Basic Information | |
---|---|
Family ID | F052308 |
Family Type | Metagenome |
Number of Sequences | 142 |
Average Sequence Length | 49 residues |
Representative Sequence | MDLLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKEGPLVPVGVTN |
Number of Associated Samples | 61 |
Number of Associated Scaffolds | 142 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 15.94 % |
% of genes near scaffold ends (potentially truncated) | 92.25 % |
% of genes from short scaffolds (< 2000 bps) | 95.07 % |
Associated GOLD sequencing projects | 60 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.24 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (82.394 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (92.254 % of family members) |
Environment Ontology (ENVO) | Unclassified (92.254 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (92.254 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.69% β-sheet: 0.00% Coil/Unstructured: 88.31% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 142 Family Scaffolds |
---|---|---|
PF03936 | Terpene_synth_C | 0.70 |
PF00078 | RVT_1 | 0.70 |
PF00931 | NB-ARC | 0.70 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 82.39 % |
All Organisms | root | All Organisms | 17.61 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005334|Ga0068869_101526249 | Not Available | 593 | Open in IMG/M |
3300005354|Ga0070675_100277326 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 1472 | Open in IMG/M |
3300005356|Ga0070674_100818194 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 806 | Open in IMG/M |
3300011119|Ga0105246_10517739 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 1016 | Open in IMG/M |
3300011119|Ga0105246_11660388 | Not Available | 606 | Open in IMG/M |
3300013297|Ga0157378_11718608 | Not Available | 675 | Open in IMG/M |
3300013297|Ga0157378_12324006 | Not Available | 588 | Open in IMG/M |
3300013297|Ga0157378_12531808 | Not Available | 565 | Open in IMG/M |
3300015268|Ga0182154_1010264 | Not Available | 853 | Open in IMG/M |
3300015274|Ga0182188_1055749 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 518 | Open in IMG/M |
3300015275|Ga0182172_1040587 | Not Available | 606 | Open in IMG/M |
3300015276|Ga0182170_1025661 | Not Available | 689 | Open in IMG/M |
3300015276|Ga0182170_1071383 | Not Available | 515 | Open in IMG/M |
3300015277|Ga0182128_1009825 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 896 | Open in IMG/M |
3300015277|Ga0182128_1028213 | Not Available | 676 | Open in IMG/M |
3300015277|Ga0182128_1036423 | Not Available | 630 | Open in IMG/M |
3300015277|Ga0182128_1036730 | Not Available | 629 | Open in IMG/M |
3300015281|Ga0182160_1028965 | Not Available | 680 | Open in IMG/M |
3300015283|Ga0182156_1009573 | Not Available | 941 | Open in IMG/M |
3300015283|Ga0182156_1013963 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales | 848 | Open in IMG/M |
3300015285|Ga0182186_1067487 | Not Available | 535 | Open in IMG/M |
3300015286|Ga0182176_1041796 | Not Available | 631 | Open in IMG/M |
3300015288|Ga0182173_1026381 | Not Available | 705 | Open in IMG/M |
3300015288|Ga0182173_1048556 | Not Available | 596 | Open in IMG/M |
3300015288|Ga0182173_1069075 | Not Available | 538 | Open in IMG/M |
3300015288|Ga0182173_1086827 | Not Available | 501 | Open in IMG/M |
3300015289|Ga0182138_1054223 | Not Available | 583 | Open in IMG/M |
3300015291|Ga0182125_1036754 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 664 | Open in IMG/M |
3300015294|Ga0182126_1030628 | Not Available | 702 | Open in IMG/M |
3300015294|Ga0182126_1040480 | Not Available | 649 | Open in IMG/M |
3300015294|Ga0182126_1076204 | Not Available | 539 | Open in IMG/M |
3300015298|Ga0182106_1002361 | Not Available | 1520 | Open in IMG/M |
3300015298|Ga0182106_1011044 | Not Available | 966 | Open in IMG/M |
3300015299|Ga0182107_1002744 | Not Available | 1427 | Open in IMG/M |
3300015299|Ga0182107_1072017 | Not Available | 565 | Open in IMG/M |
3300015299|Ga0182107_1073909 | Not Available | 560 | Open in IMG/M |
3300015302|Ga0182143_1101642 | Not Available | 507 | Open in IMG/M |
3300015303|Ga0182123_1076011 | Not Available | 544 | Open in IMG/M |
3300015303|Ga0182123_1077241 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 542 | Open in IMG/M |
3300015304|Ga0182112_1066210 | Not Available | 581 | Open in IMG/M |
3300015305|Ga0182158_1045600 | Not Available | 645 | Open in IMG/M |
3300015308|Ga0182142_1108315 | Not Available | 513 | Open in IMG/M |
3300015314|Ga0182140_1084504 | Not Available | 556 | Open in IMG/M |
3300015314|Ga0182140_1117569 | Not Available | 500 | Open in IMG/M |
3300015321|Ga0182127_1012887 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 988 | Open in IMG/M |
3300015321|Ga0182127_1101833 | Not Available | 537 | Open in IMG/M |
3300015322|Ga0182110_1082969 | Not Available | 572 | Open in IMG/M |
3300015323|Ga0182129_1007924 | Not Available | 1091 | Open in IMG/M |
3300015323|Ga0182129_1074219 | Not Available | 577 | Open in IMG/M |
3300015341|Ga0182187_1037296 | Not Available | 900 | Open in IMG/M |
3300015341|Ga0182187_1134397 | Not Available | 582 | Open in IMG/M |
3300015342|Ga0182109_1016739 | Not Available | 1244 | Open in IMG/M |
3300015342|Ga0182109_1049894 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 871 | Open in IMG/M |
3300015342|Ga0182109_1097327 | Not Available | 687 | Open in IMG/M |
3300015342|Ga0182109_1195987 | Not Available | 528 | Open in IMG/M |
3300015343|Ga0182155_1008677 | Not Available | 1459 | Open in IMG/M |
3300015343|Ga0182155_1141530 | Not Available | 598 | Open in IMG/M |
3300015343|Ga0182155_1152615 | Not Available | 582 | Open in IMG/M |
3300015343|Ga0182155_1188693 | Not Available | 537 | Open in IMG/M |
3300015343|Ga0182155_1199423 | Not Available | 526 | Open in IMG/M |
3300015343|Ga0182155_1222310 | Not Available | 504 | Open in IMG/M |
3300015344|Ga0182189_1065107 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 798 | Open in IMG/M |
3300015344|Ga0182189_1213372 | Not Available | 516 | Open in IMG/M |
3300015345|Ga0182111_1009902 | Not Available | 1532 | Open in IMG/M |
3300015345|Ga0182111_1102249 | Not Available | 702 | Open in IMG/M |
3300015345|Ga0182111_1208220 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 536 | Open in IMG/M |
3300015346|Ga0182139_1126741 | Not Available | 649 | Open in IMG/M |
3300015346|Ga0182139_1191577 | Not Available | 554 | Open in IMG/M |
3300015347|Ga0182177_1050258 | Not Available | 913 | Open in IMG/M |
3300015347|Ga0182177_1100621 | Not Available | 710 | Open in IMG/M |
3300015347|Ga0182177_1230614 | Not Available | 518 | Open in IMG/M |
3300015347|Ga0182177_1234305 | Not Available | 514 | Open in IMG/M |
3300015351|Ga0182161_1001882 | Not Available | 2548 | Open in IMG/M |
3300015351|Ga0182161_1063770 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 878 | Open in IMG/M |
3300015351|Ga0182161_1064655 | Not Available | 874 | Open in IMG/M |
3300015351|Ga0182161_1064967 | Not Available | 872 | Open in IMG/M |
3300015351|Ga0182161_1085880 | Not Available | 785 | Open in IMG/M |
3300015351|Ga0182161_1139124 | Not Available | 653 | Open in IMG/M |
3300015351|Ga0182161_1155080 | Not Available | 626 | Open in IMG/M |
3300015351|Ga0182161_1240082 | Not Available | 525 | Open in IMG/M |
3300015351|Ga0182161_1249748 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 516 | Open in IMG/M |
3300015355|Ga0182159_1029807 | Not Available | 1354 | Open in IMG/M |
3300015355|Ga0182159_1158917 | Not Available | 709 | Open in IMG/M |
3300015355|Ga0182159_1187775 | Not Available | 660 | Open in IMG/M |
3300015355|Ga0182159_1220440 | Not Available | 616 | Open in IMG/M |
3300015355|Ga0182159_1233800 | Not Available | 601 | Open in IMG/M |
3300015355|Ga0182159_1295052 | Not Available | 542 | Open in IMG/M |
3300015355|Ga0182159_1347909 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 504 | Open in IMG/M |
3300015361|Ga0182145_1015712 | Not Available | 1122 | Open in IMG/M |
3300017404|Ga0182203_1039526 | Not Available | 791 | Open in IMG/M |
3300017404|Ga0182203_1045076 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 761 | Open in IMG/M |
3300017404|Ga0182203_1061523 | Not Available | 690 | Open in IMG/M |
3300017404|Ga0182203_1080871 | Not Available | 633 | Open in IMG/M |
3300017404|Ga0182203_1140976 | Not Available | 528 | Open in IMG/M |
3300017407|Ga0182220_1093183 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 525 | Open in IMG/M |
3300017409|Ga0182204_1012717 | Not Available | 972 | Open in IMG/M |
3300017410|Ga0182207_1083383 | Not Available | 648 | Open in IMG/M |
3300017411|Ga0182208_1048456 | Not Available | 681 | Open in IMG/M |
3300017411|Ga0182208_1078022 | Not Available | 590 | Open in IMG/M |
3300017413|Ga0182222_1058670 | Not Available | 590 | Open in IMG/M |
3300017415|Ga0182202_1071091 | Not Available | 625 | Open in IMG/M |
3300017420|Ga0182228_1100518 | Not Available | 551 | Open in IMG/M |
3300017424|Ga0182219_1058980 | Not Available | 658 | Open in IMG/M |
3300017424|Ga0182219_1128915 | Not Available | 516 | Open in IMG/M |
3300017430|Ga0182192_1144964 | Not Available | 535 | Open in IMG/M |
3300017433|Ga0182206_1065423 | Not Available | 668 | Open in IMG/M |
3300017433|Ga0182206_1139172 | Not Available | 525 | Open in IMG/M |
3300017438|Ga0182191_1030056 | Not Available | 907 | Open in IMG/M |
3300017438|Ga0182191_1053175 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 758 | Open in IMG/M |
3300017438|Ga0182191_1078587 | Not Available | 668 | Open in IMG/M |
3300017442|Ga0182221_1027922 | Not Available | 871 | Open in IMG/M |
3300017442|Ga0182221_1036146 | Not Available | 807 | Open in IMG/M |
3300017442|Ga0182221_1048130 | Not Available | 742 | Open in IMG/M |
3300017442|Ga0182221_1093980 | Not Available | 606 | Open in IMG/M |
3300017442|Ga0182221_1103102 | Not Available | 589 | Open in IMG/M |
3300017442|Ga0182221_1104499 | Not Available | 586 | Open in IMG/M |
3300017442|Ga0182221_1126331 | Not Available | 553 | Open in IMG/M |
3300017443|Ga0182193_1030095 | Not Available | 934 | Open in IMG/M |
3300017443|Ga0182193_1058732 | Not Available | 756 | Open in IMG/M |
3300017443|Ga0182193_1111785 | Not Available | 612 | Open in IMG/M |
3300017443|Ga0182193_1133037 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 577 | Open in IMG/M |
3300017443|Ga0182193_1191333 | Not Available | 507 | Open in IMG/M |
3300017683|Ga0182218_1014510 | Not Available | 1011 | Open in IMG/M |
3300017683|Ga0182218_1042391 | Not Available | 744 | Open in IMG/M |
3300017683|Ga0182218_1103326 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 569 | Open in IMG/M |
3300017684|Ga0182225_1030963 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 811 | Open in IMG/M |
3300017684|Ga0182225_1074048 | Not Available | 619 | Open in IMG/M |
3300017684|Ga0182225_1081671 | Not Available | 601 | Open in IMG/M |
3300017684|Ga0182225_1123510 | Not Available | 528 | Open in IMG/M |
3300017686|Ga0182205_1015105 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1099 | Open in IMG/M |
3300017686|Ga0182205_1082239 | Not Available | 644 | Open in IMG/M |
3300017690|Ga0182223_1008775 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1027 | Open in IMG/M |
3300017690|Ga0182223_1047803 | Not Available | 655 | Open in IMG/M |
3300017690|Ga0182223_1075229 | Not Available | 579 | Open in IMG/M |
3300017690|Ga0182223_1085294 | Not Available | 559 | Open in IMG/M |
3300025926|Ga0207659_11740952 | Not Available | 530 | Open in IMG/M |
3300025938|Ga0207704_10055515 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 2421 | Open in IMG/M |
3300026121|Ga0207683_10055452 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 3475 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 92.25% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.11% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.11% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.70% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068869_1015262492 | 3300005334 | Miscanthus Rhizosphere | MYYRMDLLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGIKEGPLVPVGNTNRD* |
Ga0070675_1002773261 | 3300005354 | Miscanthus Rhizosphere | AFSPGYRAGTTIPGLKVEPSVPGHRAGIKEGPLVPVGNTNRD* |
Ga0070674_1008181941 | 3300005356 | Miscanthus Rhizosphere | TAFSPGYRAGTTIPELKVEPSVPGHRAGTKEGPLVPVGVTNRD* |
Ga0105246_105177391 | 3300011119 | Miscanthus Rhizosphere | FSPGYRARTTIPGLKMEPSVPDHRARIKEGPLVPVGVTNQD* |
Ga0105246_116603881 | 3300011119 | Miscanthus Rhizosphere | HYYRMDLLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGIKEGPLVPVGNTNRD* |
Ga0157378_117186082 | 3300013297 | Miscanthus Rhizosphere | GAIHYYRIDLLSQAVTTFSPGYRAGTTIPGLKVEPSVPGHRAGTKDGPLIPVGVINWD* |
Ga0157378_123240061 | 3300013297 | Miscanthus Rhizosphere | MDLLSRTVTAFSPGYRAGTTIPGLNVEPSVPGHRAGIKEGPLVPVGNT |
Ga0157378_125318081 | 3300013297 | Miscanthus Rhizosphere | MDLLSRAVTAFSPGYRAGTTIPGLKVKSSVPGHRARTKEGPLVLVGVTNR |
Ga0182154_10102642 | 3300015268 | Miscanthus Phyllosphere | MDLLSQPITAFSPGYRAGTTLLGLKVEPSVPGHQAGTKERPLVP |
Ga0182188_10557491 | 3300015274 | Miscanthus Phyllosphere | SRAVTAFSPGYRIGTTIPGLKVEPLVPGHRARTKEGPLVPVGITNQD* |
Ga0182172_10405872 | 3300015275 | Miscanthus Phyllosphere | LKPFDIKFGAIHYYRIDLLSQAVTTFSPGYRAGTTIPGLKVEPSVPGHRAGTKDGPLIPVGVIN |
Ga0182170_10256611 | 3300015276 | Miscanthus Phyllosphere | MDLLSRTITAFSPGYRAGTMIPGLKVEPSVPGHRAGIKEGPLVPVDNTN |
Ga0182170_10713831 | 3300015276 | Miscanthus Phyllosphere | MDLLSQAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKEGPLV |
Ga0182128_10098251 | 3300015277 | Miscanthus Phyllosphere | MDLLSRAVTAFSLGYRAGTTIPGLKVPPLVLGHRAGTKEGPLVP |
Ga0182128_10282131 | 3300015277 | Miscanthus Phyllosphere | MDLLFQTVIAFSPGYRAGTMIPGLKVPPLVPGHRAGTKEGPLV |
Ga0182128_10364232 | 3300015277 | Miscanthus Phyllosphere | MHYYRMDLLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKEGPLVPVGN |
Ga0182128_10367302 | 3300015277 | Miscanthus Phyllosphere | AGTTIPGLKVPPLVPGHRAGTKEGPLVRVGVTNRD* |
Ga0182174_10472741 | 3300015279 | Miscanthus Phyllosphere | MAFSPGYRAGTTIPGLKVPPLVPGHRAGTKEGPLVPVGV |
Ga0182160_10289651 | 3300015281 | Miscanthus Phyllosphere | MDLLSRAVIAFSPGYRAGTTIPGLKVEPSVPGHRAGIKEGPLVPVGNTN |
Ga0182156_10095731 | 3300015283 | Miscanthus Phyllosphere | MHSFIHYYRMDLLSRAVTAFSPGYRAGTTILGLKVPPLVPGHRAGTKEGPLVSVGVTNRD |
Ga0182156_10139632 | 3300015283 | Miscanthus Phyllosphere | MALLSRAVTAFNPGYRAGTTIPRLKVEPSVPGHRAGTKEGPLVLVGVTNRV |
Ga0182186_10674871 | 3300015285 | Miscanthus Phyllosphere | MCESPSSLHYYRMDLLSRAVTAFSPGYHAGTTIPGLKVEPSVPGHRAGIKEGPLVPVGNTNRD |
Ga0182176_10417961 | 3300015286 | Miscanthus Phyllosphere | MTFLSRAVTAFSPGYRAGTTILGLKVEPSVPGHRVGTKEGHLVPVGV |
Ga0182173_10263811 | 3300015288 | Miscanthus Phyllosphere | MDLLSRAVIAFSPGYRAGTTIPGLKVEPSVPGHRAGIKEGPLVPVGNT |
Ga0182173_10485561 | 3300015288 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRTGIKEGPLVPV |
Ga0182173_10690751 | 3300015288 | Miscanthus Phyllosphere | MDMLSRAVTAFSPGYRAGTTISELKVEPSVLGHRARIKEGLLVPIDVT |
Ga0182173_10868271 | 3300015288 | Miscanthus Phyllosphere | MDLLSRAVIAFSPGYRARTTIPGLKVEPSVPGHRAGTKEGPLVPVGNTNRD |
Ga0182138_10542232 | 3300015289 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTTISGLKVEPSVPGHRAGTKKGPLVPVGNTN |
Ga0182125_10367541 | 3300015291 | Miscanthus Phyllosphere | MDLLSQAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKEGPLVPV |
Ga0182126_10306281 | 3300015294 | Miscanthus Phyllosphere | MDLLSRAITAFSPGYRAGTTIPGLKVPPLVSGHRAGTKEGP |
Ga0182126_10404801 | 3300015294 | Miscanthus Phyllosphere | MDLLFRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGIKEGPLVPV |
Ga0182126_10762041 | 3300015294 | Miscanthus Phyllosphere | MYHYYRMDLLFWTVTAFSPGYRAGTTIPGLKVEPSAPGHRARIKEGPLV |
Ga0182106_10023612 | 3300015298 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRTGTTIPGLKVESSVPGHRAGTKEGPLVPVGNTNRD |
Ga0182106_10110441 | 3300015298 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKDGPLVPVGVTNRD |
Ga0182107_10027442 | 3300015299 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTMIPGLKVEPSVLGH*AGTKEGPLVPIGVTN |
Ga0182107_10720171 | 3300015299 | Miscanthus Phyllosphere | MDLLSQTVTAFSPGYHTGTTIPGLKVPPLVPGHRAGAKERPLVPVGV |
Ga0182107_10739092 | 3300015299 | Miscanthus Phyllosphere | MDLLSWAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGIKEGPLVPVG |
Ga0182143_11016421 | 3300015302 | Miscanthus Phyllosphere | MDLLSRTVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKGPPA |
Ga0182123_10760111 | 3300015303 | Miscanthus Phyllosphere | MHMGTLHYYRMDLLSRAVTTFSPGYRAGTTIPRLKVPPLVPGHRAGTKEGPLVPVGVTNQ |
Ga0182123_10772413 | 3300015303 | Miscanthus Phyllosphere | MDLLSRAVTAFSSGYRAGTTIPGLKVEPSVPGHRAGTKEGPLVPVGN |
Ga0182112_10662101 | 3300015304 | Miscanthus Phyllosphere | MDLLSRTVTAFSPGYRAGTTIPGLKVEPSVPGHRAGIKEGPLVPVGN |
Ga0182158_10456001 | 3300015305 | Miscanthus Phyllosphere | MSLKQQHGLVHYYRMDLLSRAITVFSPGYRAGTTIPGLKVEPSVSGYRAGTKEGPLVPVRVTNQD* |
Ga0182142_11083151 | 3300015308 | Miscanthus Phyllosphere | RMDLLFRMVTAFSPGYHAGTMIPGLKVPPLVPGHRAGVKEGPLVLVGVTNRD* |
Ga0182140_10845042 | 3300015314 | Miscanthus Phyllosphere | MALLSQTVTAFSPGYRAGTTIPELKVKSSVPGHRAGTKEGHLVPVSVTNRD |
Ga0182140_11175691 | 3300015314 | Miscanthus Phyllosphere | YYRMDLLSRAVTAFSPGYRAGTTIPGLKVPPLVPGHRAGTKEGPLVPVGVTNRD* |
Ga0182127_10128873 | 3300015321 | Miscanthus Phyllosphere | MDLLSRAVKAFSPGYRAGTMIPGLKVEPSVPGHRAGIKEGPLVP |
Ga0182127_11018331 | 3300015321 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTTIPGLKMPPFVPGHRAGTKEGPLVPVGVTNQN |
Ga0182110_10829691 | 3300015322 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRSGTTILGLKVEPSVLGHRAGTKEGPLVPVGV |
Ga0182129_10079241 | 3300015323 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTTIPGLKVPPLVPGHRAGTKEGPLVPVGV |
Ga0182129_10742191 | 3300015323 | Miscanthus Phyllosphere | MALLSRAITAFSPGYRAGTTIPGLKVEPSVPGHRTGTKEG |
Ga0182187_10372961 | 3300015341 | Miscanthus Phyllosphere | MHMGTLHYYRMDLLSRAVTTFSPGYRAGTTIPELKVEPSVPGHRAGTKEGPLVPVGVTNRD* |
Ga0182187_11343972 | 3300015341 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRTGTTIPGLKVEPSVPGHRAGTKEGPLVPVGN |
Ga0182109_10167391 | 3300015342 | Miscanthus Phyllosphere | MDLLSWAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGIKEGPLVPV |
Ga0182109_10498942 | 3300015342 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKEGPLVPVGVTN |
Ga0182109_10973271 | 3300015342 | Miscanthus Phyllosphere | AFSPGYRAGTTIPGLKVPPLVLGHRAGTKEGPLVQVGVTNRD* |
Ga0182109_11959871 | 3300015342 | Miscanthus Phyllosphere | MHVCIKLHYYRMDLLSRAVTAFSPGYRAGTTIPGLKVKPSVPGHQAGTKEGPLVPVGNTNQD* |
Ga0182155_10086772 | 3300015343 | Miscanthus Phyllosphere | MDLLSQAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKEGPLVPVGVT |
Ga0182155_11415301 | 3300015343 | Miscanthus Phyllosphere | MDLLSRAVTALSPGYRAGTTIPGLKVPPLVPGHRAGTKEGPLVPVG |
Ga0182155_11526151 | 3300015343 | Miscanthus Phyllosphere | MDLLSRTVTAFSLGYRAGTTIPGLKVKPSVPGHRAGTKEGPLVPVGNTNR |
Ga0182155_11886931 | 3300015343 | Miscanthus Phyllosphere | MDLLSRAVTAFSLGYRAGTTIPGLKVEPSVPGHRAGIKEGPLVPVGNT |
Ga0182155_11994231 | 3300015343 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTTIPGLKVEPSVPRERAGIKEGPLVSV |
Ga0182155_12223101 | 3300015343 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTTITGLKVPPLVPGHRAGTKEGPLVPVGV |
Ga0182189_10651071 | 3300015344 | Miscanthus Phyllosphere | MDLLFRAVTAFSPGYRAGTTIPGLKVEPSVLGHRAGAKEGPLVL |
Ga0182189_12133721 | 3300015344 | Miscanthus Phyllosphere | MALLSRAVTAFSPGYRAETMIPGLKVEPSVPGHRAGTKEGPLVPV |
Ga0182111_10099021 | 3300015345 | Miscanthus Phyllosphere | MPTAPVVATGHYYRMDLLSQAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKEGPLVPVG |
Ga0182111_11022491 | 3300015345 | Miscanthus Phyllosphere | MDLLSQAVTAFSPGYRAGTTIPGLKVEPSVPGHRARIKEGPLVPVG |
Ga0182111_11893471 | 3300015345 | Miscanthus Phyllosphere | MHHYYRMDLLSRTVMAFSPGYRPRTTIPGLKVPPLVLGHRAGTKQGPLVPV |
Ga0182111_12082201 | 3300015345 | Miscanthus Phyllosphere | MDLLSRTVTAFTPSYHAGTTIPELKVEPSVPGHRAGIKEGP |
Ga0182139_11267411 | 3300015346 | Miscanthus Phyllosphere | MDLLSRAVTAFSLGYRAGTTIPGLKVEPSVPGHRAGIKEGPLVPVGNTNR |
Ga0182139_11915771 | 3300015346 | Miscanthus Phyllosphere | MDLLSRAVTVFSPGYRAGITIPGLKVELSVPGHRAETKEGSLVPVGEALQPSKRGRT |
Ga0182177_10502581 | 3300015347 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTTIPGLKVEPSVSGHRAGTKEGPLVSVGV |
Ga0182177_11006211 | 3300015347 | Miscanthus Phyllosphere | MDTHYYRMDLLSRAVTVFSPGYRTGTTIPGLKVEPSVPSHRAGTKEGPLVPVGVT |
Ga0182177_12306141 | 3300015347 | Miscanthus Phyllosphere | MALLSRTVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKEGPLVPV |
Ga0182177_12343051 | 3300015347 | Miscanthus Phyllosphere | MNKYYTMDLLSRAVTVFSPGYRAGTTIPGLKVPPLVPGHRAGTKEGPLVPVGVTNRD* |
Ga0182161_10018821 | 3300015351 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRVGTTIPELKVPPLVPGHRAGTKEGPLVLVG |
Ga0182161_10637701 | 3300015351 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTTIPGLKVPPLVPGHRARTKEGPLVPVGV |
Ga0182161_10646551 | 3300015351 | Miscanthus Phyllosphere | MDLLSRTVTAFSPGYRAGTTIPGLKVPPLVPGHRAGTKEGPLVPVG |
Ga0182161_10649672 | 3300015351 | Miscanthus Phyllosphere | MELLSWAVTAFSPGYRVGTTIPGLKVEPSVPGHRAGTKEGPLVPVGVTN |
Ga0182161_10858801 | 3300015351 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTTIPGLKVESSVPGHRAGIKEGP |
Ga0182161_11391241 | 3300015351 | Miscanthus Phyllosphere | MHIHHYYRMDLLSRAVTTFSPGYRVGTTIPGLKVSPLVPGHRTGTKEGPLVLVGVTNRD |
Ga0182161_11550801 | 3300015351 | Miscanthus Phyllosphere | MDLLSRAITAFSPGYRTGTTIPGLKVPPLVPGHRAGAKEGPLVPVGVTN |
Ga0182161_12400821 | 3300015351 | Miscanthus Phyllosphere | MDLLSRAVTAISPGYRAGTTIPGLKVEPSVLGHRAGTKEGPLVPV |
Ga0182161_12497481 | 3300015351 | Miscanthus Phyllosphere | MDLLFWTLTAFSPGDHAGTTIPGLKVPPLVPGHRVGTKEGPLVPVDV |
Ga0182159_10298071 | 3300015355 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYCTGTTISGLKVPPLVPGHRAGAKEGPLVPVG |
Ga0182159_11589171 | 3300015355 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRTGTTIPGLKVEPSVPGHRVGTKEGPLVPVG |
Ga0182159_11877751 | 3300015355 | Miscanthus Phyllosphere | MALTFTPLGPGVHYYRMALLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKEGPLVPVGVTNR |
Ga0182159_12204401 | 3300015355 | Miscanthus Phyllosphere | MALLSQAVTAFSPGYRAGTMIPGLKVEPSVPGHRAETKEGPLVPVGVTNR |
Ga0182159_12338001 | 3300015355 | Miscanthus Phyllosphere | MFSQLHYYRMDLLSRAVIAFSPGYRAGTTIPGLKVEPSVPGHRAGIKEGPLVP |
Ga0182159_12950521 | 3300015355 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYHAGTTIPGLKVPPLVPGHQAGTKEGPLVPVG |
Ga0182159_13479091 | 3300015355 | Miscanthus Phyllosphere | MDMLSWAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGIKEGPLVPVGNTNRD |
Ga0182145_10157121 | 3300015361 | Miscanthus Phyllosphere | MNKYYTMDLLSRAVTVFSPGYRAGTTIPGLKVPPLVPGHRAGTKEGPLVP |
Ga0182203_10395261 | 3300017404 | Miscanthus Phyllosphere | MDLLSQAVTAFSLGYHVGTTIPGLKVAPLVPGHRAGTKEGPLVSVVVTNRDERLSS |
Ga0182203_10450763 | 3300017404 | Miscanthus Phyllosphere | MDLLSRAVTAFSLGYRAGTTIPGLKVPPLVLGHRAGTKEGPLV |
Ga0182203_10615231 | 3300017404 | Miscanthus Phyllosphere | MDLLSRAITAFSPGYRAGTTILGLKVPPLVPGHRAGTKDGPLVPVGVTNR |
Ga0182203_10808711 | 3300017404 | Miscanthus Phyllosphere | MDLLSRTVTAFSPGYRAGTTIPGLKVSPLVLGHRAGTKEGSLVPVGVTNR |
Ga0182203_11409761 | 3300017404 | Miscanthus Phyllosphere | MDLLSRAVMAFSPGYRVGTIIPGLKVEPSIPGHRVGTKERPLVPVDVT |
Ga0182220_10515321 | 3300017407 | Miscanthus Phyllosphere | MAFSPGYRVGTTIPGLKVEPSVPGHRAGTKEGPLVP |
Ga0182220_10931831 | 3300017407 | Miscanthus Phyllosphere | MDLLSRTVTAFSPGYRAGTTIPGLKVEPSVPGHRAGIKEG |
Ga0182204_10127171 | 3300017409 | Miscanthus Phyllosphere | MAFSPDYRARTTIPGLQVEHSAPGHRAGTKEGPLIPVG |
Ga0182207_10833831 | 3300017410 | Miscanthus Phyllosphere | MDLLSRAITAFCPGYHAGTMIPGLKVEPSVPGHRARTKEEPLILVSVTN |
Ga0182208_10484561 | 3300017411 | Miscanthus Phyllosphere | MDLLSRAVTAFSLGYRAGTTISGLKVPPLVPGHRAGTKEGPLVPV |
Ga0182208_10780221 | 3300017411 | Miscanthus Phyllosphere | VHYYRIDLLSQAVTAFSPGYHAGTTISRLKVEPSVSGHRAGTKEGLLVPIGV |
Ga0182222_10586701 | 3300017413 | Miscanthus Phyllosphere | MDLLSRTVTAFSPGYRAGTTIPGLKVPPLVPGHRAGTKEGPLVPVGVTNR |
Ga0182202_10710913 | 3300017415 | Miscanthus Phyllosphere | MVSGAVTAFSPSYRARTTIQGLKVEPSVLGHRAGTKDGPLVPIGVTN |
Ga0182228_11005181 | 3300017420 | Miscanthus Phyllosphere | HYYRMDLLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAETKEGPLVLVGVTNRD |
Ga0182219_10589801 | 3300017424 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTTISGLKVEPSVPGHRAGTKEGPLVPVGVTNQD |
Ga0182219_11289151 | 3300017424 | Miscanthus Phyllosphere | MALLSRTVTAFSFSYRAGTTILGLKVEPSVLGHRARTKEGPLVPV |
Ga0182192_11449641 | 3300017430 | Miscanthus Phyllosphere | MALLFRAVTAFSPGYRAGTTIPGLKVEPSVPGHRARTKEGPLVPVGVTNR |
Ga0182206_10654232 | 3300017433 | Miscanthus Phyllosphere | MDLLSRAVTVFSPGYHAGTTIPGLKVPPLVPGHRAGTKEEPLVPVGVTN |
Ga0182206_11391721 | 3300017433 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRTGTTIPGLKVEPSVPGHRAGIKEGPLVPVG |
Ga0182191_10300561 | 3300017438 | Miscanthus Phyllosphere | MDGVIYNMHYYRMDLLSRTVTAFSPGYRAGTMIPGLKVPPLVPGYRARTKEGPLVPIDVTNRE |
Ga0182191_10531753 | 3300017438 | Miscanthus Phyllosphere | MRGIYHLQDNNHYYTMDLLSRAVMAFSPGYRAGTTIPGLKVPPLVPGHRAGTKEGPLV |
Ga0182191_10785871 | 3300017438 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKEGPLVPVGVTNRD |
Ga0182221_10279221 | 3300017442 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYCAGTTIPGLKVEPSVPGHRAGIKEGPLVPVGNTN |
Ga0182221_10361461 | 3300017442 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGITIPGLKVEPSVSGHRAGTKEGPSLQPSK |
Ga0182221_10481301 | 3300017442 | Miscanthus Phyllosphere | MALLSRAVTAFSPSYRAETTIPGLKVEPSVLDHRAGTKEGPLVPVGVI |
Ga0182221_10863451 | 3300017442 | Miscanthus Phyllosphere | MAFSPGYRAGTTIPGLKVEPSVPGHRAGTKEGPLVP |
Ga0182221_10939801 | 3300017442 | Miscanthus Phyllosphere | MALLSRAVTAFSPGYRAETMIPGLKVEPSVPGHRAGTKEGPLVPVGV |
Ga0182221_11031021 | 3300017442 | Miscanthus Phyllosphere | MDLLSRTVTAFSPGYRAGTTIPGLKVEPSVPGHRAGIKEGPLVPV |
Ga0182221_11044991 | 3300017442 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKEGPLVPVGNT |
Ga0182221_11263312 | 3300017442 | Miscanthus Phyllosphere | MDLLSRTVTVFSPGYRVGTTIPGLKVEPSVPGHRAGTKEGPLVPVGVTN |
Ga0182193_10300952 | 3300017443 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKEGPLVPVGVRCY |
Ga0182193_10587321 | 3300017443 | Miscanthus Phyllosphere | MLFLILLHYYRMDLLSQAVTAFSPGYRAETTIPGLKVPPLVPGHRAGTKEGPLVPVGVTNQD |
Ga0182193_11117851 | 3300017443 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTTIPELKVEPSVPVHRAGTKEGPL |
Ga0182193_11330371 | 3300017443 | Miscanthus Phyllosphere | MDLLSRTVTAFTPSYHAGTTIPELKVEPSVPGHRAGIKEGPLVP |
Ga0182193_11913331 | 3300017443 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTMIPRLKVPALVLGHRAGTKEGPLVP |
Ga0182218_10145101 | 3300017683 | Miscanthus Phyllosphere | HYYRMDLLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGIKERPLVLVGNTNRD |
Ga0182218_10423911 | 3300017683 | Miscanthus Phyllosphere | MDLLSRTVTAFSSGYRAGTTTPGLKVEPSVPGHRARTKEGP |
Ga0182218_11033261 | 3300017683 | Miscanthus Phyllosphere | MDLLSRPVTAFSPGYRAGTTIPGLKVEPSVPGHRAGIKEGPLVPV |
Ga0182225_10309632 | 3300017684 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRTGTMISGLKVEPSIPGHRAGNEEGPLVPVRVTNRD |
Ga0182225_10740481 | 3300017684 | Miscanthus Phyllosphere | MILLARVVTVFSPGYHAGTMIPELKVEPSISGHRAGTKEGPLVPVGVTNRD |
Ga0182225_10816711 | 3300017684 | Miscanthus Phyllosphere | SASAHYYTMDLLSRVVTAFSSGYRAETTILGLKVPPLVPGHQAGTKEGPLVPGGNTNRD |
Ga0182225_11235101 | 3300017684 | Miscanthus Phyllosphere | MCHYYRMDLLSRAVTTFSPGYRAGTTILELKVEPSVPGHRAGTKEGPLVPVGVTNR |
Ga0182205_10151051 | 3300017686 | Miscanthus Phyllosphere | MDLLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKEGPLVPVD |
Ga0182205_10822391 | 3300017686 | Miscanthus Phyllosphere | MALLFRAVTAFSPGYRARTTIPGLKMEPSVPDHRARIKEGPLVPVGVTN |
Ga0182223_10087751 | 3300017690 | Miscanthus Phyllosphere | VEAKNALQQTTYHYYTMDLLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKEGPLVPVGVTNR |
Ga0182223_10478031 | 3300017690 | Miscanthus Phyllosphere | MDLVSRTVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKEGPLVPV |
Ga0182223_10752291 | 3300017690 | Miscanthus Phyllosphere | LWLVHYYRMDLLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKKGPLVPV |
Ga0182223_10852941 | 3300017690 | Miscanthus Phyllosphere | MALLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGTKEGPLVSVGVTNRDKRPSSRANV |
Ga0207659_117409521 | 3300025926 | Miscanthus Rhizosphere | HYYRMDLLSRAVTAFSPGYRAGTTIPGLKVEPSVPGHRAGIKEGPLVPVGNTNRD |
Ga0207704_100555153 | 3300025938 | Miscanthus Rhizosphere | VTAFSPGYRAGTTIPGLKVEPSVPGHRAGIKEGPLVPVGNTNRD |
Ga0207683_100554525 | 3300026121 | Miscanthus Rhizosphere | RAVTAFSLGYRAGTTIPGLKVEPSVPGHRARTKEGPLVPVGVTNRD |
⦗Top⦘ |