| Basic Information | |
|---|---|
| Family ID | F052403 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 142 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKKHFAILLFVVLALGLCVPPVFAQASGTVKGVCKDAQGNPIVDGVV |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 142 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 99.28 % |
| % of genes near scaffold ends (potentially truncated) | 97.89 % |
| % of genes from short scaffolds (< 2000 bps) | 90.85 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (71.831 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.789 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.535 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.930 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 2.67% Coil/Unstructured: 64.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 142 Family Scaffolds |
|---|---|---|
| PF06508 | QueC | 92.96 |
| PF04055 | Radical_SAM | 2.11 |
| PF13394 | Fer4_14 | 1.41 |
| PF01242 | PTPS | 1.41 |
| PF01564 | Spermine_synth | 0.70 |
| PF14534 | DUF4440 | 0.70 |
| PF02129 | Peptidase_S15 | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
|---|---|---|---|
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 92.96 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 92.96 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 92.96 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 92.96 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 92.96 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 92.96 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 92.96 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 92.96 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 92.96 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 1.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 71.83 % |
| All Organisms | root | All Organisms | 28.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10320180 | Not Available | 553 | Open in IMG/M |
| 3300001593|JGI12635J15846_10373070 | Not Available | 868 | Open in IMG/M |
| 3300001661|JGI12053J15887_10186032 | Not Available | 1066 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100533807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1050 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101689664 | Not Available | 532 | Open in IMG/M |
| 3300004091|Ga0062387_100080752 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
| 3300004091|Ga0062387_100205881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1192 | Open in IMG/M |
| 3300005434|Ga0070709_11390232 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005467|Ga0070706_100630814 | Not Available | 995 | Open in IMG/M |
| 3300005541|Ga0070733_10436116 | Not Available | 874 | Open in IMG/M |
| 3300005541|Ga0070733_10716352 | Not Available | 672 | Open in IMG/M |
| 3300005542|Ga0070732_10108452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1639 | Open in IMG/M |
| 3300005591|Ga0070761_10222632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1123 | Open in IMG/M |
| 3300005712|Ga0070764_10081100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1707 | Open in IMG/M |
| 3300006034|Ga0066656_10311253 | Not Available | 1016 | Open in IMG/M |
| 3300006059|Ga0075017_101585299 | Not Available | 517 | Open in IMG/M |
| 3300007265|Ga0099794_10344359 | Not Available | 775 | Open in IMG/M |
| 3300009143|Ga0099792_10475505 | Not Available | 778 | Open in IMG/M |
| 3300009521|Ga0116222_1134683 | Not Available | 1064 | Open in IMG/M |
| 3300009521|Ga0116222_1182223 | Not Available | 904 | Open in IMG/M |
| 3300009552|Ga0116138_1237611 | Not Available | 504 | Open in IMG/M |
| 3300009665|Ga0116135_1199414 | Not Available | 764 | Open in IMG/M |
| 3300009762|Ga0116130_1145036 | Not Available | 748 | Open in IMG/M |
| 3300009792|Ga0126374_10438940 | Not Available | 924 | Open in IMG/M |
| 3300010341|Ga0074045_10319186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1017 | Open in IMG/M |
| 3300010343|Ga0074044_10539783 | Not Available | 761 | Open in IMG/M |
| 3300010358|Ga0126370_10889058 | Not Available | 803 | Open in IMG/M |
| 3300011120|Ga0150983_14121134 | Not Available | 525 | Open in IMG/M |
| 3300011269|Ga0137392_11492355 | Not Available | 535 | Open in IMG/M |
| 3300012189|Ga0137388_10768804 | Not Available | 893 | Open in IMG/M |
| 3300012208|Ga0137376_11215191 | Not Available | 643 | Open in IMG/M |
| 3300012361|Ga0137360_11103497 | Not Available | 685 | Open in IMG/M |
| 3300012925|Ga0137419_11343193 | Not Available | 602 | Open in IMG/M |
| 3300014498|Ga0182019_10782206 | Not Available | 681 | Open in IMG/M |
| 3300015245|Ga0137409_10320673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1357 | Open in IMG/M |
| 3300015372|Ga0132256_100748445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1093 | Open in IMG/M |
| 3300016702|Ga0181511_1090624 | Not Available | 605 | Open in IMG/M |
| 3300016702|Ga0181511_1258266 | Not Available | 615 | Open in IMG/M |
| 3300016750|Ga0181505_11051792 | Not Available | 567 | Open in IMG/M |
| 3300017823|Ga0187818_10539230 | Not Available | 525 | Open in IMG/M |
| 3300017934|Ga0187803_10385119 | Not Available | 567 | Open in IMG/M |
| 3300017936|Ga0187821_10034334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1796 | Open in IMG/M |
| 3300017936|Ga0187821_10296598 | Not Available | 641 | Open in IMG/M |
| 3300017942|Ga0187808_10577445 | Not Available | 523 | Open in IMG/M |
| 3300017943|Ga0187819_10074233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2026 | Open in IMG/M |
| 3300017943|Ga0187819_10828996 | Not Available | 519 | Open in IMG/M |
| 3300017946|Ga0187879_10754640 | Not Available | 542 | Open in IMG/M |
| 3300017993|Ga0187823_10263922 | Not Available | 587 | Open in IMG/M |
| 3300018006|Ga0187804_10187322 | Not Available | 881 | Open in IMG/M |
| 3300018006|Ga0187804_10259348 | Not Available | 751 | Open in IMG/M |
| 3300018006|Ga0187804_10581492 | Not Available | 508 | Open in IMG/M |
| 3300018038|Ga0187855_10647949 | Not Available | 615 | Open in IMG/M |
| 3300018047|Ga0187859_10500522 | Not Available | 676 | Open in IMG/M |
| 3300018085|Ga0187772_10664230 | Not Available | 745 | Open in IMG/M |
| 3300018086|Ga0187769_11330721 | Not Available | 543 | Open in IMG/M |
| 3300018088|Ga0187771_11850108 | Not Available | 513 | Open in IMG/M |
| 3300018088|Ga0187771_11938642 | Not Available | 500 | Open in IMG/M |
| 3300020583|Ga0210401_10215199 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300021088|Ga0210404_10770984 | Not Available | 549 | Open in IMG/M |
| 3300021170|Ga0210400_10225351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1528 | Open in IMG/M |
| 3300021178|Ga0210408_11063768 | Not Available | 624 | Open in IMG/M |
| 3300021180|Ga0210396_11266369 | Not Available | 615 | Open in IMG/M |
| 3300021180|Ga0210396_11444877 | Not Available | 567 | Open in IMG/M |
| 3300021181|Ga0210388_10766865 | Not Available | 837 | Open in IMG/M |
| 3300021401|Ga0210393_10558241 | Not Available | 935 | Open in IMG/M |
| 3300021406|Ga0210386_10609859 | Not Available | 942 | Open in IMG/M |
| 3300021406|Ga0210386_11505738 | Not Available | 561 | Open in IMG/M |
| 3300021420|Ga0210394_10370651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1259 | Open in IMG/M |
| 3300021420|Ga0210394_11170194 | Not Available | 661 | Open in IMG/M |
| 3300021433|Ga0210391_10230904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1454 | Open in IMG/M |
| 3300021433|Ga0210391_10758932 | Not Available | 759 | Open in IMG/M |
| 3300021474|Ga0210390_11462872 | Not Available | 542 | Open in IMG/M |
| 3300021475|Ga0210392_11304365 | Not Available | 543 | Open in IMG/M |
| 3300021478|Ga0210402_11696895 | Not Available | 558 | Open in IMG/M |
| 3300021479|Ga0210410_10595955 | Not Available | 982 | Open in IMG/M |
| 3300021559|Ga0210409_10736821 | Not Available | 857 | Open in IMG/M |
| 3300021560|Ga0126371_10655339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1198 | Open in IMG/M |
| 3300022557|Ga0212123_10642497 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300023019|Ga0224560_112543 | Not Available | 529 | Open in IMG/M |
| 3300023068|Ga0224554_1101878 | Not Available | 661 | Open in IMG/M |
| 3300023250|Ga0224544_1003070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2241 | Open in IMG/M |
| 3300024288|Ga0179589_10154825 | Not Available | 980 | Open in IMG/M |
| 3300025509|Ga0208848_1011349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1871 | Open in IMG/M |
| 3300025604|Ga0207930_1130127 | Not Available | 553 | Open in IMG/M |
| 3300025898|Ga0207692_11145669 | Not Available | 516 | Open in IMG/M |
| 3300025905|Ga0207685_10145560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1067 | Open in IMG/M |
| 3300025906|Ga0207699_11158254 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300025910|Ga0207684_10267198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1476 | Open in IMG/M |
| 3300025928|Ga0207700_10059468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2890 | Open in IMG/M |
| 3300026322|Ga0209687_1144830 | Not Available | 765 | Open in IMG/M |
| 3300026328|Ga0209802_1116335 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300026557|Ga0179587_10716720 | Not Available | 659 | Open in IMG/M |
| 3300026839|Ga0207764_120495 | Not Available | 591 | Open in IMG/M |
| 3300027505|Ga0209218_1049245 | Not Available | 848 | Open in IMG/M |
| 3300027590|Ga0209116_1046378 | Not Available | 936 | Open in IMG/M |
| 3300027684|Ga0209626_1215657 | Not Available | 508 | Open in IMG/M |
| 3300027701|Ga0209447_10220258 | Not Available | 517 | Open in IMG/M |
| 3300027738|Ga0208989_10080855 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300027842|Ga0209580_10268552 | Not Available | 849 | Open in IMG/M |
| 3300027867|Ga0209167_10251637 | Not Available | 949 | Open in IMG/M |
| 3300027905|Ga0209415_10302130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1379 | Open in IMG/M |
| 3300028016|Ga0265354_1023787 | Not Available | 585 | Open in IMG/M |
| 3300028536|Ga0137415_10004128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14384 | Open in IMG/M |
| 3300028747|Ga0302219_10039511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1761 | Open in IMG/M |
| 3300028789|Ga0302232_10345877 | Not Available | 732 | Open in IMG/M |
| 3300028873|Ga0302197_10501617 | Not Available | 529 | Open in IMG/M |
| 3300028906|Ga0308309_11660901 | Not Available | 543 | Open in IMG/M |
| 3300029701|Ga0222748_1106887 | Not Available | 551 | Open in IMG/M |
| 3300029882|Ga0311368_10072203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3046 | Open in IMG/M |
| 3300029910|Ga0311369_11150958 | Not Available | 602 | Open in IMG/M |
| 3300029945|Ga0311330_10158698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2134 | Open in IMG/M |
| 3300029952|Ga0311346_10711598 | Not Available | 868 | Open in IMG/M |
| 3300029957|Ga0265324_10235818 | Not Available | 621 | Open in IMG/M |
| 3300030058|Ga0302179_10329755 | Not Available | 672 | Open in IMG/M |
| 3300030507|Ga0302192_10192484 | Not Available | 884 | Open in IMG/M |
| 3300030580|Ga0311355_10106267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3110 | Open in IMG/M |
| 3300030580|Ga0311355_11651576 | Not Available | 548 | Open in IMG/M |
| 3300030617|Ga0311356_10333076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1513 | Open in IMG/M |
| 3300030737|Ga0302310_10737897 | Not Available | 509 | Open in IMG/M |
| 3300031028|Ga0302180_10657807 | Not Available | 500 | Open in IMG/M |
| 3300031708|Ga0310686_100707410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1208 | Open in IMG/M |
| 3300031715|Ga0307476_10575281 | Not Available | 835 | Open in IMG/M |
| 3300031715|Ga0307476_11397944 | Not Available | 509 | Open in IMG/M |
| 3300031718|Ga0307474_10030756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3935 | Open in IMG/M |
| 3300031720|Ga0307469_10494426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1070 | Open in IMG/M |
| 3300031823|Ga0307478_10900203 | Not Available | 740 | Open in IMG/M |
| 3300031938|Ga0308175_101232059 | Not Available | 832 | Open in IMG/M |
| 3300031945|Ga0310913_10908793 | Not Available | 619 | Open in IMG/M |
| 3300031962|Ga0307479_11024910 | Not Available | 794 | Open in IMG/M |
| 3300031962|Ga0307479_11801440 | Not Available | 564 | Open in IMG/M |
| 3300032180|Ga0307471_103662211 | Not Available | 544 | Open in IMG/M |
| 3300032261|Ga0306920_102927470 | Not Available | 647 | Open in IMG/M |
| 3300032770|Ga0335085_10315008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1848 | Open in IMG/M |
| 3300032805|Ga0335078_10143488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3389 | Open in IMG/M |
| 3300032829|Ga0335070_11413836 | Not Available | 635 | Open in IMG/M |
| 3300032895|Ga0335074_10471356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1319 | Open in IMG/M |
| 3300032898|Ga0335072_11714293 | Not Available | 523 | Open in IMG/M |
| 3300032955|Ga0335076_10060012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3759 | Open in IMG/M |
| 3300033977|Ga0314861_0353308 | Not Available | 652 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.75% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.04% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.04% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.23% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.52% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.52% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.82% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.82% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.11% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.11% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.41% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.41% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.41% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.41% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.41% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.70% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.70% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.70% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.70% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
| 3300023068 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24 | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026839 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_103201801 | 3300001356 | Peatlands Soil | MKKYFVILLFAILALGLCVPPVFAQASGTVSGTCKDAQG |
| JGI12635J15846_103730701 | 3300001593 | Forest Soil | MKKHFAILLFAILALGLCVPPVFAQASGTVKGTARDA |
| JGI12053J15887_101860322 | 3300001661 | Forest Soil | MKKHFAVILFVVLALGLCVPPVFAQASGTVKGVCKDPQGTP |
| JGIcombinedJ26739_1005338073 | 3300002245 | Forest Soil | MKRHFAVFVLVLLMLAFCAPMVFAQAAGTVKGVCKDAQ |
| JGIcombinedJ26739_1016896641 | 3300002245 | Forest Soil | MKKHFAVFAFVLLMLGLCASPVVAQSGTVKGVCKDVDGKP |
| Ga0062387_1000807523 | 3300004091 | Bog Forest Soil | MKKHFAVFAVVLLVLGLGAPTVFAQGASGTVKGVCKDAQGNPIVDGVVVWAN |
| Ga0062387_1002058811 | 3300004091 | Bog Forest Soil | MKRYFAIVLLAVVAVGMSVPAMFAQASGTVKGVCKDAQGTPVADGVVVWNNVDN |
| Ga0070709_113902321 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKHFAGFVFVLLMLAFCAPTVFAQAAGTVKGVCKDQQGNPI |
| Ga0070706_1006308141 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKHFAILLFVLLALGLCVPPVFAQAAGSVKGVCKDAQGTPLVDAV |
| Ga0070733_104361161 | 3300005541 | Surface Soil | MKKRFAIFLFVLLAIGLCVPPVFSQAAGTVKGVCKDNQGNPIVDGVVLWTNMD |
| Ga0070733_107163521 | 3300005541 | Surface Soil | MKKHFAILLFVILALGLSVPPVFGQASGTIKGTCKDADGKPVA |
| Ga0070732_101084521 | 3300005542 | Surface Soil | MKKHFAILFSAILALGLCVPPVFAQASGSVKGVCKDPQGN |
| Ga0070761_102226321 | 3300005591 | Soil | MKKHFAIFVLAILAAALCVPPAFAQASGSVKGVCKDA |
| Ga0070764_100811001 | 3300005712 | Soil | MKKHFAVFAFVLLVLGFCASPVFAQSGTVKGVCKD |
| Ga0066656_103112532 | 3300006034 | Soil | MKKHFGFILFAVVTLALCVPQVFAQASGSVKGVCKDPEGKPIAGGV |
| Ga0075017_1015852992 | 3300006059 | Watersheds | MKKHFAIVLITVFSAILCAPVVFAQASGTVKGECK |
| Ga0099794_103443592 | 3300007265 | Vadose Zone Soil | MRKYFAIFVFVVLVAGLCVPPVFAQASGSVKGVAK |
| Ga0099792_104755052 | 3300009143 | Vadose Zone Soil | MKRHFAIFALVVLVLGLCVPPVFAQASGTVKGVCKDVEGK |
| Ga0116222_11346831 | 3300009521 | Peatlands Soil | MKKYFAILLFAILALGLCVPPLLAQASGSVTGVCKDAQGNPIVDGVV |
| Ga0116222_11822231 | 3300009521 | Peatlands Soil | MKKHFVILLSAVLAVGLCAAPVFGQAAGSAKGTCKDADGKPIV |
| Ga0116138_12376111 | 3300009552 | Peatland | MKKHLAVFALVLLVFGVCTSPVFAQGASGSVKGVCKDAD |
| Ga0116135_11994142 | 3300009665 | Peatland | MKKHFAIFVLAVLAAALCVPSVFAQASGSVKGVCKDAQGNPFADAVVVWVNTDNG |
| Ga0116130_11450361 | 3300009762 | Peatland | MKKHLAVFALVLLVFGVCTSPVFAQGASGSVKGVCKD |
| Ga0126374_104389402 | 3300009792 | Tropical Forest Soil | MKKHLAIIGSLMLALGLCSVPVFAQASGTVKGACKDAEGNPIAG |
| Ga0074045_103191863 | 3300010341 | Bog Forest Soil | MKKYFAIVLFAVLAVGLCVPAVFAQASGTVKGVCKDAQGNPVADGVVVWN |
| Ga0074044_105397831 | 3300010343 | Bog Forest Soil | MKKLFAMFVFLLLMLGLCVPPVFSQASGTVKGVCRDFQGNPIAD |
| Ga0126370_108890582 | 3300010358 | Tropical Forest Soil | MKKHFSVLLFVVVALGLWVPPAFGQAGTVKGVCRDAQGNPVADGVVVYTNLD |
| Ga0150983_141211342 | 3300011120 | Forest Soil | MLLDSWAAGRQKMKKHFAILLFAILALGIGAPRLFAQGTIKGVCKDADGKPIAGAVVVYA |
| Ga0137392_114923551 | 3300011269 | Vadose Zone Soil | MKKHFAVLLFVALALGLSVPPVFAQASGSVKGVCKDAQ |
| Ga0137388_107688041 | 3300012189 | Vadose Zone Soil | MKKHFAILLFAILAMGICVPSVLAQATGSVKGACKDA |
| Ga0137376_112151912 | 3300012208 | Vadose Zone Soil | MKKHFAILFFAILALGLCVPPVFAQASGSVKGICKDAQG |
| Ga0137360_111034973 | 3300012361 | Vadose Zone Soil | MRKHFAMLVFVVLILGLCATSLFGQASGTVKGVAKDV |
| Ga0137419_113431931 | 3300012925 | Vadose Zone Soil | MRKHFAILVFVVLILGLCATSLFGQASGTVKGVAKDVQGNPIVDGVV |
| Ga0182019_107822061 | 3300014498 | Fen | MKKYFAILLFAVLALGLCVPPVLAQASGSVKGVCKDAQGNPI |
| Ga0137409_103206733 | 3300015245 | Vadose Zone Soil | MRTKFAILVIAVLAVGLCVPPVFAQASGTVKGVCKDAAGTPIVDGV |
| Ga0132256_1007484453 | 3300015372 | Arabidopsis Rhizosphere | MKKHFAIFLIAVLAAALCVPVAFAQASGTVKGTCRDAQ |
| Ga0181511_10906242 | 3300016702 | Peatland | MKKHLAVFALVLLVFGVCTSPVFAQGASGSVKGVCKDADGNPI |
| Ga0181511_12582662 | 3300016702 | Peatland | MKKHFAILLFAILALALCVPPGFAQASGSVKGVCKDAQGNVVADAVVLWANMDNG |
| Ga0181505_110517921 | 3300016750 | Peatland | MKKHFAIFLFAILALGLCVPPVFAQASGTVKGVCKDADGKPIAEAIVLY |
| Ga0187818_105392302 | 3300017823 | Freshwater Sediment | MKKHFAIFLFITLAVGLCVAPAFGQASGTVKGVCKDATGAPIVDGIVVYANLD |
| Ga0187803_103851191 | 3300017934 | Freshwater Sediment | MKKHLAIFLFTVLAVGLCMPRGFGQASGTVKGVCKDVQGNYIVDAVVVYSNLD |
| Ga0187821_100343341 | 3300017936 | Freshwater Sediment | MKKHFVAGLLVALLAGLLLPPVFAQSTGSVKGVCKDG |
| Ga0187821_102965982 | 3300017936 | Freshwater Sediment | MKKHLAIFLFVILALGLCVPPVFAQASGTVKGVCKDAQGNPIADATVVWTNMDNG |
| Ga0187808_105774451 | 3300017942 | Freshwater Sediment | MKKHLAIIVVAVLALGLCVPHVLAQASGTVKGVCKDAQGNPIADG |
| Ga0187819_100742334 | 3300017943 | Freshwater Sediment | MKKRFAIFLFALLSLGLCLPPVFGQASGSVKGVCKDAQGTPIVDGVVVWANMDN |
| Ga0187819_108289961 | 3300017943 | Freshwater Sediment | MKTRFAILLLAVLALGLCIPPVFGQASGTVKGVCKDSDGNPVVDGIVVYAN |
| Ga0187879_107546401 | 3300017946 | Peatland | MKRHLVVFGLSLVMLGLCAPAVFAQGASGTVKGVCKDVQGNPIVDGVV |
| Ga0187823_102639222 | 3300017993 | Freshwater Sediment | MKKRFAILLFVILATGPCVPPVFAPTSGSVKGTAKD |
| Ga0187804_101873221 | 3300018006 | Freshwater Sediment | MKKHFAILFSALLALGLCVPPLFAQASGSIKGVCKDAQGSPIVDGVV |
| Ga0187804_102593482 | 3300018006 | Freshwater Sediment | MKKRFAIFLFALLSLGLCLPPVFGQASGSVKGVCKDAQGTPIADGVVVW |
| Ga0187804_105814922 | 3300018006 | Freshwater Sediment | MKKHFALFVLVLLMLGLCVPPVFSQASGSVKGVCKDTD |
| Ga0187872_103328212 | 3300018017 | Peatland | MKKHLAMFALVLLMMGLCAPPVFAQAASGTVKGVC |
| Ga0187855_106479492 | 3300018038 | Peatland | MKKHLAIFVLVVLAAALCVPPVFAQASGSVKGICKDAQGNPF |
| Ga0187859_105005221 | 3300018047 | Peatland | MKKHFAIFVLAVLAAALCVPSVFAQASGSVKGVCKDAQGNPFADA |
| Ga0187772_106642301 | 3300018085 | Tropical Peatland | MKRQLAILLFVLLAAGLYVPSVFAQASGTVKGVCKDPTGAPIADGIV |
| Ga0187769_113307211 | 3300018086 | Tropical Peatland | MKKHLAIFLFTVLAVGLCMPRVFGQASGTVKGVCKDVQGNPVVNGVV |
| Ga0187771_118501082 | 3300018088 | Tropical Peatland | MKKHFAILLFTVLALGLFAPRVAAQASGTVKGVCKD |
| Ga0187771_119386422 | 3300018088 | Tropical Peatland | MKKHFAIFLFAVLALGLCIPSLFAQASGTVKGVCKDA |
| Ga0210401_102151993 | 3300020583 | Soil | MKKRFAMFVFLVLMLGLCAPPGFSQASGTVKGVCKDPQGNPIVD |
| Ga0210404_107709842 | 3300021088 | Soil | MRKHLAVSVFVLLMLGLCVPSGFAQASGTVKGVCKDTDGKPLP |
| Ga0210400_102253511 | 3300021170 | Soil | MKKHFAVFAFVLLVLGFCASPVFAQSGTVKGVCKDVDGKP |
| Ga0210408_110637682 | 3300021178 | Soil | MRKHFAMLVFVVLILGLCAPALFGQASGTVKGVARDV |
| Ga0210396_112663691 | 3300021180 | Soil | MKKHFAILLFAILALGIGAPRLFAQGTIKGVCKDADGKPIAGAIVVY |
| Ga0210396_114448771 | 3300021180 | Soil | MKKHFAVSAFIFLMLGMCSPSALAQASGTVKGVAKDAQGNPL |
| Ga0210388_107668651 | 3300021181 | Soil | MKKHCAILLFVVLALGLSLPSAFAQASGTVKGVCKDAQGNPIA |
| Ga0210393_105582412 | 3300021401 | Soil | MKKHFAIFLFAVLALGLCVPPVFAQASGTVKGVCRD |
| Ga0210386_106098592 | 3300021406 | Soil | MKKYFVILLFAILVLGLCFPPAFAQASGTVKGVCKDAQGNPVADGVVIWANQD |
| Ga0210386_115057381 | 3300021406 | Soil | MKKHLAIFSFILLTLALSAPSLFAQAAGTIKGVCKDIQGNPIADGVVQLVNID |
| Ga0210394_103706513 | 3300021420 | Soil | MKKYFAILLFATLALGLCAPTVFAQASGSVEGVCKDAQGNPIADAV |
| Ga0210394_111701941 | 3300021420 | Soil | MRKHFAVFVVVLAMLGLCAPLGFAQSSATVKGVCKDLQGN |
| Ga0210391_102309041 | 3300021433 | Soil | MKKHFAVSAFIFLMLGMCAPSALAQASGTVKGVAKDA |
| Ga0210391_107589321 | 3300021433 | Soil | MQKRYFAILLLAILTLGLCVPPVSAQASGTVKGVCKDAQGNVIPDAIVLWTNTDN |
| Ga0210390_114628721 | 3300021474 | Soil | MKKHFAVFVLLVLMLGLCAPPVFSQASGTVKGVCKDRDGKP |
| Ga0210392_113043651 | 3300021475 | Soil | MKKHFAILLMVILALGVCVPSVLAQATGSVKGVCKDAQGTPIADA |
| Ga0210402_116968951 | 3300021478 | Soil | MKKHLAIFSLVLLMLGLSAVPVFAQGSSGTVKGVCKDAQGNPIVDGVVVWA |
| Ga0210410_105959552 | 3300021479 | Soil | MKRHFAGFVVVLLMLGLCASPVFAQGASGTVKGVCKDAQGNPIA |
| Ga0210409_107368212 | 3300021559 | Soil | MKKHLAIFSFILLTLALCAPSLFAQAAGTIKGVCKDIQGNPI |
| Ga0126371_106553391 | 3300021560 | Tropical Forest Soil | MKKHLAIIVFVVLALGLCAPALFAQASGTVKGTCRDAEGKPIAG |
| Ga0212123_106424971 | 3300022557 | Iron-Sulfur Acid Spring | MKKHFAGFVFVLLMLGLCVPPAFSQASGTVKGECKD |
| Ga0224560_1125431 | 3300023019 | Soil | MKKHFAVFVFVLLLLGLCVPPGFSQASGTVKGVCKDVQ |
| Ga0224554_11018782 | 3300023068 | Soil | MKKHFAIFSFVLLIVGLCLTPVFAQNSGSVKGVCKDTDGKPVAGGLVIFANQDT |
| Ga0224544_10030704 | 3300023250 | Soil | MKKHFAVFVFVVLVLALCVPPVFAQNSATVKGVCKDLQGNPIADGTVLYVNQT |
| Ga0179589_101548253 | 3300024288 | Vadose Zone Soil | MTKRFAILLFAILALGLFVPSVFAQQGTVKGVCKDAQGAPIAEAVVVYAN |
| Ga0208848_10113491 | 3300025509 | Arctic Peat Soil | MKKYFAILLFAALALGLWVPTVSAQSGSVKGVCKDSQGNVIA |
| Ga0207930_11301272 | 3300025604 | Arctic Peat Soil | MKKYFAILLFAALALGLWVPTVSAQSGSVKGVCKDSQGNVIADAIVLWANL |
| Ga0207692_111456692 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKHFSIVLITLLAAALSAPVAFAQASGTVKGTCKD |
| Ga0207685_101455603 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKHFAILLFVVLALGLCAPPVFAQASGSVKGVCKDAQGNPIADAVIVWTNMDN |
| Ga0207699_111582541 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKHFAGFVFVLLMLAFCAPTVFAQAAGTVKGVCKDQQGNPIAD |
| Ga0207684_102671983 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKHFAILLFVLLALGLCVPPVFAQAAGSVKGVCKDAQGTPLVDAVVVW |
| Ga0207700_100594685 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKYFAIFSIVVLAMGLCVLPVFGQASGTVKGVCKDAQGAPVVDGIVVWT |
| Ga0209687_11448301 | 3300026322 | Soil | MKKHFGFILFAVVTLALCVPQVFAQASGSVKGVCKDLEGK |
| Ga0209802_11163353 | 3300026328 | Soil | MRKYFAIFVFVVLVAGLCVPPVFAQASGSVKGVAKDAEGKPFVGAVVEFMN |
| Ga0179587_107167202 | 3300026557 | Vadose Zone Soil | MRKRFAVFVFVVLAVGLCAPPVFAQASGTVKGVCKDAQGN |
| Ga0207764_1204952 | 3300026839 | Tropical Forest Soil | MKKHFAILLFVVLALGLCVPPVFAQASGSVKGTCKDAQGSPVADG |
| Ga0209218_10492452 | 3300027505 | Forest Soil | MKKHFAILLFAILALGIGAPRLFAQGTIKGVCKDADGKPIAGAVVVY |
| Ga0209116_10463782 | 3300027590 | Forest Soil | MKKHFAILLFVVLALGLCVPPVFAQASGTVHGVCTDAQGN |
| Ga0209009_11259052 | 3300027667 | Forest Soil | MKKRFAGFALVLVMLALCAPSGFAQASGSVKGLCK |
| Ga0209626_12156572 | 3300027684 | Forest Soil | MKKRFAMLVFIFLMLGISAPQVFAQASGTVKGVCKDTDGKPI |
| Ga0209447_102202581 | 3300027701 | Bog Forest Soil | MKRYFAIVLLAVVAVGMSVPAMFAQASGTVKGVCKDAQGTPVADGVVVWNNVDNGQ |
| Ga0208989_100808553 | 3300027738 | Forest Soil | MRKHFAILVFVVLILGLCATSLFGQASGTVKGVAKDVQGNPVV |
| Ga0209580_102685521 | 3300027842 | Surface Soil | MKKHYAILLFAVLAAALWVPPVFGQAGSVKGVCKDVQGNPVADGVVVWTN |
| Ga0209167_102516371 | 3300027867 | Surface Soil | MKKHLAIFTFILLMLALSAPSLFAQAAGTIKGVCKD |
| Ga0209415_103021303 | 3300027905 | Peatlands Soil | MKKHFAIFVFVVLAAAFCAPSVFAQASGSVKGVCKDPQGNPI |
| Ga0265354_10237871 | 3300028016 | Rhizosphere | MKKHFAIQAFVFVLLMLGLCVPSGFSQASATVKGVCKDVDG |
| Ga0137415_100041281 | 3300028536 | Vadose Zone Soil | MRKHFAILVFVVLILGLCATSLFGQASGTVKGVAKDVQGNPIV |
| Ga0302219_100395113 | 3300028747 | Palsa | MKKHFALFVLVLAMLALCAPLGFAQASATVKGVCKDAQGNPFPDAIVIYVNQ |
| Ga0302232_103458772 | 3300028789 | Palsa | MKKLFAVFALVVLMLGRCALPVLAQGASGTVKGVCKDAQGNPIVDGVVV |
| Ga0302197_105016172 | 3300028873 | Bog | MKKHFAGFALMFLMLGLFVLPVVAQTASGTVKGVCKDTDGNPIV |
| Ga0308309_116609011 | 3300028906 | Soil | MRKHFAVLAVVLVMLGLCAALPVFAQESATVKGVCKDLQGN |
| Ga0222748_11068872 | 3300029701 | Soil | MKKYFVILLFAILALGLCLPPAFAQASGTVKGVCKDAQGNPVVDGV |
| Ga0311368_100722031 | 3300029882 | Palsa | MKKHFAVFVFVVLVLALCVPPVFAQNSATVKGVCKDLQGNPIADGTVLY |
| Ga0311369_111509582 | 3300029910 | Palsa | MKKYFAIFVLAILAAVLCVPPVFAQASGSVKGVCKDAQGNPFADA |
| Ga0311330_101586984 | 3300029945 | Bog | MKKHFAGFALMFLMLGLFVLPVVAQTASGTVKGVCKDTDGNPIVDGIV |
| Ga0311346_107115981 | 3300029952 | Bog | MKKHFAGFALMFLMLGLFVLPVVAQTASGTVKGVCKDTDGNPIVDGIVVFAN |
| Ga0311342_106784061 | 3300029955 | Bog | MKKHFEVFALVLAMLALCAPLGFAQASATMKGVCKDVQG |
| Ga0265324_102358181 | 3300029957 | Rhizosphere | MKKYLAILLFATLALGLSVPAVFAQASGSVKGVCKDAQGNPIADGIVVWTN |
| Ga0302179_103297552 | 3300030058 | Palsa | MKKHFAIFVLAVLAAALCVPSVFAQASGSVKGVCKDAQGNP |
| Ga0302192_101924842 | 3300030507 | Bog | MKMKKHFAVLSFFLLALGLCTTAGFAQASGTVKGVCKDTDGK |
| Ga0311355_101062671 | 3300030580 | Palsa | MKKHFAIFVLAVLAAALCVPSVFAQASGSVKGVCKDAQGNPFADAV |
| Ga0311355_116515761 | 3300030580 | Palsa | MKKHLAVFGFVFLMLGLCAPPVFAQASGTVKGVCKDSDGKPIVDAVVLYAN |
| Ga0311356_103330761 | 3300030617 | Palsa | MKKHFALFVLVLAMLALCAPLGFAQASATVKGVCKDAQGNPFPDAIVI |
| Ga0302310_107378972 | 3300030737 | Palsa | MKKHFAIFLFAVLTLGVAVPLASAQSASVKGVCKD |
| Ga0302180_106578071 | 3300031028 | Palsa | MKKHLAVFVFVFLVLGLCAPPVFAQAAGTVKGVCKDADGKPIVD |
| Ga0310686_1007074103 | 3300031708 | Soil | MKKHFAILFSVVLALGLCVPPVFAQASGSVKGVCKDPQGNP |
| Ga0307476_105752812 | 3300031715 | Hardwood Forest Soil | MKKHVASLVFVLVMLGLSATPVSAQVASGTVKGVVKD |
| Ga0307476_113979441 | 3300031715 | Hardwood Forest Soil | MKKHYAIFLFAVVAVALSVPSVFAQTGTVKGVCKDSTGAPIAEAYVVWTN |
| Ga0307474_100307561 | 3300031718 | Hardwood Forest Soil | MKKHYAILFSLLLLLGLGVPAVFAQASGSVKGVVKDPQGN |
| Ga0307469_104944263 | 3300031720 | Hardwood Forest Soil | MKKYFAIFSFVVLFAGLSVPSAIAQASGTVKGVCKDQ |
| Ga0307478_109002031 | 3300031823 | Hardwood Forest Soil | MKRHFAGFVLVLLMLGLCASPVFAQGASGTVKGICKDPQGNPIADAVVL |
| Ga0308175_1012320591 | 3300031938 | Soil | MKKQLGFILFAVLALALCVPPVFAQASGSVKGICKDPEGKPIAS |
| Ga0310913_109087932 | 3300031945 | Soil | MKKHLAIIGFVILVLGLSLPSAFAQNSGTVKGTCKD |
| Ga0307479_110249101 | 3300031962 | Hardwood Forest Soil | MKKHLAIFLFAVFALGLCVPSVFAQGSVKGTCKDAQGNPIADGIVVWTNMDNG |
| Ga0307479_118014401 | 3300031962 | Hardwood Forest Soil | MKKHFAVFVFVLLMLGLCVPPVFSQASGTVKGVCKDSQGNPIVDGI |
| Ga0307471_1036622111 | 3300032180 | Hardwood Forest Soil | MKKHFAILLFVVLALGLCVPPVFAQASGTVKGVCKDAQGNPIVDGVV |
| Ga0306920_1029274701 | 3300032261 | Soil | MKKHLAIIGFVILVLGLSLPSAFAQNSGTVKGTCKDAEGKPIATGLVL |
| Ga0335085_103150084 | 3300032770 | Soil | MKKHLAIFVFILLALGLCVPPVFAQASGTVKGTCKDVEG |
| Ga0335078_101434885 | 3300032805 | Soil | MKKHFAIFAITVLLLAFCVPAVFAQASGTVKGSCKDAQGNPVVDA |
| Ga0335070_114138361 | 3300032829 | Soil | MKRKLAILAVTAMAMTLAVGLCVPPAFAQASGTVKGVCKDS |
| Ga0335074_104713563 | 3300032895 | Soil | MKKRFAIFLTAVLALGLSLPAAFAQASGSVKGTCKDVQGNPIANGVVVWTNMD |
| Ga0335072_117142932 | 3300032898 | Soil | MNKPIAIILFALLTLGMCVPAAIAQASGTVQGTCKDAQGN |
| Ga0335076_100600126 | 3300032955 | Soil | MKKHLTVLGFAVLLLGFCVPPLFGQASGTVKGVCKDQQGNPIV |
| Ga0314861_0353308_1_159 | 3300033977 | Peatland | MKKHFAIFLFTVLALGLCVPLVFGQASGTVKGVCKDATGAPIVDGIVVYSNLD |
| ⦗Top⦘ |