348_1104716 | All Organisms → Viruses → Predicted Viral | 1101 | Open in IMG/M |
| 3300017784|Ga0181348_1136735 | Not Available | 929 | Open in IMG/M |
| 3300017784|Ga0181348_1248819 | Not Available | 616 | Open in IMG/M |
| 3300017785|Ga0181355_1058935 | Not Available | 1623 | Open in IMG/M |
| 3300019784|Ga0181359_1014729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2878 | Open in IMG/M |
| 3300019784|Ga0181359_1082305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1204 | Open in IMG/M |
| 3300019784|Ga0181359_1126686 | Not Available | 906 | Open in IMG/M |
| 3300019784|Ga0181359_1144971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300020151|Ga0211736_10107279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
| 3300020161|Ga0211726_10411112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1118 | Open in IMG/M |
| 3300020162|Ga0211735_10652960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300020172|Ga0211729_10453246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1655 | Open in IMG/M |
| 3300020205|Ga0211731_10606493 | Not Available | 563 | Open in IMG/M |
| 3300020205|Ga0211731_11441199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1514 | Open in IMG/M |
| 3300020530|Ga0208235_1023802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
| 3300020530|Ga0208235_1031900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
| 3300022179|Ga0181353_1015889 | All Organisms → Viruses → Predicted Viral | 1951 | Open in IMG/M |
| 3300022190|Ga0181354_1006455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3217 | Open in IMG/M |
| 3300022190|Ga0181354_1074948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1120 | Open in IMG/M |
| 3300022190|Ga0181354_1161390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300022190|Ga0181354_1207295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300022190|Ga0181354_1209736 | Not Available | 575 | Open in IMG/M |
| 3300022407|Ga0181351_1026552 | All Organisms → Viruses → Predicted Viral | 2460 | Open in IMG/M |
| 3300022407|Ga0181351_1066209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1473 | Open in IMG/M |
| 3300022407|Ga0181351_1073664 | Not Available | 1377 | Open in IMG/M |
| 3300022407|Ga0181351_1087676 | Not Available | 1227 | Open in IMG/M |
| 3300022407|Ga0181351_1176124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
| 3300024348|Ga0244776_10077357 | All Organisms → Viruses → Predicted Viral | 2528 | Open in IMG/M |
| 3300025445|Ga0208424_1000441 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5003 | Open in IMG/M |
| 3300027581|Ga0209651_1137941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300027608|Ga0208974_1002577 | Not Available | 6719 | Open in IMG/M |
| 3300027608|Ga0208974_1031240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1605 | Open in IMG/M |
| 3300027659|Ga0208975_1028019 | All Organisms → Viruses → Predicted Viral | 1813 | Open in IMG/M |
| 3300027710|Ga0209599_10010727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2806 | Open in IMG/M |
| 3300027785|Ga0209246_10016612 | Not Available | 2747 | Open in IMG/M |
| 3300027785|Ga0209246_10118959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1037 | Open in IMG/M |
| 3300027805|Ga0209229_10319956 | Not Available | 682 | Open in IMG/M |
| 3300027808|Ga0209354_10169951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium BRH_c57 | 888 | Open in IMG/M |
| 3300027808|Ga0209354_10326741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300027971|Ga0209401_1023857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3057 | Open in IMG/M |
| 3300028025|Ga0247723_1001204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15627 | Open in IMG/M |
| 3300028025|Ga0247723_1003426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7924 | Open in IMG/M |
| 3300028025|Ga0247723_1018685 | All Organisms → Viruses → Predicted Viral | 2391 | Open in IMG/M |
| 3300028025|Ga0247723_1020577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2230 | Open in IMG/M |
| 3300028025|Ga0247723_1086426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1036795 | Not Available | 3174 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10501671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300031758|Ga0315907_10387413 | Not Available | 1129 | Open in IMG/M |
| 3300031787|Ga0315900_10070838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3545 | Open in IMG/M |
| 3300031963|Ga0315901_10155110 | All Organisms → Viruses → Predicted Viral | 2036 | Open in IMG/M |
| 3300032050|Ga0315906_11269588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300032116|Ga0315903_10165704 | Not Available | 2008 | Open in IMG/M |
| 3300032173|Ga0315268_10279882 | Not Available | 1611 | Open in IMG/M |
| 3300033981|Ga0334982_0145115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1213 | Open in IMG/M |
| 3300033981|Ga0334982_0222664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
| 3300034062|Ga0334995_0359263 | Not Available | 928 | Open in IMG/M |
| 3300034066|Ga0335019_0001184 | Not Available | 16810 | Open in IMG/M |
| 3300034104|Ga0335031_0078344 | Not Available | 2352 | Open in IMG/M |
| 3300034105|Ga0335035_0205215 | Not Available | 1211 | Open in IMG/M |
| 3300034106|Ga0335036_0257609 | Not Available | 1178 | Open in IMG/M |
| 3300034112|Ga0335066_0317050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 876 | Open in IMG/M |
| 3300034118|Ga0335053_0660915 | Not Available | 593 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 46.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.15% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.04% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.63% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.93% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.23% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.52% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 3.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.11% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.11% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.11% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.41% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.41% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.41% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.70% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.70% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.70% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1089470802 | 3300002408 | Freshwater | MKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVKR* |
| B570J29032_1091693681 | 3300002408 | Freshwater | MRWLLMLFLVFLPGAASQDRKTEYRCVRWAWTGDVYNRKVVCLQWEKVVR |
| B570J29032_1093146221 | 3300002408 | Freshwater | MRWLLMLFLVFLPGAASQDKKTEYRCVRWTWSGDVYNRKVVCLQWEKVERK* |
| B570J40625_10001107519 | 3300002835 | Freshwater | MRWILVLFLVFLPGAASQDKKTEYRCVRWTWSGDVYNRKVVCLQWEKVERK* |
| JGI25908J49247_100329834 | 3300003277 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK* |
| JGI25908J49247_100370631 | 3300003277 | Freshwater Lake | MRWLLLLLLLGLVGTASQDRKTEYRCVRWAWTGDVYNRKVVCLEWQKVERK* |
| JGI25909J50240_10094093 | 3300003393 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEXRCVRWAWTGDVYNRKVVCLEWQKVERK* |
| Ga0068877_107057992 | 3300005525 | Freshwater Lake | MKWVLVIFMLMPGASSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVRR* |
| Ga0068876_103672932 | 3300005527 | Freshwater Lake | MKWVLVLFMLMPGTSSQKKKEEYRCVRWAWTGDVYNRKVVCLQWEKVERK* |
| Ga0068876_104145491 | 3300005527 | Freshwater Lake | MGDVYPRLDLGMKWVLVIFMLMPGASSQKKKDEYRCVRWAWTGDVYN |
| Ga0068876_106011891 | 3300005527 | Freshwater Lake | IFMLMPGASSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVRR* |
| Ga0068872_104521192 | 3300005528 | Freshwater Lake | MGDVYPRLDLGMKWVLVIFMLMPGASSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVRR |
| Ga0049081_100029854 | 3300005581 | Freshwater Lentic | MKWLLVIFMLIPGSSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK* |
| Ga0049081_100510924 | 3300005581 | Freshwater Lentic | MLIPGTSSQKKKDEYRCVRWAWAGDVYNRKVVCLEWQKVERK* |
| Ga0049080_101346653 | 3300005582 | Freshwater Lentic | MRWLLMLFLVFLPGAASQDRKTEYRCVRWTWSGDVYNRKVVCLQWE |
| Ga0070742_102153702 | 3300005942 | Estuarine | MKWLLVLFFLFSPEVSNKEKKPEYRCVRWAWTGDVYNRKVVCLEWQKVDKK* |
| Ga0075470_100021625 | 3300006030 | Aqueous | VGDSNDFLDVGMKWLLMLFLVVLPGAASQDRKTEYRCVRWAWTGDVYNRKVVCLQWEKVERK* |
| Ga0070748_13395932 | 3300006920 | Aqueous | QDRKTEYRCVRWAWTGDVYNRKVVCLQWEKVVRK* |
| Ga0102921_12448111 | 3300007603 | Estuarine | HLWHVHDCMDLVVKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERR* |
| Ga0102859_11350781 | 3300007708 | Estuarine | MKWLLVIFMLMPGTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVEKK* |
| Ga0104988_105689 | 3300007735 | Freshwater | MKWILVIFMLIPGTSNQKKKDEYRCVRWAWTVDVYNRKVVCLEWQKVERK* |
| Ga0114340_10060321 | 3300008107 | Freshwater, Plankton | MLFLVFLPGAASQDRKTEYRCVRWAWTGDVYNRKVVCLQWEKVERK* |
| Ga0114363_10872811 | 3300008266 | Freshwater, Plankton | MGDVYPRLDLGMKWVLVIFMLMPGASSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK* |
| Ga0114363_10993983 | 3300008266 | Freshwater, Plankton | MKWLLMLFLVFLPGAASQDKKTEYRCVRWAWTGDVYNRKVVCLEWQKVERK* |
| Ga0114364_10114005 | 3300008267 | Freshwater, Plankton | MKWLLVVFMLMPGTSSQKKKDEYRCVRWAWAGDVYNRKVVCLEWQKVERK* |
| Ga0114364_10317351 | 3300008267 | Freshwater, Plankton | MPGASSQKKKDEYRCVRWAWTGDVYNRKVVCLQWEKVERK* |
| Ga0114364_10377714 | 3300008267 | Freshwater, Plankton | MKWLLVIFMLMPGVSSQKKKDEYRCVRWAWTGDVYNRKVVCLQWEKVVRK* |
| Ga0114364_10861244 | 3300008267 | Freshwater, Plankton | MKWVLVIFMLMPGASSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK* |
| Ga0114876_10219774 | 3300008448 | Freshwater Lake | MLFLVFLPGAASQDRKTEYRCVRWAWTGDVYNRKVVCLQWEKVVRR* |
| Ga0114876_12004601 | 3300008448 | Freshwater Lake | ALGMKWVLVIFMLMPGASSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK* |
| Ga0114973_104282591 | 3300009068 | Freshwater Lake | MKWLLMLFLVFLPGAASQDKKTEYRCVRWAWTGDVYNRKVVCLQWEKV |
| Ga0114975_105738332 | 3300009164 | Freshwater Lake | PMRFLLLLSLVFVSGAESEYRCVRWTWTGDVYNRKVVCLEWQKVERK* |
| Ga0114979_101342223 | 3300009180 | Freshwater Lake | MRWLLMLFLVFLPGAASQDKKTEYRCVRWTWTGDVYNRKVVCLQWEKVERK* |
| Ga0114983_11249192 | 3300009194 | Deep Subsurface | MKFIVFLFFITLSGASSQDKNNEYRCIRWTWTGDVYNRKVVCLEWKRVEKK* |
| Ga0114967_100362516 | 3300010160 | Freshwater Lake | MKWLLMLFLVVLPGASSQEKKKDEYRCVRWAWTGDVYNRKVVCLQWEKVVRK* |
| Ga0133913_100221539 | 3300010885 | Freshwater Lake | MRWLLMFFLVFLPGASSQERKTEYRCVRWAWTGDVYNRKVVCLQWEKVVRK* |
| Ga0133913_107033624 | 3300010885 | Freshwater Lake | MKWLIMLFLLFMPVVSSQERKTEYRCVRWAWTGDVYNRKVVCLKWEKVERK* |
| Ga0133913_130233182 | 3300010885 | Freshwater Lake | MRWLLMFFLVFLPGASSQDKKTEYRCVWWAWTGDVYNRKVVCLQWEKVERK* |
| Ga0151517_16582 | 3300011113 | Freshwater | MKWVLVFFMLMPGASSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK* |
| Ga0151514_108732 | 3300011115 | Freshwater | MKWLLVIFMLLPGSSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK* |
| Ga0153697_102925 | 3300011334 | Freshwater | MKWVLVIFMLLPGASSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK* |
| Ga0153697_131118 | 3300011334 | Freshwater | VKWAIYFLLVFFLLVLPGASSQASKTEYRCVRWAWSGDVFNRKTICLEWKKK* |
| Ga0153805_10748451 | 3300012013 | Surface Ice | WVLVIFLLLPEASSQKKKDEYRCVRWVWTGDVYNRKVVCLEWQKVERK* |
| Ga0164293_105523341 | 3300013004 | Freshwater | MRWLLMLFLVFLPGASSQDKKTEYRCVRWAWTGDVYNRKVV |
| Ga0164292_102685384 | 3300013005 | Freshwater | MRWLLMLFLVFLPGAASQDRKTEYRCVRWAWTGDVYN |
| Ga0177922_100083902 | 3300013372 | Freshwater | MDLGMKWLLVIFMLMPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCFEWQKVERK* |
| Ga0181338_10065681 | 3300015050 | Freshwater Lake | MKWLLVIFMLVPQTSSKKKKDEYRCVRWAWTGDVYNRKVVCLEWQKV |
| Ga0181338_10212923 | 3300015050 | Freshwater Lake | MKWLLVSFMLVPQTSSQKKKDEYRCVRWAWTVDVYNRKVV |
| Ga0181364_10305713 | 3300017701 | Freshwater Lake | LNLDMGMKWFLVIFILLPQTASQKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0181350_10070575 | 3300017716 | Freshwater Lake | MRWLLVLFLVFLPGAASQDKKTEYRCVRWTWTGDVYNRKVVCLEWKKVEGK |
| Ga0181350_10088371 | 3300017716 | Freshwater Lake | MKWLLVLFLVFLPGAASQDRKTEYRCVRWTWTGDVYNRKVVCLQWEK |
| Ga0181350_10369323 | 3300017716 | Freshwater Lake | GMKWLLVLFLLFSPEVSNKEKKPEYRCVRWSWSGDVYNRKVVCLEWQKVEKK |
| Ga0181350_10604271 | 3300017716 | Freshwater Lake | MKWVLVIFMLMPGASSQKKKDEYRCVRWAWTGDVYNRKVVCLQWEKVVR |
| Ga0181350_10683251 | 3300017716 | Freshwater Lake | MRWLLMVFLVFLPGASSQDKKTEYRCVRWAWTGDVYNRKVVCLQWEKVVRK |
| Ga0181350_11087971 | 3300017716 | Freshwater Lake | SQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0181347_10052241 | 3300017722 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKEEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0181347_10067217 | 3300017722 | Freshwater Lake | MKWLLMFFLVFLPGASSQDRKTEYRCVRWAWTGDVYNRKVVCLQWEKVVRK |
| Ga0181347_11902091 | 3300017722 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQK |
| Ga0181365_11651601 | 3300017736 | Freshwater Lake | MKWLLMFFLVFLPGASSQDRKTEYRCVRWAWTGDVYNRKVVCLQWEKVV |
| Ga0181344_10006226 | 3300017754 | Freshwater Lake | MKWLLMLFLVFLPGAASQDRKTEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0181356_10437073 | 3300017761 | Freshwater Lake | MRWLLMVFLVFLPGASSQDKKTEYRCVRWAWTGDVYNR |
| Ga0181356_10934091 | 3300017761 | Freshwater Lake | MLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLE |
| Ga0181356_12045161 | 3300017761 | Freshwater Lake | MLVPQTSSQKKKEEYRCVRWAWTGDVYNRKVVCLEWQKVE |
| Ga0181356_12128552 | 3300017761 | Freshwater Lake | MRWLLMLFLVFLPGAASQDRKTEYRCVRWAWTGDVYNRKVVCLQWE |
| Ga0181356_12457901 | 3300017761 | Freshwater Lake | KWLLMLFLLFLPVVSSKEKKTEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0181343_10787191 | 3300017766 | Freshwater Lake | MKWVLVIFMLVPGASSQKKKDEYRCVRWAWTGDVYNRKIVCLEWQKVERK |
| Ga0181358_10204686 | 3300017774 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVV |
| Ga0181358_10254051 | 3300017774 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVER |
| Ga0181358_10320274 | 3300017774 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKEEYRCVRWAWTGDVYNRKVVCLEWQKVE |
| Ga0181358_10991491 | 3300017774 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRKV |
| Ga0181357_10190741 | 3300017777 | Freshwater Lake | SQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERR |
| Ga0181357_13021611 | 3300017777 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVAPQIGR |
| Ga0181349_10060991 | 3300017778 | Freshwater Lake | MLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0181349_10530534 | 3300017778 | Freshwater Lake | MKWLLVIFMLIPESSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0181349_11257501 | 3300017778 | Freshwater Lake | MRWLLMVFLVFLPGASSQDKKTEYRCVRWAWTGDVYNRKVVCLQW |
| Ga0181349_12035871 | 3300017778 | Freshwater Lake | SSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0181346_11965522 | 3300017780 | Freshwater Lake | MRWLLMFFLVFLPGAASQDKKTEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0181348_10164025 | 3300017784 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVDNRKVVCLEWEKVERK |
| Ga0181348_10234841 | 3300017784 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCL |
| Ga0181348_10433166 | 3300017784 | Freshwater Lake | SSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERR |
| Ga0181348_11047164 | 3300017784 | Freshwater Lake | MLVPQTSSQKKKDESRWVRWAWEGDVYNRKVVCLEW |
| Ga0181348_11367351 | 3300017784 | Freshwater Lake | MRWLLMVFLVFLPGASSQDKKTEYRCVRWAWTGDVYNRKVVCLQ |
| Ga0181348_12488191 | 3300017784 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKEEYRCVRWAWTGDVYNRK |
| Ga0181355_10589351 | 3300017785 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWTWTGDVYNRKV |
| Ga0181359_10147291 | 3300019784 | Freshwater Lake | MRWLLMLFLVFLPGAASQDRKTEYRCVRWAWTGDVYNRKVVCLQWEKFV |
| Ga0181359_10823054 | 3300019784 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRF |
| Ga0181359_11266861 | 3300019784 | Freshwater Lake | MLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQK |
| Ga0181359_11449713 | 3300019784 | Freshwater Lake | MDLVVKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0211736_101072791 | 3300020151 | Freshwater | MPGASSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0211726_104111122 | 3300020161 | Freshwater | MKWLLVIFMLMPGTSSQKKKDEYRCVRWAWTGDVYNRKVVCLQWEKVERK |
| Ga0211735_106529602 | 3300020162 | Freshwater | YCLGVPVKWLLVLSILFTLVVSSKEKTEYRCVRWAWTGDVYNRKVVCLEWQKVERR |
| Ga0211729_104532462 | 3300020172 | Freshwater | MRWLLMLFLVFLPGAASQDKKTEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0211731_106064932 | 3300020205 | Freshwater | MRWLLMLFLVFLPGAASQDRKTEYRCVRWAWTGDVYNRK |
| Ga0211731_114411995 | 3300020205 | Freshwater | MKWVLVIFMLMPGAASQKKKDEYRCVRWAWTGDVYNRKVVCLEW |
| Ga0208235_10238022 | 3300020530 | Freshwater | MRWILVLFLVFLPGAASQDKKTEYRCVRWTWSGDVYNRKVVCLQWEKVERK |
| Ga0208235_10319001 | 3300020530 | Freshwater | LMLFLVFLPGAASQDRKTEYRCVRWAWTGDVYNRKVVCLQWEKVVRK |
| Ga0181353_10158894 | 3300022179 | Freshwater Lake | MKWVLVIFLLLPEASSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0181354_10064555 | 3300022190 | Freshwater Lake | MRWLLMLFLVFLPGAASQDKKTEYRCVRWAWSGDVYNRKVVCLQWEKVKRK |
| Ga0181354_10749483 | 3300022190 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLDWQKVERK |
| Ga0181354_11613902 | 3300022190 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWTWTGDVYNRKVVCLEWQKVERK |
| Ga0181354_12072952 | 3300022190 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0181354_12097362 | 3300022190 | Freshwater Lake | MDLVVKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCP |
| Ga0181351_10265521 | 3300022407 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVY |
| Ga0181351_10662094 | 3300022407 | Freshwater Lake | MLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVER |
| Ga0181351_10736641 | 3300022407 | Freshwater Lake | MRWLLMVFLVFLPGASSQDKKTEYRCVRWAWTGDVYNRKVVCLQWEKVV |
| Ga0181351_10876763 | 3300022407 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWTWTGDVYNRKVVCLEWQ |
| Ga0181351_11761243 | 3300022407 | Freshwater Lake | KWFLVIFILLPQTTSKKDEYRCVRWAWTGDVYNRKVVCLQWEKVVRK |
| Ga0244776_100773572 | 3300024348 | Estuarine | MKWLLVIFMLMPGTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVEKK |
| Ga0208424_10004416 | 3300025445 | Aqueous | VGDSNDFLDVGMKWLLMLFLVVLPGAASQDRKTEYRCVRWAWTGDVYNRKVVCLQWEKVERK |
| Ga0209651_11379412 | 3300027581 | Freshwater Lake | TSSQKKKDEYRCVRWTWTGDVYNRKVVCLEWQKVERK |
| Ga0208974_10025778 | 3300027608 | Freshwater Lentic | MKWLLVIFMLIPGSSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0208974_10312402 | 3300027608 | Freshwater Lentic | MKWLLVIFMLIPGTSSQKKKDEYRCVRWAWAGDVYNRKVVCLEWQKVERK |
| Ga0208975_10280191 | 3300027659 | Freshwater Lentic | HCLGYVYHFVDLGMKWVLVIFLLLPEASSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0209599_100107275 | 3300027710 | Deep Subsurface | MKFIVFLFFITLSGASSQDKNNEYRCIRWTWTGDVYNRKVVCLEWKRVEKK |
| Ga0209246_100166121 | 3300027785 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLE |
| Ga0209246_101189593 | 3300027785 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWTWTGDVYNRKVVCLE |
| Ga0209229_103199563 | 3300027805 | Freshwater And Sediment | MKWLLVIFMLMPGTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVE |
| Ga0209354_101699513 | 3300027808 | Freshwater Lake | MKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKV |
| Ga0209354_103267411 | 3300027808 | Freshwater Lake | PQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERR |
| Ga0209401_10238575 | 3300027971 | Freshwater Lake | MRWLLMFFLVFLPGASSQDKKTEYRCVRWAWTGDVYNRKVVCLQWEKVERK |
| Ga0247723_10012045 | 3300028025 | Deep Subsurface Sediment | MRCLLMLFLVFLPGASTQDKKTEYRCVRWAWTGDVYNRKVVCLQWEKVVRK |
| Ga0247723_10034261 | 3300028025 | Deep Subsurface Sediment | MRWLLMLFLVFLPGAASQDRKTEYRCVRWAWTGDVYNRKVVCLQWEKV |
| Ga0247723_10186854 | 3300028025 | Deep Subsurface Sediment | LDLVVKWVLVIFMLMPGTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0247723_10205773 | 3300028025 | Deep Subsurface Sediment | MKWLLVIFMLMPETSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0247723_10864262 | 3300028025 | Deep Subsurface Sediment | IVFLFFITLSGASSQDKNNEYRCIRWTWTGDVYNRKVVCLEWKRVEKK |
| (restricted) Ga0247844_10367956 | 3300028571 | Freshwater | MKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVRR |
| (restricted) Ga0247840_105016711 | 3300028581 | Freshwater | RVGDVYDTLDLGMKWVLVIFMLIPGASSQDRKTEYRCVRWAWTGDVYNRKVVCLEWQKVR |
| Ga0315907_103874131 | 3300031758 | Freshwater | MGDVYPRLDLGMKWVLVIFMLMPGASSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVER |
| Ga0315900_100708384 | 3300031787 | Freshwater | MLFLVFLPGASSQDRKTEYRCVRWAWTGDVYNRKVVCLQWEKVERK |
| Ga0315901_101551101 | 3300031963 | Freshwater | WILMLFLVFLPGAASQDRKTEYRCVRWAWTGDVYNRKVVCLQWEKVERK |
| Ga0315906_112695881 | 3300032050 | Freshwater | FMLIPGSSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVERK |
| Ga0315903_101657041 | 3300032116 | Freshwater | MLFLVFLPGASSQDRKTEYRCVRWAWTGDVYNRKVVCLEWQK |
| Ga0315268_102798822 | 3300032173 | Sediment | MRWLLMLFLVFLPGAASQDKKTEYRCVRWAWTGDVYNRKVVCLQWEKVERK |
| Ga0334982_0145115_585_770 | 3300033981 | Freshwater | MGYIYPRLDLGMKWLLVIFMLVPQTSSQKKKDEYRCVRWAWTGDVYNRKVVCLEWQKVER |
| Ga0334982_0222664_783_920 | 3300033981 | Freshwater | MLFLVFLPGAASQDRKTEYRCVRWAWTGDVYNRKVVCLEWQKVRR |
| Ga0334995_0359263_781_927 | 3300034062 | Freshwater | MRWLLMLFLVFLPGAASQDKKTEYRCVRWAWTGDVYNRKVVCLQWEKVV |
| Ga0335019_0001184_6619_6774 | 3300034066 | Freshwater | MRWLLMLFLVFLPGAASQDKKTEYRCVRWAWTGDVYNRKVVCLQWEKVVRK |
| Ga0335031_0078344_1_123 | 3300034104 | Freshwater | MRWLLMLFLVFLPGAASQDRKTEYRCVRWAWTGDVYNRKVV |
| Ga0335035_0205215_1080_1211 | 3300034105 | Freshwater | MLFLVFLPGAASQDRKTEYRCVRWAWTGDVYNRKVVCLQWEKVV |
| Ga0335036_0257609_1049_1177 | 3300034106 | Freshwater | MSWLLVVMLIPQVSEYRCVRWAWTGDVYNRKVVCLQWEKVVRK |
| Ga0335066_0317050_1_129 | 3300034112 | Freshwater | MLFLVFLPGAASQDRKTEYRCVRWAWTGDVYNRKVVCLQWEKV |
| Ga0335053_0660915_1_129 | 3300034118 | Freshwater | MKWLLVIFMLVPQTSSQKKKEEYRCVRWAWTGDVYNRKVVCLE |
| ⦗Top⦘ |