NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F052364

Metatranscriptome Family F052364

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F052364
Family Type Metatranscriptome
Number of Sequences 142
Average Sequence Length 168 residues
Representative Sequence EWVVKVDADAVFVPHRLKGMLQGHPITYTGIYLENCKSVQWGFFGNLEVFSVEAFNTLLANIDSCSQKIDWVKGTKWGPIGEDLFAQMCMDSNGVSKVQNFDVTTDGACPGTRKRWGEEKNKKWKPPCNLVGTPALHPFKKPEEYFSCLDATMTFG
Number of Associated Samples 81
Number of Associated Scaffolds 142

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.11 %
% of genes near scaffold ends (potentially truncated) 95.77 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 73
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(69.718 % of family members)
Environment Ontology (ENVO) Unclassified
(81.690 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.845 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.26%    β-sheet: 9.78%    Coil/Unstructured: 61.96%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008934|Ga0103737_1030736All Organisms → cellular organisms → Eukaryota → Sar686Open in IMG/M
3300009006|Ga0103710_10190007All Organisms → cellular organisms → Eukaryota → Sar560Open in IMG/M
3300009022|Ga0103706_10208298All Organisms → cellular organisms → Eukaryota → Sar514Open in IMG/M
3300009025|Ga0103707_10148278All Organisms → cellular organisms → Eukaryota → Sar551Open in IMG/M
3300009028|Ga0103708_100130508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata665Open in IMG/M
3300009216|Ga0103842_1018509All Organisms → cellular organisms → Eukaryota → Sar692Open in IMG/M
3300009269|Ga0103876_1013487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata884Open in IMG/M
3300009269|Ga0103876_1027319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata723Open in IMG/M
3300009269|Ga0103876_1033829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata677Open in IMG/M
3300009269|Ga0103876_1039344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata644Open in IMG/M
3300009269|Ga0103876_1050675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata592Open in IMG/M
3300009272|Ga0103877_1001680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata843Open in IMG/M
3300009272|Ga0103877_1002152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata810Open in IMG/M
3300009272|Ga0103877_1004952All Organisms → cellular organisms → Eukaryota → Sar698Open in IMG/M
3300009272|Ga0103877_1008261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata632Open in IMG/M
3300009272|Ga0103877_1014635All Organisms → cellular organisms → Eukaryota → Sar559Open in IMG/M
3300009272|Ga0103877_1020010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300009276|Ga0103879_10008349All Organisms → cellular organisms → Eukaryota → Sar765Open in IMG/M
3300009279|Ga0103880_10013534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata846Open in IMG/M
3300009279|Ga0103880_10030555All Organisms → cellular organisms → Eukaryota → Sar688Open in IMG/M
3300009279|Ga0103880_10032207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata678Open in IMG/M
3300009353|Ga0103847_1004406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata682Open in IMG/M
3300010981|Ga0138316_11217504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata633Open in IMG/M
3300010985|Ga0138326_10515787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata590Open in IMG/M
3300010985|Ga0138326_10771973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata633Open in IMG/M
3300010985|Ga0138326_12045232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata580Open in IMG/M
3300010985|Ga0138326_12092342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300010987|Ga0138324_10601499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata550Open in IMG/M
3300018594|Ga0193292_1001762All Organisms → cellular organisms → Eukaryota → Sar1083Open in IMG/M
3300018597|Ga0193035_1013768All Organisms → cellular organisms → Eukaryota → Sar656Open in IMG/M
3300018597|Ga0193035_1020013All Organisms → cellular organisms → Eukaryota → Sar562Open in IMG/M
3300018611|Ga0193316_1034646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300018636|Ga0193377_1011622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata730Open in IMG/M
3300018637|Ga0192914_1004155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata992Open in IMG/M
3300018637|Ga0192914_1004581All Organisms → cellular organisms → Eukaryota → Sar958Open in IMG/M
3300018637|Ga0192914_1004625All Organisms → cellular organisms → Eukaryota → Sar956Open in IMG/M
3300018637|Ga0192914_1004626All Organisms → cellular organisms → Eukaryota → Sar956Open in IMG/M
3300018637|Ga0192914_1005136All Organisms → cellular organisms → Eukaryota → Sar918Open in IMG/M
3300018643|Ga0193431_1015105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata786Open in IMG/M
3300018643|Ga0193431_1015229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata783Open in IMG/M
3300018653|Ga0193504_1009353All Organisms → cellular organisms → Eukaryota → Sar954Open in IMG/M
3300018653|Ga0193504_1011746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata877Open in IMG/M
3300018653|Ga0193504_1028169All Organisms → cellular organisms → Eukaryota → Sar601Open in IMG/M
3300018659|Ga0193067_1027094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata853Open in IMG/M
3300018659|Ga0193067_1031484All Organisms → cellular organisms → Eukaryota → Sar794Open in IMG/M
3300018659|Ga0193067_1064096All Organisms → cellular organisms → Eukaryota → Sar526Open in IMG/M
3300018662|Ga0192848_1044339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300018675|Ga0193384_1034048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata538Open in IMG/M
3300018691|Ga0193294_1038402All Organisms → cellular organisms → Eukaryota → Sar547Open in IMG/M
3300018696|Ga0193110_1005416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1076Open in IMG/M
3300018696|Ga0193110_1009064All Organisms → cellular organisms → Eukaryota → Sar933Open in IMG/M
3300018696|Ga0193110_1019100All Organisms → cellular organisms → Eukaryota → Sar735Open in IMG/M
3300018696|Ga0193110_1023390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata684Open in IMG/M
3300018696|Ga0193110_1025360All Organisms → cellular organisms → Eukaryota → Sar664Open in IMG/M
3300018711|Ga0193069_1010576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata916Open in IMG/M
3300018738|Ga0193495_1054246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300018739|Ga0192974_1043695All Organisms → cellular organisms → Eukaryota → Sar770Open in IMG/M
3300018739|Ga0192974_1050598All Organisms → cellular organisms → Eukaryota → Sar707Open in IMG/M
3300018793|Ga0192928_1081227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata560Open in IMG/M
3300018794|Ga0193357_1038096All Organisms → cellular organisms → Eukaryota → Sar788Open in IMG/M
3300018794|Ga0193357_1051253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata684Open in IMG/M
3300018794|Ga0193357_1055256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata657Open in IMG/M
3300018807|Ga0193441_1041281All Organisms → cellular organisms → Eukaryota → Sar818Open in IMG/M
3300018811|Ga0193183_1095648All Organisms → cellular organisms → Eukaryota → Sar526Open in IMG/M
3300018837|Ga0192927_1048623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata661Open in IMG/M
3300018850|Ga0193273_1057537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata581Open in IMG/M
3300018854|Ga0193214_1050776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata799Open in IMG/M
3300018854|Ga0193214_1084588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata585Open in IMG/M
3300018865|Ga0193359_1077644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata633Open in IMG/M
3300018867|Ga0192859_1055744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata647Open in IMG/M
3300018873|Ga0193553_1086975All Organisms → cellular organisms → Eukaryota → Sar819Open in IMG/M
3300018879|Ga0193027_1073670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata682Open in IMG/M
3300018903|Ga0193244_1057305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata719Open in IMG/M
3300018903|Ga0193244_1079412All Organisms → cellular organisms → Eukaryota → Sar607Open in IMG/M
3300018903|Ga0193244_1083731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata590Open in IMG/M
3300018908|Ga0193279_1076368All Organisms → cellular organisms → Eukaryota → Sar696Open in IMG/M
3300018927|Ga0193083_10009592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1074Open in IMG/M
3300018927|Ga0193083_10021784All Organisms → cellular organisms → Eukaryota → Sar833Open in IMG/M
3300018927|Ga0193083_10029908All Organisms → cellular organisms → Eukaryota → Sar746Open in IMG/M
3300018930|Ga0192955_10064718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata864Open in IMG/M
3300018934|Ga0193552_10081296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata883Open in IMG/M
3300018942|Ga0193426_10058585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata834Open in IMG/M
3300018942|Ga0193426_10070911All Organisms → cellular organisms → Eukaryota → Sar765Open in IMG/M
3300018942|Ga0193426_10072736All Organisms → cellular organisms → Eukaryota → Sar756Open in IMG/M
3300018942|Ga0193426_10082077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata714Open in IMG/M
3300018942|Ga0193426_10146136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata530Open in IMG/M
3300018947|Ga0193066_10065752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1029Open in IMG/M
3300018947|Ga0193066_10099313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata846Open in IMG/M
3300018947|Ga0193066_10119460All Organisms → cellular organisms → Eukaryota → Sar770Open in IMG/M
3300018964|Ga0193087_10121847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata845Open in IMG/M
3300018966|Ga0193293_10041056All Organisms → cellular organisms → Eukaryota → Sar756Open in IMG/M
3300018966|Ga0193293_10086472All Organisms → cellular organisms → Eukaryota → Sar594Open in IMG/M
3300018970|Ga0193417_10190011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata647Open in IMG/M
3300018981|Ga0192968_10083429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata861Open in IMG/M
3300018982|Ga0192947_10129299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata843Open in IMG/M
3300018988|Ga0193275_10158256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata692Open in IMG/M
3300018988|Ga0193275_10264212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata542Open in IMG/M
3300018989|Ga0193030_10098974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata893Open in IMG/M
3300018998|Ga0193444_10080515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata848Open in IMG/M
3300018998|Ga0193444_10091690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata797Open in IMG/M
3300018998|Ga0193444_10102229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata756Open in IMG/M
3300018998|Ga0193444_10103359All Organisms → cellular organisms → Eukaryota → Sar752Open in IMG/M
3300018998|Ga0193444_10110314All Organisms → cellular organisms → Eukaryota → Sar728Open in IMG/M
3300018999|Ga0193514_10101542All Organisms → cellular organisms → Eukaryota → Sar1046Open in IMG/M
3300018999|Ga0193514_10257191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata609Open in IMG/M
3300019001|Ga0193034_10109241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata642Open in IMG/M
3300019007|Ga0193196_10243052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata777Open in IMG/M
3300019017|Ga0193569_10241189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata779Open in IMG/M
3300019017|Ga0193569_10241197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata779Open in IMG/M
3300019017|Ga0193569_10334689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata611Open in IMG/M
3300019019|Ga0193555_10171789All Organisms → cellular organisms → Eukaryota → Sar748Open in IMG/M
3300019022|Ga0192951_10205061All Organisms → cellular organisms → Eukaryota → Sar724Open in IMG/M
3300019037|Ga0192886_10051674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1072Open in IMG/M
3300019037|Ga0192886_10089668All Organisms → cellular organisms → Eukaryota → Sar885Open in IMG/M
3300019039|Ga0193123_10315517All Organisms → cellular organisms → Eukaryota → Sar613Open in IMG/M
3300019040|Ga0192857_10313282All Organisms → cellular organisms → Eukaryota → Sar539Open in IMG/M
3300019049|Ga0193082_10217904All Organisms → cellular organisms → Eukaryota → Sar931Open in IMG/M
3300019049|Ga0193082_10299280All Organisms → cellular organisms → Eukaryota → Sar833Open in IMG/M
3300019111|Ga0193541_1038827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata822Open in IMG/M
3300019115|Ga0193443_1009805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata918Open in IMG/M
3300019115|Ga0193443_1010797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata881Open in IMG/M
3300019115|Ga0193443_1016445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata738Open in IMG/M
3300019115|Ga0193443_1019115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata688Open in IMG/M
3300019126|Ga0193144_1031301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata824Open in IMG/M
3300019126|Ga0193144_1076938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata599Open in IMG/M
3300019143|Ga0192856_1037718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata666Open in IMG/M
3300019151|Ga0192888_10159085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata716Open in IMG/M
3300028575|Ga0304731_10510739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata633Open in IMG/M
3300028575|Ga0304731_10685010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300030750|Ga0073967_10000442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata797Open in IMG/M
3300030750|Ga0073967_11752920All Organisms → cellular organisms → Eukaryota → Sar527Open in IMG/M
3300030750|Ga0073967_11895596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata530Open in IMG/M
3300030801|Ga0073947_1006464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata574Open in IMG/M
3300030859|Ga0073963_10935938All Organisms → cellular organisms → Eukaryota → Sar593Open in IMG/M
3300030918|Ga0073985_10629600All Organisms → cellular organisms → Eukaryota → Sar524Open in IMG/M
3300030951|Ga0073937_12070035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata626Open in IMG/M
3300030955|Ga0073943_11505385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata541Open in IMG/M
3300031037|Ga0073979_12065102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata685Open in IMG/M
3300031717|Ga0307396_10556277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata551Open in IMG/M
3300031725|Ga0307381_10131910All Organisms → cellular organisms → Eukaryota → Sar844Open in IMG/M
3300031725|Ga0307381_10332716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata551Open in IMG/M
3300031738|Ga0307384_10576512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata537Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine69.72%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.79%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water10.56%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water2.82%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water1.41%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.70%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008934Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2CEnvironmentalOpen in IMG/M
3300009006Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E2EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009216Microbial communities of water from the North Atlantic ocean - ACM47EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009272Eukaryotic communities of water from the North Atlantic ocean - ACM45EnvironmentalOpen in IMG/M
3300009276Eukaryotic communities of water from the North Atlantic ocean - ACM57EnvironmentalOpen in IMG/M
3300009279Eukaryotic communities of water from the North Atlantic ocean - ACM42EnvironmentalOpen in IMG/M
3300009353Microbial communities of water from the North Atlantic ocean - ACM49EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300018594Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809463-ERR1739849)EnvironmentalOpen in IMG/M
3300018597Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782201-ERR1712206)EnvironmentalOpen in IMG/M
3300018611Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001660 (ERX1782173-ERR1712095)EnvironmentalOpen in IMG/M
3300018636Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782245-ERR1711897)EnvironmentalOpen in IMG/M
3300018637Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000837 (ERX1782121-ERR1712056)EnvironmentalOpen in IMG/M
3300018643Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782462-ERR1712152)EnvironmentalOpen in IMG/M
3300018653Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003013 (ERX1789553-ERR1719190)EnvironmentalOpen in IMG/M
3300018659Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782249-ERR1712111)EnvironmentalOpen in IMG/M
3300018662Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000526 (ERX1782276-ERR1711878)EnvironmentalOpen in IMG/M
3300018675Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001994 (ERX1789575-ERR1719413)EnvironmentalOpen in IMG/M
3300018691Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001616 (ERX1782222-ERR1712214)EnvironmentalOpen in IMG/M
3300018696Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000864 (ERX1782143-ERR1711870)EnvironmentalOpen in IMG/M
3300018711Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003139 (ERX1782287-ERR1712099)EnvironmentalOpen in IMG/M
3300018738Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002938 (ERX1789371-ERR1719226)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018793Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000876 (ERX1789367-ERR1719325)EnvironmentalOpen in IMG/M
3300018794Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782102-ERR1711992)EnvironmentalOpen in IMG/M
3300018807Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002356 (ERX1789611-ERR1719493)EnvironmentalOpen in IMG/M
3300018811Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782290-ERR1712064)EnvironmentalOpen in IMG/M
3300018837Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782235-ERR1712073)EnvironmentalOpen in IMG/M
3300018850Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001578 (ERX1782388-ERR1711941)EnvironmentalOpen in IMG/M
3300018854Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000076 (ERX1789602-ERR1719346)EnvironmentalOpen in IMG/M
3300018865Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001824 (ERX1789688-ERR1719211)EnvironmentalOpen in IMG/M
3300018867Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000968 (ERX1789681-ERR1719251)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018879Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002480 (ERX1789365-ERR1719178)EnvironmentalOpen in IMG/M
3300018903Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001499 (ERX1789636-ERR1719512)EnvironmentalOpen in IMG/M
3300018908Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001584 (ERX1789660-ERR1719479)EnvironmentalOpen in IMG/M
3300018927Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782133-ERR1712125)EnvironmentalOpen in IMG/M
3300018930Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018970Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789437-ERR1719295)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019019Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019115Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002358 (ERX1782231-ERR1711979)EnvironmentalOpen in IMG/M
3300019126Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000695 (ERX1782402-ERR1712043)EnvironmentalOpen in IMG/M
3300019143Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782306-ERR1712244)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030750Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030801Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_X_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030859Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030918Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030951Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_Q_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030955Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_T_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103737_103073613300008934Ice Edge, Mcmurdo Sound, AntarcticaDAVFVPHRLKGMLQGHPLTHTGIYLENCKSVQYGFFGNLEVFSAEAFNTLTTNIDSCSKRIDWVKGTKWGPIGEDLFAQMCMDDNSVSKVAGFDVTTDAACPGTRKRWGEKNNKKWKPPCKLLGTPAMHPFKKPQEYFSCLDATMVYG*
Ga0103710_1019000713300009006Ocean WaterVDDVNDEFFMVKREETGTWVNTGMFKQVWKAMSGTKVSLADWVVKVDADAVFVPHRLKAMLMGHPLTYTGIYIENCKEVMWGYFGNLEVFSDQAFKSLLDNVDSCSEIIDWVKGGMFGPIGEDLFAQMCMDYQGVSKVQNFDLTTDGMCPGTKKRWGAKNITKWKRPCNLVGTPAMHPFKKPSEYF
Ga0103706_1020829813300009022Ocean WaterTIKVVDEENNFHVVRRKITKTWVNTGVFKQVWKAVAPRLQDAEWVVKVDADAVFVPHRLKGMLQGHPITYTGIYVENCKSVQWGFFGNLEVFSREAFDTLIANLDSCSAKIDWVRGTKWGPIGEDLFAQMCMDYNGVSKVQNFDLTTDAACPGTRKRWGEEKNKKWKPPC
Ga0103707_1014827813300009025Ocean WaterMSGKIGLQKADWVVKVDADAVFVPHRLKAALMGQPLTYTGIYFENCQGVEWGFFGNLEVYSMQAFKTLLANIDSCSEKIDWVKGTKWGPIGEDLFAQMCMDNQGVTKLQNFDLTTDALCPGTKKRWGQKDNNKWKHPCT
Ga0103708_10013050813300009028Ocean WaterEWVVKVDADAVFVPHRLKGMLQGHPITYTGIYLENCKSVQWGFFGNLEVFSVEAFNTLLANIDSCSQKIDWVKGTKWGPIGEDLFAQMCMDSNGVSKVQNFDVTTDGACPGTRKRWGEEKNKKWKPPCNLVGTPALHPFKKPEEYFSCLDATMTFG*
Ga0103842_101850923300009216River WaterLIQQAWRAVGLREGPKRSDWIVKVDADAVFVPHRLKKTLLGHPLSATGVYFENCKEVQWGLFGNLEVWSIQAFNALLTNLDECAQSIDWVKGTKWGPIGEDLFAQMCMDKQGVSKVQNFDLTTDAMCPGTRKRWGQKDNKKWKVPCDSVLTPAIHPFKKPEEYFKCLDATLALER*
Ga0103876_101348713300009269Surface Ocean WaterVRRKKTRTWVNTGLFKQVWRAIGGKTQDAEWVVKVDADAVFVPHRLKGMVQGHPITYTGIYIENCKSVQWGFFGNLEVFSREAFDTLLANLDSCSNRIDWVRGTKWGPIGEDLFAQMCMDYNGVSKVQNFDLTTDAACPGTRKRWGEKENKKWKPPCNLVGTPALHPFKKPQEYFSCLDATMTFG*
Ga0103876_102731913300009269Surface Ocean WaterWVNTGLFKQVWRAIGDSSGETVRDAEWVVKVDADAVFVPHRLKGMVQGHPITYTGIYIENCKSVQYGFFGNLEVFSREAFDTLLANLDSCSSKIDWVKGTKWGPIGEDLFAQMCMDYNGVSRVQNFDLTTDAACPGTRKRWGEKQNKKWKPPCNLVGTPALHPFKKPQEYFSCLDATMTFG*
Ga0103876_103382913300009269Surface Ocean WaterGETLRDAEWVVKVDADAVFVPHRLKGMLQGHPITYTGIYIENCKSVQYGFFGNLEVFSREAFDTLLANLDSCSNKIDWVKGTKWGPIGEDLFAQMCMDYNGVSKVQNFDLTTDAACPGTRKRWGEKENKKWKPPCNLVGTPALHPFKKPQEYFSCLDATMTFG*
Ga0103876_103934413300009269Surface Ocean WaterVVKVDADTVFVPHRLKGMLQGHPITYTGIYIENCKSVQWGFFGNLEVFSREAFDTLLTNLDSCSQRIDWVRGTKWGPIGEDLFAQMCMDYHGVSKVQNFDLTTDAACPGTRKRWGEEKNKKWKPPCNLVGTPALHPFKKPQDYFSCLDATMTFG*
Ga0103876_105067513300009269Surface Ocean WaterAIGDSSGETIRDAEWVVKVDADAVFVPHRLKGMVQGHPITYTGIYIENCKSVQYGFFGNLEVFSREAFDTLLANLDSCSSKIDWVKGTKWGPIGEDLFAQMCMDYNGVSRVQNFDLTTDAACPGTRKRWGEKQNKKWKPPCNLVGTPALHPFKKPQEYFSCLDATMTFG*
Ga0103877_100168013300009272Surface Ocean WaterAIGGKTQDAEWVVKVDADAVFVPHRLKGMVQGHPITYTGIYIENCKSVQWGFFGNLEVFSREAFDTLLANLDSCSNRIDWVRGTKWGPIGEDLFAQMCMDYNGVSKVQNFDLTTDAACPGTRKRWGEKENKKWKPPCNLVGTPALHPFKKPQEYFSCLDATMTFG*
Ga0103877_100215223300009272Surface Ocean WaterAIGESSGETLRDAEWVVKVDADAVFVPHRLKGMLQGHPITYTGIYIENCKSVQYGFFGNLEVFSREAFDTLLANLDSCSNKIDWVKGTKWGPIGEDLFAQMCMDYNGVSKVQNFDLTTDAACPGTRKRWGEKENKKWKPPCNLVGTPALHPFKKPQEYFSCLDATMTFG*
Ga0103877_100495213300009272Surface Ocean WaterDAVFVPHRLKKTLLGHPLSATGVYFENCKEVQWGLFGNLEVWSIQAFNALLNNLDECAQSIDWVKGTKWGPIGEDLFAQMCMDKQGVSKVQNFDLTTDAMCPGTRKRWGQKDNKKWKVPCNSVLTPAIHPFKKPEEYFKCLDATLALER*
Ga0103877_100826113300009272Surface Ocean WaterKKTKTWVNTGLFKQVWRAIGDSSGETVRDAEWVVKVDADAVFVPHRLKGMVQGHPITYTGIYIENCKSVQYGFFGNLEVFSREAFDTLLANLDSCSSKIDWVKGTKWGPIGEDLFAQMCMDYNGVSRVQNFDLTTDAACPGTRKRWGEKQNKKWKPPCNLVGTPALHPFKKPQEYFSCLDATMTFG*
Ga0103877_101463513300009272Surface Ocean WaterFKQGWRAVAGRTQDAEWVVKADADAIFLPHRLKGMLQGHPITNTGIYIENCKAVQWGFFGNLEVFSREAWDTLLRNLDSCSTRIDWVKGTKYGPIGEDLFAQMCMDYNGVSKVQNFDLTTDAACPGTRKRWGEKENKKWKPPCNLVGTPALHPFKKPQEYFSCLDATMTFG*
Ga0103877_102001013300009272Surface Ocean WaterAEWVVKVDADAVFVPHRLKGMLQGHPITYTGIYVENCKSVQYGFFGNLEVFSREAFDTLLANLDSCSKRIDWVKGTKWGPIGEDLFAQMCMDYNGVSKVQNFDLTTDAACPGTRKRWGEKENKKWKPPCNLVGTPALHPFKKPQEYFSCLDATMTFG*
Ga0103879_1000834913300009276Surface Ocean WaterWSAVGLRDGPKRSDWIVKVDADAVFVPHRLKKTLLGHPLSATGVYFENCKEVQWGLFGNLEVWSIQAFNALLNNLDECAQSIDWVKGTKWGPIGEDLFAQMCMDKQGVSKVQNFDLTTDGMCPGTLKRWGQKGNKKWKPPCDSVLTPAIHPFKKPEEYFKCLDATLALER*
Ga0103880_1001353413300009279Surface Ocean WaterVNTGLFKQVWRAIGGKTQDAEWVVKVDADAVFVPHRLKGMVQGHPITYTGIYIENCKSVQWGFFGNLEVFSREAFDTLLANLDSCSNRIDWVRGTKWGPIGEDLFAQMCMDYNGVSKVQNFDLTTDAACPGTRKRWGEKENKKWKPPCNLVGTPALHPFKKPQEYFSCLDATMTFG*
Ga0103880_1003055513300009279Surface Ocean WaterVDADAVFVPHRLKKTLLGHPLSATGVYFENCKEVQWGLFGNLEVWSIQAFNALLNNLDECAQSIDWVKGTKWGPIGEDLFAQMCMDKQGVSKVQNFDLTTDGMCPGTLKRWGQKGNKKWKPPCDSVLTPAIHPFKKPEEYFKCLDATLALER*
Ga0103880_1003220713300009279Surface Ocean WaterAIADTNAHADMDWVVKVDADAVFVPHRLKAMLMGHPLTYTGIYIENCKSVQYGFFGNLEVFSREAFDTLLSNLDSCSKRIDWVKGTKWGPIGEDLFAQMCMDYNGVSKVSNFDLTTDAACPGTRKRWGEKQNKKWKPPCGEIRTPAIHPFKKPAEYFQCLDATMALGI*
Ga0103847_100440613300009353River WaterLKGMLQGHPITYSGIYLENCKSVEWGFFGNLEVFSIEAFNTLLANIDSCSQKIDWVKGTKWGPIGEDLFAQMCMDSNGVSKVQNFDVTTDGACPGTRKRWGEEKNKKWKPPCHLVGTPALHPFKKPEEYFSCLDATMTFG*
Ga0138316_1121750413300010981MarineVKVDADAVFVPHRLKGMLQGHPLTFSGIYIENCKGVQWGFFGNLEVFSREAFQTLVDNLNDCSKKIDWVKGTKWGPIGEDLFAQMCLDYHGVSKVQNFDVTTDGPCPGTRKRWGEKKNKKWKPPCHLVGTPAIHPFKKPKDYFACLDATMVYN*
Ga0138326_1051578713300010985MarinePEVGGWMNTGLFKQIWKKMGPEVQSTDAEWIVKVDADAVFVPHRLKGMLQGHPLTFSGIYIENCKGVQWGFFGNLEVFSKEAFQTLVDNLDDCSKKIDWVKGTKFGPIGEDLFAQMCLDYHGVSKVQNFDVTTDGACPGTRKRWGEKKNKKWKPPCHLVGTPAMHPFKKPKDSFACLDATMVYN*
Ga0138326_1077197313300010985MarineTDVDWVVKVDADAVFVPHRLKGMLQGHPLTFSGIYIENCKEVQWGFFGNLEVFSTEAFKTLVNNIDDCSKRIDFVKGTKWGPIGEDLFAQMCMDDHGVSKVQNFDVTTDGACPGTRKRWGEKNNKKWKPPCSLLGTPAMHPFKKPQDYFACLDATMAHN*
Ga0138326_1204523213300010985MarineMTVVEDVDNEFHVIKRPEVGGWMNTGLFKQIWKKMGPEVQRTDAEWVVKVDADAVFVPHRLKGMLQGHPLTFSGIYIENCKGVQWGFFGNLEVFSREAFQTLVDNLNDCSKKIDWVKGTKWGPIGEDLFAQMCLDYHGVSKVQNFDVTTDGACPGTRKRWGEKKNKKWK
Ga0138326_1209234213300010985MarineIKRPKVGTWINTGMFKQVWKKLGQDVPKTDVDWVVKVDADAVFVPHRLKGMLQGHPLTYTGIYIENCKEVQWGFFGNLEVFSTEAFKTLVDNIDDCSKRIDFVKGTKWGPIGEDLFAQMCMDDHGVSKVQNFDVTTDGACPGTRKRWGEKNNKKWKPPCSLLGTPAIHPFKK
Ga0138324_1060149913300010987MarineQDVRNTDADWVVKVDADAVFVPHRLKGMLQGHPLTYAGIYIENCKEVMWGFFGNLEVFSKDAFQTLVDNLDDCGKKIDWVKGTKWGPIGEDLFAQMCMDYHGVSKVQNFDVTTDGACPGTKKRWGEKNTKKWKPPCHLVGTPAIHPFKKPNDYFACLDATMVYN*
Ga0193292_100176213300018594MarineHEFRLIKRKKTGTWVNTGMFKQVWKAIAEKPEIKEVQWVVKVDADAIFFPHRLKGMLQGHPITYTGIYLENCNEVKWGFFGNLEVFSVEAFNTLLSNIDSCSQSIDWVKGTKFGPIGEDLFAQMCMDRNGVSKVQNFDLTTDGVCPGTKKRWGAKNATKWKPPCNLVGTPAIHPFKKPQEYFSCYEATKAFG
Ga0193035_101376813300018597MarineVFVPHRLKAALMGQPLAYAGIYFENCQGVEWGFFGNLEVYSMQAFKTLLANIDSCSENIDWVKGTKWGPIGEDLFAQMCMDNQGVTKLQNFDLTTDALCPGTKKRWGQKDNNKWKPPCAWVSTPSLHPFKKVQEWMSCHDATIALG
Ga0193035_102001313300018597MarineFPHRLKGMLQGHPITYTGIYLENCNEVKWGFFGNLEVFSVEAFNTLLNNIDSCSQAIDWVKGTKFGPIGEDLFAQMCMDRNGVSKVQNFDLTTDGVCPGTKKRWGAKNATKWKPPCNLIGTPAIHPFKKPQEYFSCYEATKAFG
Ga0193316_103464613300018611MarineVVKVDADAVFIPHRLKGMLQGHPLTYTGIYLENCKSVQYGFFGNLEVFSADAFNTLVANIGSCSQRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDVTTDGACPGTRKRWGEKNNKKWKPPCNLLGTPAIHPFKKPQEYFSCLDATTVFG
Ga0193377_101162213300018636MarineFKQIWKKIGGKTADAEWVVKVDADAVFVPHRLKGMLQGHPITYTGIYLENCKSVQWGFFGNLEVFSVEAFNTLLANIDSCSQKIDWVKGTKWGPIGEDLFAQMCMDYNGVSKVQNFDVTTDGACPGTRKRWGEEKNKKWKPPCNLVGTPALHPFKKPEEYFSCLDATMTFG
Ga0192914_100415513300018637MarineSGTWVNTGMFKQVWKATKGRIGLEKADWVVKVDADAVFVPHRLKATLMGQPLTYTGVYFENCKGVEWGFFGNLEVFSTQAFNTLLVNVDSCSEKIDWVNGTKWGPIGEDLFAQMCMDLQGVTKLQNFDLTTDAMCPGTRKRWGEKDNKKWKPPCGWLGTPAMHPFKKPQEWFTCYEATIVLG
Ga0192914_100458123300018637MarineHRLKGMLQGHPITYTGIYLENCNEVKWGFFGNLEVFSVEAFNTLLNNIDSCSKSIDWVKGTKFGPIGEDLFAQMCMDRNGVSKVQNFDLTTDGVCPGTKKRWGAKNATKWKPPCNLVGTPAIHPFKKPEEYFSCYEATKTFG
Ga0192914_100462523300018637MarineHRLKGMLQGHPITYTGIYIENCNEVKWGFFGNLEVFSVEAFSTLLTNIDSCSQTIDWVKGTKFGPIGEDLFAQMCMDRNGVSKVQNFDLTTDGVCPGTKKRWGAKNATKWKPPCNLVGTPAIHPFKKPQEYFSCYEATKAFG
Ga0192914_100462623300018637MarineHRLKGMLQGHPITYTGIYLENCNEVKWGFFGNLEVFSVEAFNTLLNNIDSCSKSIDWVKGTKFGPIGEDLFAQMCMDRNGVSKVQNFDLTTDGVCPGTKKRWGAKNATKWKPPCNLVGTPAIHPFKKPQEYFSCYEATKAFG
Ga0192914_100513613300018637MarineHRLKGMLQGHPITYTGIYLENCNEVKWGFFGNLEVFSVEAFNTLLNNIDSCSKSIDWVKGTKFGPIGEDLFAQMCMDRNGVSKVQNFDLTTDGVCPGTKKRWGAKNATKWKPPCNLVGTPAIHPFKKPEEYFACLEATKTFG
Ga0193431_101510513300018643MarineENDFHLVKRKTVGTWVNTGLFKQIWKAVAKTGKVQLADWVVKVDADAVFIPHRLKGMLQGHPLTHTGIYLENCKSVQYGYFGNLEVFSAEAFNTLVANIGSCSQRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDVTTDGACPGTRKRWGEKNNKKWKPPCNLLGTPAIHPFKKPQEYFSCLDATMVFG
Ga0193431_101522913300018643MarineENDFHLVKRKTVGTWVNTGLFKQIWKAVAKTGKVQLADWVVKVDADAVFIPHRLKGMLQGHPLTHTGIYLENCKSVQYGYFGNLEVFSAEAFNTLVANIGSCSQRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDVTTDGACPGTRKRWGEKNNKKWKPPCNLLGTPAIHPFKKPQEYFSCLDATTVFG
Ga0193504_100935313300018653MarineTEIKEVQWVVKVDADAIFFPHRLKGMLQGHPITYTGIYLENCNEVKWGFFGNLEVFSVEAFNTLLNNIDSCSQSIDWVKGTKFGPIGEDLFAQMCMDRNGVSKVQNFDLTTDGVCPGTKKRWGAKNATKWKPPCNLVGTPAIHPFKKPQEYFSCYEATKAFG
Ga0193504_101174613300018653MarineGMFKQVWKATKGRIGLEKADWVVKVDADAVFVPHRLKAALMGQPLTYTGVYFENCRGVEWGLFGNLEVFSIKAYNTFLLNIDSCSEKIDWVRGTKWGPIGEDLFAQMCMDNQGVTKLQNFDLTTDAACPGTRKRWGQKDNKKWKPPCGSLGTPAMHPFKKPQEWLTCHEATIALG
Ga0193504_102816913300018653MarinePNRLRVMLQGHPVTYTGIYLENCKSVRWGFFGNLEVFSIEAFNTLLANIDSCTQKIDWVKGTEWGPIGEDLFAQMCMDYNGVSKVQNFDLTTDAACPGTRKRWGEKNNTKWKPPCEKLATPAMHPFKKPDDYFNCVTATMNFAA
Ga0193067_102709413300018659MarineEFHLVKRKKQGTWINTGLFKQVWKAMKGQIGLEKADWVVKVDADAVFVPQRLKTALMGHPLTSAGIYFENCKEVQWGLFGNLEVYSLQAFNTLVANIDSCSTSIDWVEGTKWGPIGEDLFAQMCMDLHGVSKVQNFDLTTDAACPGTRKRWGAKTKTEDDKKWKPNCALVQTPALHPFKKPNEYFSCLDATLAGQ
Ga0193067_103148413300018659MarineVFVPHRLKTALMGHPLTYTGIYFENCKEVQWGLFGNLEVYSLQAFNTLLANIDSCSTSIDWVKGTKWGPIGEDLFAQMCMDLHGVSKVENFDLTTDAACPGTRKRWGETTKASDNKEWKPNCALVQTPALHPFKKPNEYFSCLDATLALDARQ
Ga0193067_106409613300018659MarineLKTALMGHPLTYAGIYLENCQGVQWGFFGNLEVYSIQAFNTLLANIDSCSTSIDWVEGNKWGPIGEDLFAQMCMDLHGVSKVQNFDITTDAACPGTRKRWGVKTKTTDDKKWKPNCAKVQTPALHPFKKPNEYFSCLDATLSFAP
Ga0192848_104433913300018662MarineTWAATAEVKEADWVVKVDADAVFVPHRLKGMLQGHPLTYTGIYLENCKSVQYGFFGNLEVFSSEAFNTLVNNIDSCSKRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDVTTDGACPGTRKRWGEKNNKKWKPPCKLVGTPALHPFKKPQEYFSCLDATTVFG
Ga0193384_103404813300018675MarineKTADAEWVVKVDADAVFVPHRLKGMLQGHPVTYTGIYLENCKSVQWGFYGNLEVFSVEAFNTLLANIDSCSQKIDWVKGTKWGPIGEDLFAQMCMDFNGVSKVPNFEVTTDGACPGTRKRWGEEKNKKWKPPCNLVGTPALHPFKKPEEYFRCLDATMTFG
Ga0193294_103840213300018691MarineRLKGMLQGHPLTHKGIYLENCKSVQYGYFGNLEVFSAEAFNTLVANIGSCSQRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDVTTDGACPGTRKRWGEKNNKKWKPPCNLLGTPAMHPFKKPQEYFSCLDATMVFG
Ga0193110_100541613300018696MarineTGMFKQVWKAIAGSDEITKVDWVVKVDADAIFVPHRLKGMLQGHPITYTGIYIENCKSVQWGFFGNLEVFSIEAFNTLIANIDTCSQRIDWVKGTKWGPIGEDLFAQMCMDDHGVSKVQNFDVTTDAMCPDTRKRWGEKNNTKWKPPCDKVGTPAIHPFKKPQEYFSCLDATMTFG
Ga0193110_100906413300018696MarineHRLKGMLQGHPITYTGIYLENCNEVKWGFFGNLEVFSVEAFNTLLNNIDSCSQSIDWVKGTKFGPIGEDLFAQMCMDRNGVSKVQNFDLTTDGMCPGTKKRWGAKNATKWKPPCNLVGTPAIHPFKKPEEYFACLEATKTFG
Ga0193110_101910013300018696MarineHRLKGMLQGHPITYTGIYLENCNEVKWGFFGNLEVFSVEAFNTLLNNIDSCSQSIDWVKGTKFGPIGEDLFAQMCMDRNGVSKVQNFDLTTDGVCPGTKKRWGAKNATKWKPPCNLVGTPAIHPFKKPQEYFSCYEATKAFG
Ga0193110_102339013300018696MarineYKIKRKEVGTWINTGMFKQIWKKIAGKTADAEWVVKVDADAVFVPHRLKGMLQGHPITYTGIYLENCKSVQWGFFGNLEVFSVEAFNTLLANIDSCSQKIDWVKGTKWGPIGEDLFAQMCMDSNGVSKVQNFDVTTDGACPGTRKRWGEEKNKKWKPPCNLVGTPALHPFKKPEEYFSCLDATMTFG
Ga0193110_102536013300018696MarineAQKAELTKVQWVVKVDADAVFVPNRLRVMLQGHPVTYTGIYLENCKSVRWGFFGNLEVFSIEAFNTLLANIDSCTQKIDWVKGTEWGPIGEDLFAQMCMDYNGVSKVQNFDLTTDGACPGTRKRWGEKNNTKWKPPCEKLATPAMHPFKKPDDYFNCVTATMNFAP
Ga0193069_101057613300018711MarineTWVNTGMFKQVWKAMAGRTEITKSDWVVKVDADAVFVPHRLKGMLQGQPITYTGVYIENCKSVKWGFFGNLEVYSSTAFYTLLGNLDRCSQMIDFVKGTEWGPIGEDLFAQMCMDYSGVSKVQNFNVTTDAACPGTRKRWGEANNTKWKPPCHLLGTPAIHPFKKPEEYFSCLAATMIYG
Ga0193495_105424613300018738MarineWVNTGLFKQIWKAVAATAEVKMADWVVKVDADAIFIPHRLKGMLQGHPLTYTGIYLENCKSVQYGFFGNLEVFSVEAFKTLVANIQSCSQRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDVTTDGACPGTRKRWGEKNNKKWKPPCKLVGTPALHPFKKPQEYFSCLDATT
Ga0192974_104369513300018739MarineAVFLPHRLRGMLQGHPLTFTGIYLENCKSVQWGFFGNLEVLSAEAFNTLVANIDSCSQRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDLTTDAACPGTRTRWGEKNNKKWKPPCNLLGTPAIHPFKKPEEYFSCLDATTVYG
Ga0192974_105059813300018739MarineAVFLPHRLRGMLQGHPLTYTGIYLENCKSVQWGFFGNLEVLSTEAFNTLVANIDSCSQRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDLTTDAACPGTRTRWGEKNNKKWKPPCNLLGTPAIHPFKKPEEYFSCLDATTVYG
Ga0192928_108122713300018793MarineREGPKRADWIVKVDADAVFVPQRLRKMLLGHPLSAAGIYFENCKEVQWGLFGNLEVWSIQAFNALLLNLDSCSQSIDWVTGTKWGPIGEDLFAQMCMDKQGVSKIQNFDMTTDAMCPGTRKRWGQKDNKKWKVPCDSVLTPAMHPLKKPEEYFKCLDATMALESSLAEKGQSA
Ga0193357_103809613300018794MarineHLVKRKQQKTWVNTGLFKQVWKAMKGQIGLEKADWVVKVDADAVFVPHRLKTALMGHPLTYTGIYFENCKEVQFGLFGNLEVWSIQAFNTLLANIDSCSTSIDWVKGTKWGPIGEDLFAQMCMDLNGVSKVQNFDLTTDAACPGTRKRWGVKTKTTDDKKWKPNCAKVQTPALHPFKKPNEYFSCLDATLSFAP
Ga0193357_105125323300018794MarineWKRLGQDVRNTDVDWVVKVDADAVFVPHRLKGMLQGHPLTYSGIYIENCKEVMWGFFGNLEVFSKDAFQTLVDNLDDCGKKIDWVKGTKWGPIGEDLFAQMCMDYHGVSKVQNFDVTTDGACPGTKKRWGEKNTKKWKPPCHLVGTPAIHPFKKPNDYFACLDATMVYN
Ga0193357_105525613300018794MarineNTGMFKQIWKKLRPEVQNTDADWVVKVDADAVFVPHRLKGMLQGHPLTFSGIYIENCKGVQWGFFGNLEVFSREAFQTLVDNLNDCSKKIDWVKGTKWGPIGEDLFAQMCLDYHGVSKVQNFDVTTDGACPGTRKRWGEKKNKKWKPPCHLVGTPAIHPFKKPKDYFACLDATMVYN
Ga0193441_104128113300018807MarineWVNTGMFKQAWKAIGLREGPKRADWIIKVDADAVFVPQRLKKMLLGHPLSAAGIYFENCKEVEWGLFGNLEVWSIQAFNALLLNIDSCSQSIDWVTGTKWGPIGEDLFAQMCMDKQGVSKVQNWDLTTDGACPGTLKRWGEKNNKHWKVPCDKVMTPALHPFKKPEEYFSCLDATTALDH
Ga0193183_109564813300018811MarineQWVVKVDADAVFVPNRLRTMLQGHPVTYTGIYLENCKSVRWGFFGNLEVFSIEAFNTLIANIDSCTQKIDWVKGTEWGPIGEDLFAQMCMDYNGVSKVQNFDLTTDAACPGTRKRWGEKNNTKWKPPCEKLATPAMHPFKKPGRLFQLRYRYNELCGMSVYQASVFFEMCQKAHQ
Ga0192927_104862313300018837MarineQAWRAIGLRDGPKRADWIVKVDADAVFVPHRLKKTLLGHPLTASGVYFENCKEVQWGLFGNLEVWSIQAFNALLTNLDECSQSIDWVKGTKWGPIGEDLFAQMCMDKQCVSMVQNFDLTTDAMCPGTRKRWGQKDNKKWKVPCDSVLTPAMHPFKKPEEYFKCLDATMALER
Ga0193273_105753713300018850MarineWVVKVDADAVFVPERLRKVLSEQADTYTGVYLENCKGVEYGYFGNLEVTSKKAFKLLLDNLESCSQKIDWVKGTKLGPIGEDLFAQMCMDWQGVAKVSNFEVTTDGACPNTRKRYGQKDNKKWKPPCGELKTPALHPFKKPLEYFQCLDATMALGV
Ga0193214_105077613300018854MarinePDVALQNADWVVKVDADAVFVPQRLRNMLTQQPDTYTGVYIENCKGVEWGYFGNLEIMSKTAFKLLLDNIDMCSEKIDWVKGTKWGPIGEDLFAQMCMDWQGVAKIDNFEVTTDGACPGTRKRYGEANNKKWKPPCGEIRTPAIHPFKKPEEYFQCLDATMALGV
Ga0193214_108458813300018854MarineEDAENNFHIIRRKKTRTWVNTGLFEQVWKAIAATTGETLRDAEWVVKVDADAVFFPHRLKGMLQGHPITYTGIYIENCKSVQYGFFGNLEVFSREAFDTLLANLDSCSKRIDWVKGTKWGPIGEDLFAQMCMDYNGVSKVQNFDVTTDAACPGTRKRWGEKQNKKWKPPCNLIGTPALHPFKKPQEYFSCLDAT
Ga0193359_107764413300018865MarineKGGKGWVNTGMFKQAWKAIGLREGPKRADWIVKVDADAVFVPQRLRKMLLGHPLSAAGIYFENCKEVQWGLFGNLEVWSIQAFNALLLNLDSCSQSIDWVTGTKWGPIGEDLFAQMCMDKQGVSKVQNWDLTTDGACPGTLKRWGEKKNKHWKVPCDKVRTPSLHPFKKPQEYFSCMDATLALER
Ga0192859_105574413300018867MarineADWVVKVDADAVFVPQRLRVMLRGHPLTSTGIYLENCKSVQWGFFGNLEVISAVGFRTFANNIDSCSQQIDWVTGTKWGPIGEDLFLQKCMDAIGVSKVAGFDLTTDAACPGTRTRWGEKNNKKWKPPCDLLRTPAIHPFKNPQEYKACLDATTALEE
Ga0193553_108697513300018873MarineVFVPHRLKGMLQGQPITYTGVYIENCKSVKWGFFGNLEVYSSTAFYTLLGNLDRCSQMIDFVKGTEWGPIGEDLFAQMCMDYSGVSKVQNFNVTTDAACPGTRKRWGEANNTKWKPPCHLLGTPAIHPFKKPEEYFSCLAATMIYG
Ga0193027_107367013300018879MarineFKQIWKAMSRKIGLQKADWVVKVDADAVFVPHRLKAALMGQPLAYTGIYFENCQGVEWGFFGNLEVYSMQAFKTLLANIDSCSEKIDWVKGTKWGPIGEDLFAQMCMDNQGVAKLQNFDLTTDALCPGTKKRWGQKDNNKWKPPCAWVSTPSVHPFKKVQEWMSCHDATIALG
Ga0193244_105730513300018903MarineWVVKVDADAVFVPHRLKGMLQGHPITYSGVYLENCKSVQWGFFGNLEVFSVEAFNTLLANIDSCSQKIDWVKGTKWGPIGEDLFAQMCMDSNGVSKVQNFEVTTDGACPGTRKRWGEEENKKWKPPCNLVGTPALHPFKKPEEYFSCLDATMTFG
Ga0193244_107941213300018903MarineLKGMLQGHPLTHTGIYLENCKSVQYGFFGNLEVFSAEAFNTLTNNIDSCSQRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDVTTDAACPGTRKRWGEKNNKKWKPPCHLLGTPAMHPFKKPQEYFSCLDATMVYG
Ga0193244_108373113300018903MarineWVVKVDADAVFVPHRLKGMLQGHPITYSGVYLENCKSVQWGFFGNLEVFSVEAFNTLLANIDSCSQKIDWVKGTKWGPIGEDLFAQMCMDSNGVSKVQNFEVTTDGACPGTRKRWGEAKNKKWKPSCNLVGTPALHPFKKPEEYFSCLDATMTFG
Ga0193279_107636813300018908MarineADAVFVPHRLKAMLMGHPLTYTGIYIENCKEVMWGYFGNLEVFSDQAFKALLDNIDSCSEKIDWVKGGIFGPIGEDLFAQMCMDYQGVSKVQNFDLTTDAMCPGTKKRWGAKNITKWKPPCNLVGTPAMHPFKKPKEYFTCLEETLAFA
Ga0193083_1000959213300018927MarineKRKKTKSWVNTGMFKQVWKAIAGSDEITKVDWVVKVDADAIFVPHRLKGMLQGHPITYTGIYIENCKSVQWGFFGNLEVFSIEAFNTLIANIDTCSQRIDWVKGTKWGPIGEDLFAQMCMDDHGVSKVQNFDVTTDAMCPDTRKRWGEKNNTKWKPPCDKVGTPAIHPFKKPQEYFSCLDATMTFG
Ga0193083_1002178423300018927MarineAVFVPHRLKGMLQGQPITYTGVYIENCKSVKWGFFGNLEVYSSTAFYTLLGNLDRCSQMIDFVKGTEWGPIGEDLFAQMCMDYSGVSKVQNFNVTTDAACPGTRKRWGEANNTKWKPPCHLLGTPAIHPFKKPEEYFSCLAATMIYG
Ga0193083_1002990813300018927MarineHGIAQKAELTKVQWVVKVDADAVFVPNRLRTMLQGHPVTYTGIYLENCKSVRSGFFGNLEVFSIEAFNTLLANIDSCTQKIDWVKGTEWGPIGEDLFAQMCMDYNGVSKVQNFDLTTDAACPGTRKRWGEKNNTKWKPPCEKLATPAMHPFKKPDDYFNCVTATMNFAA
Ga0192955_1006471813300018930MarineGLREVPKRSDWIVKVDADAVFVPPRLKKLLLGHPLSASGIYLENCKEVEWGLFGNLEVWSIQAFNALLSNLDSCSQSIDWVTGTKWGPIGEDLFAQMCMDKQGVSKVQNFDVTTDGACPGTRKRWGQKHNKHWKVPCNSVLTPSMHPFKKPAEYFNCMDATLALER
Ga0193552_1008129613300018934MarineWVNTGMFKQVWKAMAGRTEITKSDWVVKVDADAVFVPHRLKGMLQGQPITYTGVYIENCKSVKWGFFGNLEVYSSTAFYTLLGNLDRCSQMIDFVKGTEWGPIGEDLFAQMCMDYSGVSKVQNFNVTTDAACPGTRKRWGEANNTKWKPPCHLLGTPAIHPFKKPEEYFSCLAATMIYG
Ga0193426_1005858513300018942MarineDHDWYKIKREETGTWINTGMFKQVWKAVAGKTQDAEWVIKVDADAIFVPHRLKGMLQGHPVTYTGIYIENCKSVQWGFFGNLEVFSIEAFNTLLANIDSCSQKIDWVKGTKWGPIGEDLFAQMCMDYNGVSKVQNFGLTTDAACPGTRKRWGAAENDKTWKPPCNLVGTPALHPFKKPEDYFSCLDATMTFG
Ga0193426_1007091113300018942MarineDHDWYKIKREETGTWINTGMFKQVWKAVAGKTQDAEWVIKVDADAIFVPHRLKGMLQGHPVTYTGIYIENCKSVQWGFFGNLEVFSIEAFNTLLANIDSCSQKIDWVKGTKWGPIGEDLFAQMCMDYNGVSKVQNFGLTTDAACPGTKKRWGAAENDKTWKPPCNLVGTPALHPFKKPEDYFRCLDATMTFG
Ga0193426_1007273613300018942MarinePHRLKGMLQGHPITYTGIYLENCNEVKWGFFGNLEVFSVEAFNTLLNNIDSCSQSIDWVKGTKFGPIGEDLFAQMCMDRNGVSKVQNFDLTTDGVCPGTKKRWGAKNATKWKPPCNLVGTPAIHPFKKPQEYFSCYEATKAFG
Ga0193426_1008207713300018942MarineFKQIWKKIAGKTADAEWVVKADADAVFVPHRLKGMLQGHPVTYTGIYLENCKSVQWGFYGNLEVFSVEAFNTLLANIDSCSQKIDWVKGTKWGPIGEDLFAQMCMDFNGVSKVPNFEVTTDGACPGTRKRWGEEKNKKWKPPCNLVGTPALHPFKKPEEYFRCLDATMTFG
Ga0193426_1014613613300018942MarineDHDWYKIKREETGTWINTGMFKQVWKAVAGKTQDAEWVIKVDADAIFVPHRLKGMLQGHPVTYTGIYIENCKSVQWGFFGNLEVFSIEAFNTLLANIDSCSQKIDWVKGTKWGPIGEDLFAQMCMDYNGVSKVQNFGLTTDAACPGTKKRWGAAENDKKWKPPCNLVGTPALHPFK
Ga0193066_1006575213300018947MarineHLVRRKKTGTWVNTGMFKQVWKAIAQKPEIKEVQWVVKVDADAIFFPHRLKGMLQGHPITYTGIYLENCNEVKWGFFGNLEVFSVEAFNTLLNNIDSCSQSIDWVKGTKFGPIGEDLFAQMCMDRNGVSKVQNFDLTTDGMCPGTKKRWGAKNATKWKPPCNLVGTPAIHPFKKPEEYFACLEATKTFG
Ga0193066_1009931313300018947MarineDELHEFHLVKRKTQGTWVNTGLFKQVWKAMKGQIGLEKADWVVKVDADAVFVPHRLKTALMGHPLTYAGIYLENCQGVQWGFFGNLEVYSIQAFNTLLANIDSCSTSIDWVEGNKWGPIGEDLFAQMCMDLHGVSKVQNFDITTDAACPGTRKRWGVKTKTTDDKKWKPNCAKVQTPALHPFKKPNEYFSCLDATLSLDAGQ
Ga0193066_1011946013300018947MarineGTYTGVYIENCKSVKWGFFGNLEVYSSTAFYTLLGNLDRCSQMIDFVKGTEWGPIGEDLFAQMCMDYSGVSKVQNFNVTTDAACPGTRKRWGEANNTKWKPPCHLLGTPAIHPFKKPEEYFSCLAATMIYG
Ga0193087_1012184723300018964MarineWVVKVDADAIFVPHRLKGMLMGHPITYTGIYLENCKSVKWGFFGNLEVFSIEAFNTLMANIDECSQRIDWVKGTKFGPIGEDLFAQMCMDDHGVSKVQNFDVTTDAMCPDTKKRWGEKNNTKWKPPCDKVGTPAIHPFKKPQEYFSCLDATMTFG
Ga0193293_1004105613300018966MarineMGGSGYPTIKVEDAVHEFHLVKRKNQGTWINTGLFKQVWKAMKGQIGLEKADWVVKVDADAVFVPHRLKTALMGHPLTYTGIYFENCKEVQFGLFGNLEVWSIQAFNTLLANIDSCSTSIDWVKGTKWGPIGEDLFAQMCMDLNGVSKVQNFDLTTDAACPGTRKRWGVKTKTTDDKKWKPNCAKVQTPALHPFKKPNEYFNCLDATLSFAP
Ga0193293_1008647213300018966MarineHRLKKMLLGHPLTATGVYFENCKEVEWGLFGNMEVWSIQAFNALLANLDSCSESIDWVTGTKWGPIGEDLFAQMCMDSQGVSKIQNFDLTTDAECPSTRKRWGQKENKKWKVPCDAVLTPSMHPFKKPEEYFRCLDASLALERKVEAREQSSDA
Ga0193417_1019001113300018970MarineIVKVDADAVFIPHRLKGMLQGHPLTHTGIYLENCKSVQYGYFGNLEVFSAEAFNTLVANIGSCSQRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDVTTDGACPGTRKRWGEKNNKKWKPPCNLLGTPAIHPFKKPQEYFSCLDATTVFG
Ga0192968_1008342913300018981MarineGMFKQIWKAVAATEAVKMADWVVKVDADAVFLPHRLRGMLQGHPLTYTGIYLENCKSVQWGFFGNLEVLSAEAFNTLVANIDSCSQRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDLTTDAACPGTRTRWGEKNNKKWKPPCNLLGTPAIHPFKKPEEYFSCLDATTVYG
Ga0192947_1012929913300018982MarineWIVKVDADAVFVPPRLKKLLLGHPLSASGIYLENCKEVEWGLFGNLEVWSIQAFNALLSNLDSCSQSIDWVTGTKWGPIGEDLFAQMCMDKQGVSKVQNFDVTTDGACPGTRKRWGQKHNKHWKVPCNSVLTPSMHPFKKPAEYFNCMDATLALER
Ga0193275_1015825613300018988MarineMGDARTTDADWVVKVDADAVFVPDRLKQMLQGHPLTYTGIYVENCKEVQWGFFGNLEVVSKEAFLTLVDNLDLCSQRIDWVKGTKWGPIGEDLFAQMCMDDHGVSKVQNFDVTTDGACPGTRKRWGEKGNKKWKPPCQLLGTPAIHPFKKPNEYFACLDATMAYEAK
Ga0193275_1026421213300018988MarineYSMIKVSDVENEFHLIKRKKVGTWVNTGMFKQVWKAMAGRTEITKSDWVVKVDADAVFVPHRLKGMLQGQPITYTGVYIENCKSVKWGFFGNLEVYSSTAFYTLLGNLDRCSQMIDFVKGTEWGPIGEDLFAQMCMDYSGVSKVQNFNVTTDAACPGTRKRWGEANNTKWKPPCHLLGTP
Ga0193030_1009897413300018989MarineVVAQVGSGYPTIKVDDVAHEFHVVKRKKVGTWVNTGMFKQIWKAMSRKIGLQKADWVVKVDADAVFVPHRLKAALMGQPLAYAGIYFENCQGVEWGFFGNLEVYSMQAFKTLLANIDSCSEKIDWVKGTKWGPIGEDLFAQMCMDNQGVAKLQNFDLTTDALCPGTKKRWGQKDNNKWKPPCAWVSTPSVHPFKKVQEWMSCHDATIALG
Ga0193444_1008051523300018998MarineTIKVEDVENDFHVIRRKKTKTWVNTGLFKQVWRAIGDSSGETVRDAEWVVKVDADAVFVPHRLKGMVQGHPITYTGIYIENCKSVQYGFFGNLEVFSREAFDTLLANLDSCSSKIDWVKGTKWGPIGEDLFAQMCMDYNGVSRVQNFDLTTDAACPGTRKRWGEKQNKKWKPPCNLVGTPALHPFKKPQEYFSCLDATMTFG
Ga0193444_1009169013300018998MarineLFEQVWKAIAATTGETLRDAEWVVKVDADAVFFPHRLKGMLQGHPITYTGIYIENCKSVQYGFFGNLEVFSREAFDTLLANLDSCSKRIDWVKGTKWGPIGEDLFAQMCMDYNGVSKVQNFDVTTDAACPGTRKRWGEKQNKKWKPPCNLIGTPALHPFKKPQEYFSCLDATTTFG
Ga0193444_1010222923300018998MarineTWVNTGLFKQVWRAIGDSSGETLRDAEWVVKVDADAVFVPHRLKGMLQGHPITYTGIYIENCKSVQYGFFGNLEVFSREAFDTLLANLDSCSSKIDWVKGTKWGPIGEDLFAQMCMDYNGVSKVQNFDLTTDAACPGTRKRWGEKENKKWKPPCNLVGTPALHPFKKPQEYFSCLDATMTFG
Ga0193444_1010335923300018998MarineMGKQVWRAVAGRTQDAEWVVKADADAIFLPHRLKGMLQGHPITNTGIYIENCKAVQWGFFGNLEVFSREAWDTLLGNLDSCSTRIDWVKGTKYGPIGEDLFAQMCMDYNGVSKVQNFDLTTDAACPGTRKRWGEKENKKWKPPCNLVGTPALHPFKKPQEYFSCLDATMTFG
Ga0193444_1011031423300018998MarinePHRLKGMLQGHPITFTGIYIENCKSVQYGFFGNLEVFSREAFDTLLANLDSCSKRIDWVKGTKWGPIGEDLFAQMCMDYNGVSKVQNFDVTTDAACPGTRKRWGEKQNKKWKPPCNLIGTPALHPFKKPQEYFSCLDATTTFG
Ga0193514_1010154223300018999MarineVKVDADAVFVPNRLRTMLQGHPVTYTGIYLENCKSVRWGFFGNLEVFSIEAFNTLLANIDSCTQKIDWVKGTEWGPIGEDLFAQMCMDYNGVSKVQNFDLTTDGACPGTRKRWGEKNNTKWKPPCEKLATPAMHPFKKPDDYFNCVTATMNFAP
Ga0193514_1025719113300018999MarineGIWRKVSLTAAQNSADWVVKVDADAVFVPQRLRVMLQGHPLTSTGIYLENCQSVKWGFFGNLEVISAVGFKTFANNIDSCSQQIDWVAGTKWGPIGEDLFMQKCMDANGVSKVAGFDLTTDAACPGTRTRWGEKNNKKWKPPCNLLRTPAIHPFKDPQDYRACLDATTALD
Ga0193034_1010924113300019001MarineNTGMFKQVWKEIAKTLGTKTVEWVVKVDADAVFIPHRLKGMLMGQPITNTGIYIENCKSVEWGYFGNLEIFSIQAFNTLLSNIDSCSAKIDWVKGTKWGPIGEDLFAQMCMDDHGVSKVQNFGVTTDAMCPGTRKRWGQTDNKKWKPPCNLVGSPALHPFKKPEEYFQCLYDTQVLG
Ga0193196_1024305223300019007MarineVKVDADAVFVPHRLKGMLQGHPLTYTGIYLENCKSVQYGFFGNLEVFSSEAFNTLVNNIDSCSKRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDVTTDGACPGTRKRWGEKDNKKWKPPCDLLGTPAMHPFKKPHEYFSCLDATMRFG
Ga0193569_1024118913300019017MarineMTVVEDVDNEFHVIKRPEVGGWMNTGLFKQIWKKMGPEVQSTDAEWIVKVDADAVFVPHRLKGMLQGHPLTFSGIYIENCKGVQWGFFGNLEVFSKEAFQTLVDNLDDCSKKIDWVKGTKWGPIGEDLFAQMCLDYHGVSKVQNFDVTTDGACPGTRKRWGEKKNKKWKPPCHLVGTPAMHPFKKPKDYFACLDATMVYN
Ga0193569_1024119713300019017MarineMTVVEDVDNEFHVIKRPEVGGWMNTGLFKQAWKKLGPEVQSTDAEWVVKVDADAVFVPHRLKGMLQGHPLTFSGIYIENCKGVQWGFFGNLEVFSKEAFQTLVDNLDDCSKKIDWVKGTKWGPIGEDLFAQMCLDYHGVSKVQNFDVTTDGACPGTRKRWGEKKNKKWKPPCHLVGTPAMHPFKKPKDYFACLDATMVYN
Ga0193569_1033468913300019017MarineFHVIKRPKVGGWMNTGLFKQVWKRLGQDVRNTDADWVVKVDADAVFVPHRLKGMLQGHPLTYAGIYIENCKEVMWGFFGNLEVFSKDAFQTLVDNLDDCGKKIDWVKGTKWGPIGEDLFAQMCMDYHGVSKVQNFDVTTDGACPGTKKRWGEKNTKKWKPPCHLVGTPAIHPFKKPNDYFACLDATMVYN
Ga0193555_1017178913300019019MarineFKQVWKAMKGQIGLEKADWVVKVDADAVFVPHRLKTALMGHPLTYTGIYFENCKDVQWGLFGNLEVYSSQAFNTLLANIDSCSTSIDWVEGTKWGPIGEDLFAQMCMDLNGVSKVQNFDLTTDAACPGTRKRWGVKTKTTDDKKWKPNCAKVQTPALHPFKKPNEYFNCLDATLSFAP
Ga0192951_1020506113300019022MarineWIVKVDADAVFVPARLQKLLLGHPLSASGVYFENCKEVEWGLFGNLEVWSIQAFNALLSNLESCSQSIDWVTGTKWGPIGEDLFAQMCMDKQGVSKIQNFDVTTDAACPGTRKRWGQADNKHWKVPCNSVLTPSIHPFKKPAEYFKCMDATLALER
Ga0192886_1005167413300019037MarineLIKRKKTGTWVNTGMFKQVWKAIAQKPAIKEVQWVVKVDADAIFFPHRLKGMLQGHPITYTGIYLENCNEVKWGFFGNLEVFSVEAFNTLLNNIDSCSQSIDWVKGTKFGPIGEDLFAQMCMDRNGVSKVQNFDLTTDGVCPGTKKRWGAKNATKWKPPCNLVGTPAIHPFKKPEEYFSCYEATKTFG
Ga0192886_1008966813300019037MarineLIKRKKTGTWVNTGMFKQVWKAIAQKPAIKEVQWVVKVDADAIFFPHRLKGMLQGHPITYTGIYLENCNEVKWGFFGNLEVFSVEAFNTLLNNIDSCSQSIDWVKGTKFGPIGEDLFAQMCMDRNGVSKVQNFDLTTDGVCPGTKKRWGAKNATKWKPPCNLVGTPAIHPFKKPQEYFSCYEATKAFG
Ga0193123_1031551723300019039MarineVPHRLKGMLQGHPVTYTGIYIENCNTVQWGFFGNLEVFSIEAWNTLIANLDSCSQKIDWVKGTKWGPIGEDLFAQMCMDYNGVSKVQNFGVTTDAACPGTKKRWGAAENDKKWKPPCNLVGTPALHPFKKPEDYFSCLEATMTFG
Ga0192857_1031328213300019040MarineKGMLQGHPITYSGIYLENCKSVQWGFFGNLEVFSIEAFNTLLANIDSCSQKIDWVKGTKWGPIGEDLFAQMCMDYNGVSKVQNFDVTTDGACPGTRKRWGEAKNKKWTPPCHLVGTPALHPFKKPEEYFRCLDATMTFG
Ga0193082_1021790413300019049MarineMFKQVWKAIAQKAELTKVQWVVKVDADAVFVPNRLRTMLQGHPVTYTGIYLENCKSVRWGFFGNLEVFSIEAFNTLLANIDSCTQKIDWVKGTEWGPIGEDLFAQMCMDYNGVSKVQNFDLTTDAACPGTRKRWGEKNNTKWKPPCEKLATPAMHPFKKPDDYFNCVTATMNFAA
Ga0193082_1029928013300019049MarineMFKQVWKAIAQKAELTKVQWVVKVDADAVFVPNRLRTMLQGHPVTYTGIYLENCKSVRWGFFGNLEVFSIEAFNTLLANIDSCTQKIDWVKGTEWGPIGEDLFAQMCMDYNGVSKVQNFDLTTDAACPGTRKRWGEKNNTKWKPPCEKLATPAMHPFKKPEDYFNCVTATLNFKEQKAQ
Ga0193541_103882713300019111MarineQKADWVVKVDADAVFVPHRLKAALMGQPLAYTGIYFENCQGVEWGFFGNLEVYSMQAFKTLLANIDSCSEKIDWVKGTKWGPIGEDLFAQMCMDNQGVAKLQNFDLTTDALCPGTKKRWGQKDNNKWKPPCAWVSTPSVHPFKKVQEWMSCHDATIALG
Ga0193443_100980513300019115MarineKVGTWVNTGMFKQVWKAMAGRTEITKSDWVVKVDADAVFVPHRLKGMLQGQPITYTGVYIENCKSVKWGFFGNLEVYSSTAFYTLLGNLDRCSQMIDFVKGTEWGPIGEDLFAQMCMDYSGVSKVQNFNVTTDAACPGTRKRWGEANNTKWKPPCHLLGTPAIHPFKKPEEYFSCLAATMIYG
Ga0193443_101079713300019115MarineHGGTWVNSGMFKQVWKATKGRIGLEKADWVVKVDADAVFVPHRLKAALMGHPLTYTGVYFENCEGVEWGFFGNLEVYSSQAFSTLLVGIDSCSEKIDWVKGTKWGPIGEDLFAQMCMDNQGVTKLQNFDLTTDAACPGTRKRWGQKDNKKWKPPCGSLGTPAMHPFKKPQEWLTCHEATIALG
Ga0193443_101644513300019115MarineAEKPEIKEVQWVVKVDADAIFVPHRLKGMLQGHPITYTGIYLENCKSVQWGFFGNLEVFSVEAFNTLLANIDSCSQKIDWVKGTKWGPIGEDLFAQMCMDSNGVSKVQNFDVTTDGACPGTRKRWGEEKNKKWKPPCNLVGTPALHPFKKPEEYFSCLDATMTFG
Ga0193443_101911513300019115MarineAEKPEIKEVQWVVKVDADAIFVPHRLKGMLQGHPITYTGIYLENCKSVQWGFFGNLEVFSVEAFNTLLANIDSCSQKIDWVKGTKWGPIGEDLFAQMCMDSNGVSKVQNFDVTTDGACPGTRKRWGEEKNKKWKPPCHLVGTPALHPFKKPEEYFSCLDATMTFG
Ga0193144_103130113300019126MarineEGDFHLVKRKTVGTWVNTGMFKQIWKKVAATAEVKMADWVVKVDADAVFVPHRLKGMLQGHPLTHTGIYLENCKSVQYGFFGNLEVFSAEAFNTLTTNIDSCSQRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDLTTDAACPGTRKRWGEKNNKKWKPPCQLLGTPAMHPFKKPQEYFSCLDATMVYG
Ga0193144_107693813300019126MarineLFKQIWKAVAATGKVQLADWVVKVDADAVFIPHRLKGMLQGHPLTRTGIYLENCKSVQYGYFGNLEVFSAEAFNTLVANIGSCSQRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDVTTDGACPGTRKRWGEKNNKKWKPPCNLLGTPAMHPFKKPQEYFSCLDATMVFG
Ga0192856_103771813300019143MarineTWVNTGLFKQIWKAVAATEAVKMADWVVKTDADAVFLPHRLRGMLQGHPLTYTGIYLENCKSVQWGFFGNLEVFSAEAFTTLVNNIDSCSQRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDLTTDGACPGTRTRWGEKDNKKWKPPCELIGTPAIHPFKKPEEYLNCLAATEKLG
Ga0192888_1015908513300019151MarineFKQIWKAVAATGKVQLADWVVKVDADAVFIPHRLKGMLQGHPLTHTGIYLENCKSVQYGYFGNLEVFSAEAFNTLVANIDSCGQRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDVTTDGACPGTRKRWGEKNNKKWKPPCNLLGTPAIHPFKKPQEYFSCLDATTVFG
Ga0304731_1051073913300028575MarineVKVDADAVFVPHRLKGMLQGHPLTFSGIYIENCKGVQWGFFGNLEVFSREAFQTLVDNLNDCSKKIDWVKGTKWGPIGEDLFAQMCLDYHGVSKVQNFDVTTDGPCPGTRKRWGEKKNKKWKPPCHLVGTPAIHPFKKPKDYFACLDATMVYN
Ga0304731_1068501013300028575MarineTGMFKQIWKAVASTAEVKMADWVVKADADAVFVPHRLRGMLQGHPLTNTGIYLENCKSVEYGFFGNLEVFSAEAFNTLVNNIDSCSQRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDVTTDGACPGTRKRWGEKNNKKWKPPCELLGTPAMHPFKKPQEYFSCL
Ga0073967_1000044213300030750MarineDVDNDFHLVKRKETSKGWINTGLFKQAWRAVGLRDGPKRADWIVKVDADAVFVPHRLKKTLLGHPLSATGVYFENCKEVQWGLFGNLEVWSIQAFNALLNNLDECAQSIDWVKGTKWGPIGEDLFAQMCMDKQGVSKVQNFDLTTDGMCPGTLKRWGQKGNKKWKPPCDSVLTPAIHPFKKPEEYFKCLDATLALER
Ga0073967_1175292013300030750MarineVDADTVFIPHRLKAALMGHPLTWTGVYFENCKEVEWGFFGNLEVFSLQAFNSLVANIDSCSQKIDWVKGTQWGPIGEDLFAQMCMDYQGVTKLQNFDLTTDGKCPGTRKSWGQPDNMKWQPNCAWVSTPALHPFPEPQEWSSCHQATEALG
Ga0073967_1189559613300030750MarineREGPKRADWIVKVDADAVFVPQRLRKMLLGHPLSAAGIYFENCKEVQWGLFGNLEVWSIQAFNALLLNLDSCSQSIDWVTGTKWGPIGEDLFAQMCMDQQGVSKVQNWDLTTDGACPGTLKRWGEKDNKHWKVPCDKVMTPALHPFKKPEEYFSCLDATVALEKSSRSDQALDH
Ga0073947_100646413300030801MarineDFHMVKRKTAGTWVNTGLFKQIWKAVAATAEVKKADWVVKVDADAVFVPHRLKGMLQGHPLTYTGIYLENCKSVQYGFFGNLEVFSSEAFNTLVNNIDSCSKRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDVTTDGACPGTRKRWGEKNNTKWKPPCEKLATPAMHPFKKPDDYFNCVTATMNFA
Ga0073963_1093593813300030859MarineVWKATTGRIGREKAEWVVKVDADTVFIPHRLKAALMGHPLTWTGVYFENCKEVEWGFFGNLEVFSLQAFNSLVANIDSCSQKIDWVKGTQWGPIGEDLFAQMCMDYQGVTKLQNFDLTTDGKCPGTRKSWGQPDNMKWQPNCAWVSTPALHPFPEPQEWSSCHQATEALG
Ga0073985_1062960013300030918MarineKVDADAVFVPQRLRNLLTQQPDTYTGVYIENCKGVEYGYFGNLEIMSKTAFKLLLDNIDSCSEKIDWVKGTKWGPIGEDLFAQMCMDQQGVSKVQNWDLTTDGACPGTLKRWGETDNKHWKVPCDKVMTPALHPFKKPEEYFSCLDATLALDK
Ga0073937_1207003513300030951MarineWVNTAMFKQVWKAIAQKAELTKVQWVVKVDADAVFVPNRLRTMLQGHPVTYTGIYLENCKSVRWGFFGNLEVFSIEAFNTLLANIDSCTQKIDWVKGTEWGPIGEDLFAQMCMDYNGVSKVQNFDLTTDGACPGTRKRWGEKNNTKWKPPCEKLATPAMHPFKKPDDYFNCVTATMNFAP
Ga0073943_1150538513300030955MarineTGMFKQVWKKVAATAEVKMADWVVKVDADAVFVPHRLKGMLQGHPITYTGIYLENCKSVQWGFFGNLEVFSVEAFNTLLANIDSCSQKIDWVKGTKWGPIGEDLFAQMCMDSNGVSKVQNFDVTTDGACPGTKKRWGEEKNKKWKPPCNLVGTPALHPFKKPEEYFSCLDATMTFG
Ga0073979_1206510213300031037MarineMFKQIWKAMSGKIGLQKADWVVKVDADAVFVPHRLKAALMGQPLTYTGIYFENCQGVEWGFFGNLEVYSMQAFKTLLANIDSCSEKIDWVKGTKWGPIGEDLFAQMCMDNQGVTKLQNFDLTTDALCPGTKKRWGQKDNKKWKPPCAWVATPALHPFKKPQEWFTCHQATMALG
Ga0307396_1055627713300031717MarineGMFKQIWKAVAATEAVKMADWVVKVDADAVFLPHRLRGMLQGHPLTFTGIYLENCKSVQWGFFGNLEVLSAEAFNTLVANIDSCSQRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDLTTDAACPGTRTRWGEKNNKKWKPPCNLLGTPAIHPFKKPEEYFSCLDATTVYG
Ga0307381_1013191013300031725MarineGPKRSDWIVNVDADAVFVPPRLKRLLLGHPLSGSGVYLENCKEVEWGLFGNLEVWSIQAFNALLSNLDSCSQSIDWVTGTKWGPIGEDLFAQMCMDKQGVSKVQNFDVTTDGACPGTRKRWGQKHNKHWKVPCNSVLTPSMHPFKKPAEYFNCMDATLALER
Ga0307381_1033271613300031725MarineFHLIKRKTVGSWVNTGMFKQIWKAVAATEAVKMADWVVKVDADAVFLPHRLRGMLQGHPLTYTGIYLENCKSVQWGFFGNLEVLSTEAFNTLVANIDSCSQRIDWVKGTKWGPIGEDLFAQMCMDDNGVSKVAGFDLTTDAACPGTRTRWGEKNNKKWKPPCNLLGTPAIHPFKKPEEYFSCL
Ga0307384_1057651213300031738MarineDDGGWINTGMFKQAWKAVGLREGPKRSDWIVKVDADAVFVPARLQKLLLGHPLSASGVYFENCKEVEWGLFGNLEIWSIQAFNALLSNLESCSQSIDWVTGTKWGPIGEDLFAQMCMDKQGVSKIQNFDVTTDAACPGTRKRWGQAHNKHWKVPCNSVLTPSIHPFKKPAEYFNCMDA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.