NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F052400

Metagenome / Metatranscriptome Family F052400

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F052400
Family Type Metagenome / Metatranscriptome
Number of Sequences 142
Average Sequence Length 203 residues
Representative Sequence MLITAGQRLFFNTALQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYRK
Number of Associated Samples 77
Number of Associated Scaffolds 142

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.89 %
% of genes from short scaffolds (< 2000 bps) 97.89 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.887 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(60.563 % of family members)
Environment Ontology (ENVO) Unclassified
(83.099 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(52.817 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 66.99%    β-sheet: 1.91%    Coil/Unstructured: 31.10%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.89 %
UnclassifiedrootN/A2.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001282|B570J14230_10131303All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium728Open in IMG/M
3300001282|B570J14230_10131317All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium728Open in IMG/M
3300002271|B570J29578_1011339All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium618Open in IMG/M
3300002275|B570J29585_1009147All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium678Open in IMG/M
3300002363|B570J29624_107707All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium642Open in IMG/M
3300002367|B570J29646_108479All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium666Open in IMG/M
3300002396|B570J29629_1009388All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium793Open in IMG/M
3300002398|B570J29623_1015097All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium676Open in IMG/M
3300002399|B570J29610_1019226All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium549Open in IMG/M
3300002403|B570J29609_1029405All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium513Open in IMG/M
3300002408|B570J29032_108792614All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium511Open in IMG/M
3300005044|Ga0071351_1048151All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1527Open in IMG/M
3300005044|Ga0071351_1059933All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium694Open in IMG/M
3300005420|Ga0068879_1741061All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium587Open in IMG/M
3300005525|Ga0068877_10742514All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium522Open in IMG/M
3300005527|Ga0068876_10450268All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium712Open in IMG/M
3300005527|Ga0068876_10487208All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium678Open in IMG/M
3300005527|Ga0068876_10628443All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium579Open in IMG/M
3300005528|Ga0068872_10566716All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium604Open in IMG/M
3300005528|Ga0068872_10566717All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium604Open in IMG/M
3300007319|Ga0102691_1565715All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium614Open in IMG/M
3300008109|Ga0114342_1091088All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium789Open in IMG/M
3300008109|Ga0114342_1101416All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium738Open in IMG/M
3300008109|Ga0114342_1115652All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium678Open in IMG/M
3300008109|Ga0114342_1129433All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium630Open in IMG/M
3300008109|Ga0114342_1176964All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium514Open in IMG/M
3300008112|Ga0114345_1223578All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium640Open in IMG/M
3300008112|Ga0114345_1226631All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium635Open in IMG/M
3300008112|Ga0114345_1227535All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium633Open in IMG/M
3300008112|Ga0114345_1251723All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium598Open in IMG/M
3300008112|Ga0114345_1261307All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium585Open in IMG/M
3300008112|Ga0114345_1318310All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium516Open in IMG/M
3300008115|Ga0114348_1120821All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium558Open in IMG/M
3300008118|Ga0114352_1103772All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium592Open in IMG/M
3300008118|Ga0114352_1103963All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium592Open in IMG/M
3300008118|Ga0114352_1126277All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium532Open in IMG/M
3300008118|Ga0114352_1134329All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium515Open in IMG/M
3300008264|Ga0114353_1321982All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium624Open in IMG/M
3300008264|Ga0114353_1394601All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium515Open in IMG/M
3300008264|Ga0114353_1398743All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium510Open in IMG/M
3300009081|Ga0105098_10711388All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium534Open in IMG/M
3300009081|Ga0105098_10757374All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium521Open in IMG/M
3300012711|Ga0157607_1030474All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium650Open in IMG/M
3300012712|Ga0157598_1206939All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium529Open in IMG/M
3300012712|Ga0157598_1240335All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium507Open in IMG/M
3300012726|Ga0157597_1101616All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium527Open in IMG/M
3300012726|Ga0157597_1302455All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium666Open in IMG/M
3300012729|Ga0157625_1077491All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium616Open in IMG/M
3300013004|Ga0164293_10697413All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium651Open in IMG/M
3300013005|Ga0164292_10519044All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium778Open in IMG/M
3300013005|Ga0164292_10620143All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium697Open in IMG/M
3300016695|Ga0180059_1102884All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium757Open in IMG/M
3300020480|Ga0208201_111800All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium630Open in IMG/M
3300020482|Ga0208464_109362All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium731Open in IMG/M
3300020526|Ga0208085_1032412All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium677Open in IMG/M
3300020543|Ga0208089_1030200All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium754Open in IMG/M
3300020548|Ga0208856_1044915All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium583Open in IMG/M
3300020558|Ga0208362_1056732All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium611Open in IMG/M
3300020558|Ga0208362_1067757All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium539Open in IMG/M
3300020563|Ga0208082_1080829All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium509Open in IMG/M
3300020574|Ga0208221_1045842All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium822Open in IMG/M
3300020574|Ga0208221_1057592All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium715Open in IMG/M
3300027793|Ga0209972_10298455All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium711Open in IMG/M
3300027793|Ga0209972_10427388All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium557Open in IMG/M
3300027816|Ga0209990_10474774All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium532Open in IMG/M
3300033816|Ga0334980_0343783All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium572Open in IMG/M
3300033816|Ga0334980_0365615All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium550Open in IMG/M
3300033816|Ga0334980_0373403All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium543Open in IMG/M
3300033980|Ga0334981_0413394All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium575Open in IMG/M
3300033981|Ga0334982_0353422All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium678Open in IMG/M
3300033993|Ga0334994_0370569All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium701Open in IMG/M
3300033993|Ga0334994_0423221All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium638Open in IMG/M
3300033993|Ga0334994_0455632All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium604Open in IMG/M
3300033994|Ga0334996_0396895All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium649Open in IMG/M
3300034018|Ga0334985_0646460All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium581Open in IMG/M
3300034019|Ga0334998_0442602All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium736Open in IMG/M
3300034019|Ga0334998_0594788All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium603Open in IMG/M
3300034023|Ga0335021_0396079All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium721Open in IMG/M
3300034023|Ga0335021_0477398All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium637Open in IMG/M
3300034050|Ga0335023_0382237All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium747Open in IMG/M
3300034051|Ga0335024_0334326All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium769Open in IMG/M
3300034051|Ga0335024_0380820All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium707Open in IMG/M
3300034051|Ga0335024_0480699All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium609Open in IMG/M
3300034051|Ga0335024_0605072All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium523Open in IMG/M
3300034060|Ga0334983_0751942All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium513Open in IMG/M
3300034063|Ga0335000_0447877All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium756Open in IMG/M
3300034063|Ga0335000_0560026All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium649Open in IMG/M
3300034064|Ga0335001_0589632All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium585Open in IMG/M
3300034064|Ga0335001_0616543All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium569Open in IMG/M
3300034066|Ga0335019_0768331All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium547Open in IMG/M
3300034071|Ga0335028_0578846All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium607Open in IMG/M
3300034082|Ga0335020_0430028All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium633Open in IMG/M
3300034082|Ga0335020_0443225All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium621Open in IMG/M
3300034082|Ga0335020_0476570All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium594Open in IMG/M
3300034082|Ga0335020_0513410All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium567Open in IMG/M
3300034082|Ga0335020_0542265All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium548Open in IMG/M
3300034093|Ga0335012_0334192All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium759Open in IMG/M
3300034093|Ga0335012_0460631All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium610Open in IMG/M
3300034093|Ga0335012_0466349All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium605Open in IMG/M
3300034093|Ga0335012_0561768All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium532Open in IMG/M
3300034093|Ga0335012_0615680All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium500Open in IMG/M
3300034101|Ga0335027_0691879All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium606Open in IMG/M
3300034102|Ga0335029_0551287All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium657Open in IMG/M
3300034103|Ga0335030_0475718All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium793Open in IMG/M
3300034103|Ga0335030_0713861All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium599Open in IMG/M
3300034103|Ga0335030_0746983All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium580Open in IMG/M
3300034105|Ga0335035_0400487All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium778Open in IMG/M
3300034107|Ga0335037_0440171All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium701Open in IMG/M
3300034107|Ga0335037_0544124All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium618Open in IMG/M
3300034107|Ga0335037_0585882All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium590Open in IMG/M
3300034108|Ga0335050_0379275All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium643Open in IMG/M
3300034112|Ga0335066_0445163All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium697Open in IMG/M
3300034112|Ga0335066_0524477All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium624Open in IMG/M
3300034112|Ga0335066_0710305All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium506Open in IMG/M
3300034116|Ga0335068_0346553All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium725Open in IMG/M
3300034116|Ga0335068_0446163All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium609Open in IMG/M
3300034116|Ga0335068_0498059All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium564Open in IMG/M
3300034117|Ga0335033_0527364All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium560Open in IMG/M
3300034117|Ga0335033_0567789All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium532Open in IMG/M
3300034118|Ga0335053_0598011All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium635Open in IMG/M
3300034119|Ga0335054_0530116All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium654Open in IMG/M
3300034120|Ga0335056_0551849All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium600Open in IMG/M
3300034121|Ga0335058_0366234All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium831Open in IMG/M
3300034121|Ga0335058_0608588All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium610Open in IMG/M
3300034121|Ga0335058_0719107All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium549Open in IMG/M
3300034122|Ga0335060_0472790All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium650Open in IMG/M
3300034166|Ga0335016_0415245All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium781Open in IMG/M
3300034166|Ga0335016_0572998All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium621Open in IMG/M
3300034166|Ga0335016_0602235All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium599Open in IMG/M
3300034168|Ga0335061_0401849All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium707Open in IMG/M
3300034272|Ga0335049_0643623All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium650Open in IMG/M
3300034272|Ga0335049_0685513All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium623Open in IMG/M
3300034272|Ga0335049_0744257All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium587Open in IMG/M
3300034279|Ga0335052_0353578All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium795Open in IMG/M
3300034280|Ga0334997_0541596All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium723Open in IMG/M
3300034280|Ga0334997_0586786All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium688Open in IMG/M
3300034280|Ga0334997_0752759All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium589Open in IMG/M
3300034280|Ga0334997_0790880All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium571Open in IMG/M
3300034357|Ga0335064_0825220All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium564Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater60.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater13.38%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton13.38%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake7.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.11%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.41%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater, Plankton1.41%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300002271Freshwater microbial communities from Lake Mendota, WI - 13JUN2011 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002275Freshwater microbial communities from Lake Mendota, WI - 06JUL2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002363Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002367Freshwater microbial communities from Lake Mendota, WI - 18MAY2011 deep hole epilimnion nsEnvironmentalOpen in IMG/M
3300002396Freshwater microbial communities from Lake Mendota, WI - 13OCT2010 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002398Freshwater microbial communities from Lake Mendota, WI - 10AUG2009 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002399Freshwater microbial communities from Lake Mendota, WI - 07JUL2009 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002403Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300005044Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0048EnvironmentalOpen in IMG/M
3300005420Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005525Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaGEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300007319Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300008109Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-53-LTREnvironmentalOpen in IMG/M
3300008112Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-100-LTREnvironmentalOpen in IMG/M
3300008115Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-100-LTREnvironmentalOpen in IMG/M
3300008118Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-100-LTREnvironmentalOpen in IMG/M
3300008264Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTREnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300012711Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012712Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES121 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012726Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012729Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300016695Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES164 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020480Freshwater microbial communities from Lake Mendota, WI - 16JUL2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020482Freshwater microbial communities from Lake Mendota, WI - 13SEPL2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020526Freshwater microbial communities from Lake Mendota, WI - 21JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020527Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020543Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020548Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020558Freshwater microbial communities from Lake Mendota, WI - 13OCT2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020563Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020574Freshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034023Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090EnvironmentalOpen in IMG/M
3300034050Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095EnvironmentalOpen in IMG/M
3300034051Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097EnvironmentalOpen in IMG/M
3300034060Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016EnvironmentalOpen in IMG/M
3300034063Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053EnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034103Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M
3300034108Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034117Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034166Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079EnvironmentalOpen in IMG/M
3300034168Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034279Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M
3300034357Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B570J14230_1013130313300001282FreshwaterSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYRKPLIFPLKYNRNVGSLPATSMIQFNSMQIGNAGIPASGNEFFSFPPRAGSNPTVNWQESTLQQQQRI
B570J14230_1013131713300001282FreshwaterTYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYNRNVGSLPATSMIQFNSMQIGNAGIPASGNEFFSFPPMAGSNPT
B570J29578_101133913300002271FreshwaterDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPAXRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNLPATSMIQFNSIENGAGIIPNYGM
B570J29585_100914713300002275FreshwaterQRLFFNTALQQPETYVEISRPEASDLPSEIAVCHFLDGAKTVIDWALSLPKLKLLAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAPLTTARRLIDIVYPANRAGTEIQRSTAWRTAIISFLPDEIAIPMSERLKVANXICQPITDAELEAMAYQAEEVYRKPPPFTLKFGRNIGSIPVSAMIQF
B570J29624_10770713300002363FreshwaterAPAPVNLPAMLVTAGQRLFFNTALQQPETYVEIARPEASDLPSEIAVCHFLDGAKTVIDWALSLPKFKALAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAPLTTARRLIDIVYPANRAGTEIQRSTAWRTAIISFLPDEIAIPMSERLKVANEICQPITDAELEAMAYQAE
B570J29646_10847913300002367FreshwaterRDRRVNGAPAPVNLPAMLVTAGQRLFFNTALQQPETYVEISRPEASDLPSEIAVCHFLDGAKTVIDWALSLPKLKLLAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAPLTTARRLIDIVYPANRAGTEIQRSTAWRTAIISFLPDEIAIPMSERLKVANEICQPITDAELEAMAYQAEEV
B570J29629_100938813300002396FreshwaterDFELGDPVTIEAAGRLCRDRRVNGAPAPVNLPAMLVTAGQRLFFNTALQQPETYVEIARPEASDLPSEIAVCHFLDGAKTVIDWALSLPKFKALAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAPLTTARRLIDIVYPANRAGTEIQRSTAWRTAIISFLPDEIAIPMSERLKVANEICQPITDAELEAMAYQAEEVYRKPPPFPLKFGRNIGSIPVSAMI
B570J29623_101509713300002398FreshwaterEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNLPATSMIQFNSIENGAGIIPNYGM
B570J29610_101922613300002399FreshwaterKLRIDETPAPNFDFELGEPLTIEDAANRCAERRVNGQVAPVNLPDMLVTACQRVFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTT
B570J29609_102940513300002403FreshwaterETYVEISRPEASDLPSEIAVCHFLDGAKTVIDWALSLPKLKLLAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAPLTTARRLIDIVYPANRAGTEIQRSTAWRTAIISFLPDEIAIPMSERLKVANEIC
B570J29032_10879261413300002408FreshwaterTALQQPETYVEISRPEASDLPSEIAVCHFLDGAKTVIDWAESLPKFKQLAKERVYTARMTQQALHRLVSRFTPEHSHLVSDMTPNEMANYLLRTETNRDKTAYRRKELLELVRRPDMELRAPLTTARRLIDIVYPANRAGTEIQRSTAWRTAIISFLPDEIAIPMSERL
Ga0071351_104815113300005044Freshwater, PlanktonQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARTALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLIDLIFPANRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNLPATSMIQFNSIENGAGIIPNXXXXXXXXXXXQLPP*
Ga0071351_105993313300005044Freshwater, PlanktonDWALSLPSLKELAQQRLYTEAMARRALHRLVSIYTPEHSHLVSDMTANEMANYLLSTEVNRDKTVFRRKELFELTRKPDMDRRAPLTTARRLVDMIFPADRAEMALQRSAAWRTAIISFLPDEIAIPISDRLKIANDKCRPISDQELEAMAYQAEEAYKKPLVFPLKYGRNVGNLPVTSMVQFNSIENGAGIIPNYGMPVTGIGRLYQTYPPFPPMVDNNVLVRQQEAARQ
Ga0068879_174106113300005420Freshwater LakeLHNFMQKLRIEETPAPNFDFELGNPITVQNAANRCADRRVNGQRAPVNLPDMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEIAACHFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDM
Ga0068877_1074251413300005525Freshwater LakeVTIETAGRLCRDRRVNGAPAPVNLPAMLVTAGQRLFFNTALQQPETYVEISRPEASDLPSEIAVCHFLDGAKTVIDWALSLPKLKLLAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAPLTTARRLIDIVYPA
Ga0068876_1045026813300005527Freshwater LakeMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQTLHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNLPATSMIQFNSIENGAGIIPNYGMPVTG
Ga0068876_1048720813300005527Freshwater LakeNRCAERRVNGQAAPVNLPDMLVTACQRVFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARTALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLIDLIFPANRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAY
Ga0068876_1062844313300005527Freshwater LakeMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLIDLIFPANRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAY
Ga0068872_1056671613300005528Freshwater LakeQRVFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARTALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLIDLIFPANRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAY
Ga0068872_1056671713300005528Freshwater LakeQRVFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLIDLIFPANRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAY
Ga0102691_156571513300007319Freshwater LakeLHNFMQKLRIEETPAPNFDFELGNPITIQNAANRCADKRVNGQRAPVNLPDMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSLYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARRLIDIIFPANRPEM
Ga0114342_109108813300008109Freshwater, PlanktonNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNLPATSMIQFNSIENGAGIIPNYGMPVTGIGRLYQTYPPFPPLVDNNVLVR
Ga0114342_110141613300008109Freshwater, PlanktonITAGQRLFFNTALQQPATYVEISRPEASDLPSEIAACHFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSLYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARRLIDKIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYRKPLVFPLKYNRNVGSLPATSMIQFNSMQIGNAGIPASGN
Ga0114342_111565213300008109Freshwater, PlanktonRRVNGQRAPVNLPDMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTAYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCTPISDEELEAMAYQAEEAYRKPL
Ga0114342_112943313300008109Freshwater, PlanktonGRLCRDRRVNGAPAPVNLPAMLVTAGQRLFFNTALQQPETYVEISRPEASDLPSEIAVCHFLDGAKTVIDWALSLPKLKLLAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAPLTTARRLIDIVYPANRAGTEIQRSTAWRTAIISFLPDEIAIPMSERLKVANEICQP
Ga0114342_117696413300008109Freshwater, PlanktonGQRAPVNLPDMLVTAGQRLFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQERLYTEAMARQALHRLVSKYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAW
Ga0114345_122357813300008112Freshwater, PlanktonNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQTLHRLVSIYTPEHAHLVSDMNANETANYLLSTETNRDKTVYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNL
Ga0114345_122663113300008112Freshwater, PlanktonTAMQQPATYVEISRPEASDLPSEVAASRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQSLHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTVYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPANRPEMAMQRSAAWRTAIISFLPDEIAIPLSDRLKLANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGS
Ga0114345_122753513300008112Freshwater, PlanktonVFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARTALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLIDLIFPANRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYG
Ga0114345_125172313300008112Freshwater, PlanktonRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNL
Ga0114345_126130713300008112Freshwater, PlanktonNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEE
Ga0114345_131831013300008112Freshwater, PlanktonVFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISD
Ga0114348_112082113300008115Freshwater, PlanktonRRVNGQRAPVNLPDMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTAYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPD
Ga0114352_110377213300008118Freshwater, PlanktonVFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARTALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLIDLIFPANRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEE
Ga0114352_110396313300008118Freshwater, PlanktonVFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLIDLIFPANRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEE
Ga0114352_112627713300008118Freshwater, PlanktonFDFELGNPITVQDAANRCADRRVNGQRAPVNLPDMLVTAGQRLFFNTALQQPATYREISRPEASDLPSEVAACHFLDGAKKVIDWALSLPSLKILAKERLYTGAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARRLID
Ga0114352_113432913300008118Freshwater, PlanktonFDFELGNPITVQNAANRCADRRVNGQRAPVNLPDILITAGQRLFFNTALQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTAYRRKELFELTRKPDMDLRAPLTI
Ga0114353_132198213300008264Freshwater, PlanktonNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQERLYTEAMARQALHRLVSKYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYRKPLIFPLKYN
Ga0114353_139460113300008264Freshwater, PlanktonRVNGQRAPVNLPDMLITAGQRLFFNTALQQPATYREISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKRLARERLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTAYRRKELFELTRKPDMDLRAPLTRARKLIDMIFPANRPEMAMQRS
Ga0114353_139874313300008264Freshwater, PlanktonNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIIPFLTDEIAIPISDR
Ga0105098_1071138813300009081Freshwater SedimentGQVAPVNLPDMLVTAGQRLFFNTAMQQPATYVEISRPESSDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTTARRLIDIIFPANRPEMAVQRSAAWRTAIIS
Ga0105098_1075737413300009081Freshwater SedimentATYVEISRPEASDLPSEVAACRFLDGANKFIDWALSLPSLKELAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPI
Ga0157607_103047413300012711FreshwaterIDETPAPEFDFELGEPLTIEDAANRCAERRVNGQAAPVNLPDMLVTACQRVFFNTAMQQPATYVEISRPEVSDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSKYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPADRPEMAMQRSAAWRTAIISFLPDEIA
Ga0157598_120693913300012712FreshwaterTVQDAANRCADRRVNGQRAPVNLPDMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEIAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANR
Ga0157598_124033513300012712FreshwaterTVQDAANRCADRRVNGQRAPVNLPDMLVTAGQRLFFNTALQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTAYRRKELFELTRKPDMDLRAPLTIARKLID
Ga0157597_110161613300012726FreshwaterNLPDMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEIAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARRLIDKIFPANRPEMAMQRSAAWRTAIISFLPD
Ga0157597_130245513300012726FreshwaterEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARTALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTVYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNLPATSMIQFNSIENGAGIIPNYGMPVTGIGRLY
Ga0157625_107749113300012729FreshwaterEETPAPNFDFELGNPITVQNAANRCADRRVNGQRAPVNLPDMLITAGQRLSFNTALQQPATYVEIRRPEASDLLSEVAASRFLDGAKKVIDWALSLPSLKTLAQERFYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTLYRRKELFELNRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTA
Ga0164293_1069741313300013004FreshwaterITASQRLFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYRKPLIFPLKYN
Ga0164293_1104700913300013004FreshwaterDWALSLPKFKALAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAPLTTARRLIDVIYPADRAGTETQRSTVWRTAIISFLPDEIAIPLSDRLKVANEICQPITDDELEAMAYQAEEVYRKPPPFPLKF
Ga0164292_1051904413300013005FreshwaterRVNGAPAPVNLPAMLVTAGQRLFFNTALQQPETYMEIARPEASDLPSEIAVCHFLDGAKTVIDWAESLPKFKQLAKERVYTARMTQQALHRLVSRFTPEHSHLVSDMTPNEMANYLLRTETNRDKTAYRRKELLELVRRPDMELRAPLTTARRLIDIVYPANRAGTEMQRSTYWRMAIISFLPDEIAVPISERLKVANERCQPITDDELEAMAYQAEEVYRKKPPFPLKFGRDIGSIPVSAMIQFNSIDQELENRTAPN
Ga0164292_1062014313300013005FreshwaterVTIETAGRLCRDRRVNGAPAPVNLPAMLVTAGQRLFFNTALQQPETYVEISRPEASDLPSEIAVCHFLDGAKTVIDWALSLPKLKLLAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAPLTTARRLIDTVYPANRAGTEIQRSTVWRTAILSFLPDEIAIPMSERLKVANEICQPITDAELEAMAYQAEEV
Ga0180059_110288413300016695FreshwaterNGQAAPVNLPDMLVTACQRVFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYRKPLNFPLKYNRNVGSLPATSMIQFNSMQIGNA
Ga0208201_11180013300020480FreshwaterISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYRKPLIFPLKYNRNVGSLPATSIVQFN
Ga0208464_10936213300020482FreshwaterANRCADRRVNGQRAPVNLPDMLVTAGQRLFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYRKPLIFPLKYNRNVGS
Ga0208085_103241213300020526FreshwaterVTAGQRLFFNTALQQPETYVEIARPEASDLPSEIAVCHFLDGAKTVIDWALSLPKFKALAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAPLTTARRLIDVIYPADRAGTETQRSTVWRTAIISFLPDEIAIPLSDRLKVANEICQPITDDELEAMAYQAEEVYRKPPPFPLKFGRNIGSIPVS
Ga0208232_103277913300020527FreshwaterRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNLPATSMIQFNSIENGAGIIPNYGMPVTGIGRLYQTYPPFPPMVDNNVLVRQQEAARQAERDRQAAEQAAAAEQA
Ga0208089_103020013300020543FreshwaterGNPITIQNAANRCADRRVNGQRAPVNLPDMLITAAQRLFFNTALQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSKYTPEHAHLVSDMNANETANYLLSTEINRDKTAYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYRKPLIFPLKYNRNV
Ga0208856_104491513300020548FreshwaterEQLRIGTDEPIAEFDFELGDPITIEAAGRLCRDRRVNGAPAPVNLPAMLVTAGQRLFFNTALQQPETYVEIARPEASDLPSEIAVCHFLDGAKTVIDWALSLPKFKALAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAPLTTARRLIDVIYP
Ga0208362_105673213300020558FreshwaterFMQKLRIEETPAPNFDFELGNPITVQNAANRCADRRVNGQRAPVNLPDMLVTAGQRLFFNTALQQPATYREISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKRLASERLYTEAMARQALHRLVSIYTPEHSHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDRIFPANRPEMAM
Ga0208362_106775713300020558FreshwaterFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLIDLIFPANRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKC
Ga0208082_108082913300020563FreshwaterPGTPLHNFMQKLRIEETPAPNFDFELGNPITVQDAANRCADRRVNGQRAPVNLPDMLVTAGQRLFFNTALQQPATYREISRPEASDLPSEVAACHFLDGAKKVIDWALSLPSLKILAKERLYTGAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTA
Ga0208221_104584213300020574FreshwaterFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTAYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCTPISDEELEAMAYQAEEAYRKPLIFPLKYNRNVGSLPATSMIQFNSMQIGNAGIPASGNEFFSFPPMAGSNPTVNWQESTMQQQQRIALQEAMQ
Ga0208221_105759213300020574FreshwaterDFELGNPITIQNAANRCADRRVNGQRAPVNLPDMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEIAACHFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSLYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARRLIDKIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAE
Ga0209972_1029845513300027793Freshwater LakeYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNLPATSMIQFNSIENGAGIIPNYGMPVTGIGRLY
Ga0209972_1042738813300027793Freshwater LakeTQFMEQLRIGTEEPEAEFDFELGEPMTIETAGRLCRDRRVNGAPAPVNLPAMLVTAGQRLFFNTAMQQPETYVEISRPEASDLPSEIAVCHFLDGAKTVIDWAESLPKFKQLAKERVYTARMTQQALHRLVSRFTPEHSHLVSDMTPNEMANYLLRTETNRDKTAYRRKELLELVRRPDMELRAP
Ga0209990_1047477413300027816Freshwater LakeEVAACRFLDGAKKFIDWALSLPSLKELAQQRPYTEAMARRALHRLVSIYTPEHSHLVSDMTANEMANYLLSTEVNRDKTVFRRKELFELTRKPDMDLRAPLTTARRLIDMIFPADRAEMALQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPL
Ga0334980_0343783_2_5713300033816FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTAYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRP
Ga0334980_0365615_1_5343300033816FreshwaterVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLIDLIFPANRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDRELEAM
Ga0334980_0373403_3_5423300033816FreshwaterIDETPAPNFDFELGNPITVQNAANRCADRRVNGQRAPVNLPDMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHSHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTTA
Ga0334981_0413394_1_5733300033980FreshwaterPEFDFELGEPLTIEDAANRCAERRVNGQAAPVNLPDMLVTACQRVFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLIDLIFPANRPEMAM
Ga0334982_0353422_56_6763300033981FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEIAACHFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSLYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARRLIDKIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKKANEKCRPISDEELEAMAYQAEEAY
Ga0334994_0370569_1_6993300033993FreshwaterVTIETAGRLCRDRRVNGAPAPVNLPAMLVTAGQRLFFNTALQQPETYVEISRPEASDLPSEIAVCHFLDGAKTVIDWALSLPKLKLLAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAPLTTARRLIDIVYPANRAGTEIQRSTAWRTAIISFLPDEIAIPMSERLKVANEICQPITDAELEAMAYQAEEVY
Ga0334994_0423221_42_6383300033993FreshwaterMLVTAGQRLFFNTAMQLPATYVEISRPEASDLPSEVAACRFLDGAKKFIDWALSLPSLKELAQQRLYTEAMARRALHRLVSIYTPEHSHLVSDMTANEMANYLLSPEVNRDKTVYRRKELFELTRKPDMDLRAPLTTARRLIDMIFPADRAEMALQRSAAWRTAIISFLPDEIAIPISDRIKIANEKCRPIFDQELEAM
Ga0334994_0455632_3_6023300033993FreshwaterPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNLPA
Ga0334996_0396895_43_6483300033994FreshwaterMLVTAGQRLFFNTALQQPETYVEISRPEASDLPSEIAVCHFLDGAKTVIDWAESLPKFKQLAKERVYTARMTQQALHRLVSRFTPEHSHLVSDMTPNEMANYLLRTETNRDKTAYRRKELLELVRRPDMELRAPLTTARRLIDIVYPANRAGTEMQRSTYWRMAIISFLPDEIAVPISERLKVANERCQPITDDELEAMAYQ
Ga0334985_0646460_1_5793300034018FreshwaterMLVTAGQRLFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKFIDWAMSLPSLKELAQQRLYTEAMARRALHRLVSIYTPEHSHLVSDMTANEMANYLLSTEVNRDKTVYRRKELFELTRKPDMDLRAPLTTARRLIDMIFPADRAEMALQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISD
Ga0334998_0442602_1_7263300034019FreshwaterVEISRPEVSDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTAYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYRKPLTLPLKYNRNVGSLPATSMIQFNSMQIGNAGIPASGNEFFSFPPMAGSNPTMN
Ga0334998_0594788_3_5483300034019FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEIAACHFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSLYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARRLIDKIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLK
Ga0335021_0396079_2_7213300034023FreshwaterETPAPNFDFELGNPITVEDAANRCADRRVNEQAAPVNLPDMLVTAGQRLFFNTAMQLPATYVEISRPEASDLPSEVAACRFLDGAKKFIDWALSLPSLKELAQQRLYTEAMARRALHRLVSIYTPEHSHLVSDMTANEMATYLLSTEVNRDKTVYRRKELFELTRKPDMDLRAPLTTARRLINMIFPADRAEMALQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMA
Ga0335021_0477398_24_6353300034023FreshwaterMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYRKPLIFPLKYN
Ga0335023_0382237_28_7473300034050FreshwaterVNEQAAPVNLPDMLVTACQRVFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYRKPLIFPLKYNRNVGSLPATS
Ga0335024_0334326_3_7673300034051FreshwaterPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNLPATSMIQFNSIENGAGIIPNYGMPVTGIGRLYQTYPPFPPLVDNNVLVRQQEAARQA
Ga0335024_0380820_3_7073300034051FreshwaterVTIETAGRLCRDRRVNGAPAPVNLPAMLVTAGQRLFFNTALQQPETYVEISRPEASDLPSEIAVCHFLDGAKTVIDWALSLPKLKLLAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAPLTTARRLIDTVYPANRAGTEIQRSTAWRTAILSFLPDEIAIPMSERLKVANEICQPITDAELEAMAYQAEEVYRK
Ga0335024_0480699_3_5723300034051FreshwaterMQLPATYVEISRPEASDLPSEVAACRFLDGAKKFIDWALSLPSLKELAQQRLYTEAMARRALHRLVSIYTPEHSHLVSDMTANEMANYLLSTEVNRDKTVFRRKELFELTRKPDMDLRAPLTTARRLIDMIFPADRAEMALQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAE
Ga0335024_0605072_3_4673300034051FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTAYRRKELFELTRKPDMDLRAPLTIARKLIDRIFPANRPEMAM
Ga0334983_0751942_2_4933300034060FreshwaterVEISRPEASDLPSEIAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARRLIDKIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIAN
Ga0335000_0447877_3_7553300034063FreshwaterPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNLPATSMIQFNSIENGAGIIPNYGMPVTGIGRLYQTYPPFPPLVDNNVLVRQQEA
Ga0335000_0560026_32_6493300034063FreshwaterMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQVLEAMAYQAEEAYKKPLLFPLKYGRN
Ga0335001_0589632_19_5853300034064FreshwaterMQQPATYVEISRPEASDLPSEVAACRFLDGAKKFIDWAMSLPSLKELAQQRLYTEAMARRALHRLVSIYTPEHSHLVSDMTANEMANYLLSTEVNRDKTVYRRKELFELTRKPDMDLRAPLTTARRLIDMILPADRAEMALQRSAAWRTAIISFLPDEIAIPISDRLKIANDKCRPISDQELEAMAYQA
Ga0335001_0616543_1_5643300034064FreshwaterMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARTALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLIDLIFPANRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQ
Ga0335019_0768331_15_5453300034066FreshwaterMQKLRIDETPAPDFDFELGNPITVEDAANRCADRRVNDQAAPVNLPDMLVTAGKRLFFNTAMQLPATYVEISRPEASDLPSEVAACRFLDGAKKFIDWALSLPSLKELAQQRLYTEAMARRALHRLVSIYTPEHSHLVSDMTANEMATYLLSTEVNRDKTVYRRKELFELTRKPDMD
Ga0335028_0578846_24_6053300034071FreshwaterMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYR
Ga0335020_0430028_3_5453300034082FreshwaterMLVTAGQRLFFNTAMQQPATYVEISRPEASDLPSEVAACHFLDGAKKVIDWALSLPSLKRLARERLYTETMARHALHRLVSIYTPEHSHLVSDMTANEMANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDR
Ga0335020_0443225_3_6203300034082FreshwaterPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNLPATSMIQF
Ga0335020_0476570_2_5623300034082FreshwaterMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARTALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLIDLIFPANRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAY
Ga0335020_0513410_72_5663300034082FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEVAACHFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSKYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAI
Ga0335020_0542265_113_5473300034082FreshwaterMLITASQRLFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQERLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTAYRRKELFELTRKPDMDLRAPLTIARKLIDRI
Ga0335012_0334192_2_7273300034093FreshwaterMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARTALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLIDLIFPANRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNLPATSMIQFNSIENGAGIIPNYGMPVTGIGRLY
Ga0335012_0460631_3_5753300034093FreshwaterMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEE
Ga0335012_0466349_1_6033300034093FreshwaterETYVEISRPEASDLPSEIAVCHFLDGAKTVIDWAESLPKFKQLAKERVYTARMTQQALHRLVSRFTPEHSHLVSDMTPNEMANYLLRTETNRDKTAYRRKELLELVRRPDMELRAPLTTARRLIDIVYPANRAGTEMQRSTYWRMAIISFLPDEIAVPISERLKVANERCQPITDDELEAMAYQAEEVYRKKPPFPLKFGR
Ga0335012_0561768_3_4763300034093FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEIAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQTLHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARRLIDKIFPANRPEMAMQRS
Ga0335012_0615680_1_4983300034093FreshwaterAPNFDFELGNPITVQNAANRCADRRVNGQRAPVNLPDMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHSHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDM
Ga0335027_0691879_2_5503300034101FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEIAACHFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSLYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARRLIDKIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKI
Ga0335029_0551287_2_5953300034102FreshwaterMEQLRIGTEEPVAEFDFELGEPVTIETAGRLCRDRRVNGAPAPVNLPAMLVTAGQRLFFNTALQQPETYVEISRPEASDLPSEIAVCHFLDGAKTVIDWALSLPKLKLLAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAPLTTARRLIDIVYPANR
Ga0335030_0475718_2_5233300034103FreshwaterMQKLRIEETPAPNFDFELGNPITVQNAANRCADRRVNGQRAPVNLPDMLVTAGQRLFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKP
Ga0335030_0713861_1_5913300034103FreshwaterVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYG
Ga0335030_0746983_56_5803300034103FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEIAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQTLHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARRLIDIIFPANRPEMAMQRSAAWRTAIISFLPDEIAV
Ga0335035_0400487_9_7763300034105FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEIAACHFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSLYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARRLIDKIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYRKPLIFPLKYNRNVGSLPATSMIQFNSMQIGNAGIPASGNEFFSFPPMA
Ga0335037_0440171_2_6823300034107FreshwaterMLVTASQRLFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNLPAT
Ga0335037_0544124_4_6183300034107FreshwaterMQKLRIEETPAPNFDFELGNPITVQNAANRCADRRVNGQRAPVNLPDMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEIAACHFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHSHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRS
Ga0335037_0585882_1_5373300034107FreshwaterMLVTAGQRLFFNTALQQPETYVEIARPEASDLPSEIAVCHFLDGAKTVIDWALSLPKFKALAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAPLTTARRLIDVIYPADRAGTETQRSTVWRTAIISFLPDEIAIPLSD
Ga0335050_0379275_1_6153300034108FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEVAASRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTVYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEE
Ga0335066_0445163_3_6233300034112FreshwaterMLVTAGQRLFFNTALQQPETYVEIARPEASDLPSEIAVCHFLDGAKTVIDWALSLPKFKALAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAPLTTARRLIDIVYPANRAGTEIQRSTAWRTAIISFLPDEIAIPMSERLKVANEICQPITDAELEAMAYQAEEVY
Ga0335066_0524477_1_6243300034112FreshwaterVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTVYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNLPATSM
Ga0335066_0710305_3_4943300034112FreshwaterVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIAN
Ga0335068_0346553_9_7253300034116FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEIAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQTLHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARRLIDKIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYRKPLTFPLKYNRNVGSLPATSMIQFNSMQIGN
Ga0335068_0446163_1_6093300034116FreshwaterPAPNFDFELGEPLTIEAAANRCAERRVNGQVAPVNLPDMLVTACQRVFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAI
Ga0335068_0498059_2_5353300034116FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHSHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTTARRLIDIIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLS
Ga0335033_0527364_3_5543300034117FreshwaterVENAANRCAERRVNEQAAPVNLPDMLVTAGQRLFFNTAMQQPATYVEISRPEASDLPSEVAASRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTVYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPANRPEMAMQRSAA
Ga0335033_0567789_3_4763300034117FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEIAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARRLIDKIFPANRPEMAMQRS
Ga0335053_0598011_1_6333300034118FreshwaterQKLRIDETPAPNFDFELGEPLTIEAAANRCAERRVNGQVAPVNLPDMLVTACQRVFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAI
Ga0335054_0530116_1_6273300034119FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYRK
Ga0335056_0551849_3_5843300034120FreshwaterMTIETAGRLCRERRVNGAPAPVNLPAMLVTAGQRLFFNTALQQPETYVEISRPEASDLPSEIAVCHFLDGAKTVIDWAESLPKFKQLAKERVYTARMTQQALHRLVSRFTPEHSHLVSDMTPNEMANYLLRTETNRDKTAYRRKELLELVRRPDMELRAPLTTARRLIDIVYPANRAGTEIQRSTAWRTAIISF
Ga0335058_0366234_1_7893300034121FreshwaterMLVTAGQRLFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKFIDWAMSLPSLKELAQQRLYTEAMARRALHRLVSIYTPEHSHLVSDMTANEMANYLLSTEVNRDKTVYRRKELFELTRKPDMDLRAPLTTARRLIDMIFPADRAEMALQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLVFPLKYGRNVGNLPVTSMVQFNSIENGAGIIPNYGMPVTGIGRLYQTYPPFP
Ga0335058_0608588_3_5543300034121FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEIAACHFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQTLHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARRLIDKIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIA
Ga0335058_0719107_3_5483300034121FreshwaterMEQLRIGTDEPIAEFDFELGDPVTIEAAGRLCRDRRVNGAPAPVNLPAMLVTAGQRLFFNTALQQPETYVEIARPEASDLPSEIAVCHFLDGAKTVIDWALSLPKFKALAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAP
Ga0335060_0472790_2_6373300034122FreshwaterMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYRKPLIFPLKYNRNVGSLPA
Ga0335016_0415245_3_7733300034166FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEIAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARRLIDKIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEEAYRKPLTFPLKYNRNVGSLPATSMIQFNSMQIGNAGIPASGNEFFSFPPMAG
Ga0335016_0572998_3_6203300034166FreshwaterVEISRPEASDLPSEIAVCHFLDGAKTVIDWAESLPKFKQLAKERVYTARMTQQALHRLVSRFTPEHSHLVSDMTPNEMANYLLRTETNRDKTAYRRKELLELVRRPDMELRAPLTTARRLIDIVYPANRAGTEMQRSTYWRMAIISFLPDEIAVPISERLKVANERCQPITDDELEAMAYQAEEVYRKKPPFPLKFGRDIGSIPVS
Ga0335016_0602235_2_5413300034166FreshwaterMLVTASQRLFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDR
Ga0335061_0401849_32_7063300034168FreshwaterMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYKKPLLFPLKYGRNVGNLPATSMIQFNSIKNGA
Ga0335049_0643623_1_5853300034272FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETANYLLSTEINRDKTAYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCTPISDEE
Ga0335049_0685513_3_6233300034272FreshwaterPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISDQELEAMAYQAEEAYRKPLIFPLKYNRNVGSLPATSMIQFN
Ga0335049_0744257_2_5023300034272FreshwaterMLITASQRLFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSKYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIIS
Ga0335052_0353578_67_7953300034279FreshwaterMLVTAGQRLFFNTALQQPETYVEISRPEASDLPSEIAVCHFLDGAKTVIDWALSLPKLKLLAQERVYTARMAQQALHRLVSRFTPEHSHLVSDMTANEMANYLLRTETNRDKTAYRRKELHELVRKPDMELRAPLTTARRLIDIVYPANRAGTEIQRSTAWRTAIISFLPDEIAIPMSERLKVANEICQPITDAELEAMAYQAEEVYRKPPPFPLKFGRNIGSIPVSAMIQFNSIDNEINQAV
Ga0334997_0541596_3_6833300034280FreshwaterMLVTAGQRLFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKFIDWALSLPSLKELAQQRLYTEAMARRALHRLVSIYTPEHSHLVSDMTANEMANYLLSTEVNRDKTVFRRKELFELTRKPDMDLRAPLTTARRLIDMIFPADRAEMALQRSAAWRTAIISFLPDEIAIPISDRLKIANAKCRPISDQELEAMAYQAEEAYKKPLVFPLKYGRNVGNLPVT
Ga0334997_0586786_3_6173300034280FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEVAACHFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSKYTPEHAHLVSDMTANETANYLLSTETNRDKTSYRRKELFELTRKPDMDLRAPLTIARKLIDMIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPLSDRLKIANEKCRPISDEELEAMAYQAEE
Ga0334997_0752759_3_5333300034280FreshwaterMLITAGQRLFFNTALQQPATYVEISRPEASDLPSEIAACRFLDGAKKVIDWALSLPSLKTLAQERLYTEAMARQALHRLVSIYTPEHAHLVSDMTANETANYLLSTETNRDKTAYRRKELFELTRKPDMDLRAPLTTARRLIDKIFPANRPEMAMQRSAAWRTAIISFLPDEIAVPL
Ga0334997_0790880_69_5693300034280FreshwaterMLVTACQRVFFNTAMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLVDLIFPADRPEMAMQRSAAWRTAIIS
Ga0334997_0951470_1_5073300034280FreshwaterCHFLDGAKTVIDWAESLPKFKQLAKERVYTARMTQQALHRLVSRFTPEHSHLVSDMTPNEMANYLLRTETNRDKTAYRRKELLELVRRPDMELRAPLTTARRLIDIVYPANRAGTEMQRSTYWRMAIISFLPDEIAVPISERLKVANERCQPITDDELEAMAYQAEEVY
Ga0335064_0825220_2_5383300034357FreshwaterMQQPATYVEISRPEASDLPSEVAACRFLDGAKKVIDWALSLPSLKQLAQQRLYTEAMARQALHRLVSIYTPEHAHLVSDMNANETATYLLSTEINRDKTLYRRKELFELTRKPEMDLRAPLTTARRLIDLIFPANRPEMAMQRSAAWRTAIISFLPDEIAIPISDRLKIANEKCRPISD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.