| Basic Information | |
|---|---|
| Family ID | F052262 |
| Family Type | Metagenome |
| Number of Sequences | 143 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKTSYLSYLIELLQSDEWRGVSKNIDIAKGKYKIPKTWTEFLKRR |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 9.79 % |
| % of genes near scaffold ends (potentially truncated) | 34.27 % |
| % of genes from short scaffolds (< 2000 bps) | 60.84 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.734 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (20.280 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.469 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (44.755 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.14% β-sheet: 0.00% Coil/Unstructured: 69.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF14550 | Peptidase_S78_2 | 11.19 |
| PF04466 | Terminase_3 | 2.10 |
| PF07460 | NUMOD3 | 0.70 |
| PF00145 | DNA_methylase | 0.70 |
| PF04860 | Phage_portal | 0.70 |
| PF09568 | RE_MjaI | 0.70 |
| PF00877 | NLPC_P60 | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 2.10 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.70 |
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.73 % |
| All Organisms | root | All Organisms | 34.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 20.28% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 8.39% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 7.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.29% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.59% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 5.59% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.59% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 4.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.50% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.50% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.10% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.10% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 2.10% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.40% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.40% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.40% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.40% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.40% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.70% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.70% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.70% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.70% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.70% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.70% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.70% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.70% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.70% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.70% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.70% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.70% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.70% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.70% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.70% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352018 | Saline water microbial communities from Qinghai Lake, Tibetan Plateau -Sample 11630 | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300000930 | Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16m | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005824 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.180_BBC | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020503 | Freshwater microbial communities from Lake Mendota, WI - 03MAY2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020525 | Freshwater microbial communities from Lake Mendota, WI - 05MAR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027192 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes) | Environmental | Open in IMG/M |
| 3300027216 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027278 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes) | Environmental | Open in IMG/M |
| 3300027416 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| QLA_00475350 | 2199352018 | Saline Water | MKPTYLSYLIELLQASDYRNVSETIDIAKGKNAIPRTWKEFLKRR |
| OpTDRAFT_100277013 | 3300000928 | Freshwater And Marine | MKTSYLSYLIELLQADSWKGVSHNVDIAKGKYQMPTTWTEFLKRR* |
| OpTDRAFT_100397592 | 3300000928 | Freshwater And Marine | MKTSYLSYLIELLQSDQWKGVSHNIDIAKGKYRIPKTWTEFLKRR* |
| BpDRAFT_104023031 | 3300000930 | Freshwater And Marine | MKTSYLSYLIELLQSDQWKGVSHNIDIAKGKYKIPK |
| BBAY92_100028063 | 3300000947 | Macroalgal Surface | MKTSYLSYLIELLQADRWKGVSHNVDIAKGKYQMPTTWTEFLKRR* |
| JGI24006J15134_100095755 | 3300001450 | Marine | MKNTYLSYLIELLQSDEWKGVSDTVEIAKGKYQIPKNWTEFIKSR* |
| GOS2243_10028782 | 3300001965 | Marine | MKKSYLSYLIELLQADEWRGESENIEIAKGKYRIPNNWSEFL |
| KVRMV2_1000473463 | 3300002231 | Marine Sediment | MKNSYLSYLIELLQSDEWKGISHNVEIAKGKYKIPKTWNEFLKRR* |
| B570J40625_1000919754 | 3300002835 | Freshwater | MKPTYLSYLIELLQASDYRNVSDTIDIAKGKNAIPRTWKEFLNRR* |
| B570J40625_1002600141 | 3300002835 | Freshwater | QRSMKTGYLSYLIELLQLEEWRKESEAIDIAKGKYAIPKTWDEFLKRR* |
| B570J40625_1004059972 | 3300002835 | Freshwater | MKTGYLSYLIELLQLEEWRKESEAIDIAKGKYAIPKTWDEFLKRR* |
| JGI25908J49247_100191212 | 3300003277 | Freshwater Lake | MKPTYLSYLIELLQASDYRNVSDTIDIAKGKNAIPRTWKEFLKRR* |
| Ga0069718_163484975 | 3300004481 | Sediment | MKPTYLGYLIELLQASEYRKTSDAIDIAKGKNAIPRTWKEFLNRR* |
| Ga0078894_109515192 | 3300005662 | Freshwater Lake | MKPSYLGYLIELLQVDDWRKQSEAIDIAKGKYAIPKTWDEFLKRR* |
| Ga0079957_10098902 | 3300005805 | Lake | MKPTYLSYLIELLQASDYRNVSETIDIAKGKNAIPRTWKEFLKRR* |
| Ga0074474_14371201 | 3300005824 | Sediment (Intertidal) | IELLQSDQWKGVSHNIDIAKGKYRIPKTWTEFLKRR* |
| Ga0074474_15408243 | 3300005824 | Sediment (Intertidal) | MKTSYLSYLIELLQSDQWKGVSHNIDIAKGKYKIPKTWTEFLKRR* |
| Ga0070743_100022432 | 3300005941 | Estuarine | MKTSYLSYLIELLQTDEWKGKSHNIDIAKGKYRMPKSWTEFLKRR* |
| Ga0075461_100705791 | 3300006637 | Aqueous | RCMKTSYLSYLIELLQSDEWKGKSHNIDIAKGKYRIPKTWTEFLKRR* |
| Ga0075461_100784232 | 3300006637 | Aqueous | MKPSYLSYLIELLQLDEWRKQSEAIDIAKGKYAIPKTWDEFLKRR* |
| Ga0079301_10042962 | 3300006639 | Deep Subsurface | MKPSYLSYLIELLQASEYRKVSEHIDIAKGKYAIPRTWKEFLNRR* |
| Ga0098073_10171452 | 3300006734 | Marine | MKTSYLSYLIELLQSDEWKGKSHNIDIAKGKYKIP |
| Ga0098048_10062162 | 3300006752 | Marine | MKKSYLSYLIELLQADEWRGESENIEIAKGKYRIPNNWSEFLKRR* |
| Ga0070749_100056295 | 3300006802 | Aqueous | MKPTYLGYLIELLQASEYRKVSKNIDIAKGKYAIPRTWKEFLNRR* |
| Ga0070749_100190275 | 3300006802 | Aqueous | MKPSYLSYLIELLQLDEWRKQSEAIDIAKGKYAIPKTWDEFLK |
| Ga0070749_100610082 | 3300006802 | Aqueous | MKTSYLSYLIELLQSDEWKGKSHNIDIAKGKYRIPKTWTEFLKRR* |
| Ga0070749_100872342 | 3300006802 | Aqueous | MKTSYLSYLIELLQSDEWRGVSQNVDIAKGKYRIPKTWTELLKGR* |
| Ga0070749_103182002 | 3300006802 | Aqueous | MKTSYLSYLIELLQSDEWRGVSKNIDIAKGKYKIPKTWTEFLKRR* |
| Ga0070754_102745511 | 3300006810 | Aqueous | CMKTSYLSYLIELLQTDEWKGKSHNIDIAKGKYKIPQTWTEFLKRR* |
| Ga0075476_100284402 | 3300006867 | Aqueous | MKTSYLSYLIELLQSDEWKGKSHNIDIAKGKYKIPQTWTEFLKRR* |
| Ga0075477_102241612 | 3300006869 | Aqueous | MKTSYLSYLIELLQSDEWKGKSQNIDIAKGKYRMPQTWTEFLK |
| Ga0070748_13198112 | 3300006920 | Aqueous | MKKSYLSYLIELLQADDWKGESEYIDIAKGKYKIPKNWNDFIKGR* |
| Ga0098051_10414132 | 3300006924 | Marine | YLIELLQADEWRGESENIEIAKGKYRIPNNWSEFLKRR* |
| Ga0075463_100969672 | 3300007236 | Aqueous | GITQRCMKTSYLSYLIELLQSDDWKGVSHNIDIAKGKYRMPQTWTEFLKRR* |
| Ga0070745_100191911 | 3300007344 | Aqueous | MKTSYLSYLIELLQANDWRGVSKNVDIAKGKYQLPTSWTEYFKRR* |
| Ga0070745_10363911 | 3300007344 | Aqueous | CQYDNGQGSPPTPQRCMKTSYLSYLIELLQSDQWKGVSHNIDIAKGKYIIPKTWTEFLKRR* |
| Ga0070753_11472632 | 3300007346 | Aqueous | MKTSYLSYLIELLQSDEWKGVSHNVDIAKGKYKTPKTWTEFLKRR* |
| Ga0099847_11816872 | 3300007540 | Aqueous | MKQGYLSYLIELLQVDDWRNESEAIDIAKGKYAIPKTWDEFLKRR* |
| Ga0099846_10151832 | 3300007542 | Aqueous | MKTSYLSYLIELLQSDDWKGVSHNIDIAKGKYRMPQTWTEFLKRR* |
| Ga0099846_12220541 | 3300007542 | Aqueous | MKQGYLSYLIELLQVDDWRNESEAIDIAKGKYAIPKTWDEFLK |
| Ga0102820_10138771 | 3300007554 | Estuarine | ITQRCMKTSYLSYLIELLQADSWKGVSHNVDIAKGKYQMPTTWTEFLKRR* |
| Ga0070751_11813892 | 3300007640 | Aqueous | MKTSYLSYLIELLQSDEWKGVSHNVDIAKGKYKIPQTWTEFLKRR* |
| Ga0114363_10630013 | 3300008266 | Freshwater, Plankton | MKPSYLGYLIELLQLDEWRNESEAIDIAKGKHAIPKTWDEFLKRR* |
| Ga0114363_12289472 | 3300008266 | Freshwater, Plankton | MKPSYLGYLIELLQVDDWRNQSEAIDIAKGKYAIPKTWDEFLKRR* |
| Ga0114364_10044337 | 3300008267 | Freshwater, Plankton | MKTSYLSYLIELLQLQEWRNESEAIDIAKGKYAIPKTWNEFLKRR* |
| Ga0114880_10038953 | 3300008450 | Freshwater Lake | MKPSYLGYLIELLQLDEWRNESEAIDMAKGKHAIPKTWDEFLKRR* |
| Ga0114880_10357032 | 3300008450 | Freshwater Lake | MKPTYLGYLIELLQASEYRKVSEHIDIAKGKYAIPRTWKEFLNRR* |
| Ga0105093_106946282 | 3300009037 | Freshwater Sediment | MKQTYLGYLIELLQVNEWRKQSEAIDIAKGKYAIPKTWDEFLKRR* |
| Ga0105099_103801642 | 3300009082 | Freshwater Sediment | YLGYLIELLQVNEWRKQSEAIDIAKGKYAIPKTWDEFLKRR* |
| Ga0105099_106125442 | 3300009082 | Freshwater Sediment | MKPSYLGYLIELLQASEYRNAPETIEIAKGKYAIPKTWQEFLKRRRWP* |
| Ga0105099_108200612 | 3300009082 | Freshwater Sediment | YLIELLQVSEWRKESEAIDIAKGKYAIPKTWDEFLKRR* |
| Ga0105103_101541332 | 3300009085 | Freshwater Sediment | MKTSYLSYLIELLQLEEWRKESEAIDIAKGKYAIPKTWDEFLKRR* |
| Ga0114918_100412153 | 3300009149 | Deep Subsurface | MKTSYLSYLIELLQADRWKGVSHNVDIAKGKYEMPTTWTEFLKRR* |
| Ga0114918_100880563 | 3300009149 | Deep Subsurface | RLPTTQRCMKTSYLGYLIELLQADRWKGVSHNIDIAKGKYKIPKTWTELLKRR* |
| Ga0114918_103280312 | 3300009149 | Deep Subsurface | MKTSYLGYLIELLQSDEWKGVSYNIDIAKGKYKIPKTWTEFLKRR* |
| Ga0114918_106921132 | 3300009149 | Deep Subsurface | MKKSYLGYLIELLQSDEWRGVSDNIDIAKGKYKIPKTWTEFLKRR* |
| Ga0105102_100185722 | 3300009165 | Freshwater Sediment | MKPSYLGYLIELLQVSEWRKESEAIDIAKGKYAIPKTWDEFLKRR* |
| Ga0105102_100378311 | 3300009165 | Freshwater Sediment | MKPSYLSYLIELLQASEYRKVSEHIDIAKGKYAIPRTWKEFLNR |
| Ga0105104_100905091 | 3300009168 | Freshwater Sediment | RSMKPSYLSYLIELLQASEYRKVSEHIDIAKGKYAIPRTWKEFLNRR* |
| Ga0105097_105750651 | 3300009169 | Freshwater Sediment | LLQVSEWRKESEAIDIAKGKYAIPKTWDEFLKRR* |
| Ga0126448_10082982 | 3300009466 | Meromictic Pond | MKPTYLGYLIELLQASEYRKVSNNIDIAKGKYAIPRTWKEFLNRR* |
| Ga0114932_100685684 | 3300009481 | Deep Subsurface | MKNSYLSYLIELLQSDEWKGVSHNVEIAKGKYKIPQTWNEFLKRR* |
| Ga0098043_10337252 | 3300010148 | Marine | MKNSYLSYLIELLQSDEWKGVSHDVEIAKGKYKIPQTWNEFLKRR* |
| Ga0129333_105063502 | 3300010354 | Freshwater To Marine Saline Gradient | MKPSYLGYLIELLQASEYRKVSNNIDIAKGKYAIPRTWKEFLNRR* |
| Ga0114922_100440932 | 3300011118 | Deep Subsurface | MKKSYLSYLIELLQADDWRGESENIDIAKGKCKIPNNWSEFLKRR* |
| Ga0114922_100875502 | 3300011118 | Deep Subsurface | MKKTYLSYLIELLQADDWKGESEYIDIAKGKNKIPKNWSEFLKRR* |
| Ga0164293_105639752 | 3300013004 | Freshwater | MKPTYLGYLIELLQASEYRKTSEAIDIAKGKNAIPRTWKEFLNRR* |
| (restricted) Ga0172365_103926062 | 3300013127 | Sediment | MKPSYLGYLIELLQASEYRKVSDAIDIAKGKKAIPRTWKEFLNRR* |
| (restricted) Ga0172376_103644331 | 3300014720 | Freshwater | YLIELLQASEYRKVSDAIDIAKGKNAIPRTWKEFLNRR* |
| Ga0181369_11312822 | 3300017708 | Marine | MKKSYLSYLIELLQADEWRGESENIEIAKGKYIIPNNWSEFLKRR |
| Ga0181391_100083814 | 3300017713 | Seawater | MKNSYLSYLIELLQSDEWKGISHDVEIAKGKYKIPQTWNEFLKRR |
| Ga0181352_10873512 | 3300017747 | Freshwater Lake | MKPSYLGYLIELLQLDEWRNESEAIDIAKGKHAIPKTW |
| Ga0181344_10947761 | 3300017754 | Freshwater Lake | MKPSYLGYLIELLQVDDWRKQSEAIDIAKGKYAIPKTW |
| Ga0181344_11692481 | 3300017754 | Freshwater Lake | RSMKPSYLGYLIELLQVDDWRKQSEAIDIAKGKYAIPKTWDEFLKRR |
| Ga0181343_10889862 | 3300017766 | Freshwater Lake | MKQTYLGYLIELLQVDDWRKQSEAIDIAKGKYAIPKTWDEFLKRR |
| Ga0181361_1049122 | 3300019783 | Freshwater Lake | ESMKPTYLSYLIELLQASDYRNVSDTIDIAKGKNAIPRTWKEFLKRR |
| Ga0181359_10208303 | 3300019784 | Freshwater Lake | MKPTYLSYLIELLQASDYRNVSDTIDIAKGKNAIPRTWKEFLKRR |
| Ga0211676_101556002 | 3300020463 | Marine | MKNSYLSYLIELLQSDEWKGVSHNVEIAKGKYKIPQTWNEFLKRR |
| Ga0208363_10160162 | 3300020503 | Freshwater | MKTGYLSYLIELLQLEEWRKESEAIDIAKGKYAIPKTWDEFLKRR |
| Ga0207938_10042752 | 3300020525 | Freshwater | MKPTYLSYLIELLQASDYRNVSQAIDIAKGKNAIPRTWKEFLNRR |
| Ga0213862_101749472 | 3300021347 | Seawater | MKNSYLSYLIELLQSDEWKGVSHDVEIAKGKYKIPQTWNEFLKRR |
| Ga0213862_103222092 | 3300021347 | Seawater | MKKSYLSYLIELLQADDWKGESEYIDIAKGKYKIPKNWNDFIKGR |
| Ga0222718_100076087 | 3300021958 | Estuarine Water | MKTSYLSYLIELLQSDEWRGVSQNVDIAKGKYRIPKTWTELLKGR |
| Ga0222718_100913342 | 3300021958 | Estuarine Water | MKTSYLSYLIELLQASDWRGVSKNVDIAKGKYQLPSSWTEYLKRR |
| Ga0222714_100100406 | 3300021961 | Estuarine Water | MKTSYLSYLIELLQADSWKGVSHNVDIAKGKYQMPTTWTEFLKRR |
| Ga0222714_100115455 | 3300021961 | Estuarine Water | MKTSYLSYLIELLQSDQWKGVSHNIDIAKGKYKIPKTWTEFLKRR |
| Ga0222714_101317982 | 3300021961 | Estuarine Water | MKTSYLSYLIELLQSDEWRGVSKNIDIAKGKYKIPKTWTEFLKRR |
| Ga0222713_100425551 | 3300021962 | Estuarine Water | QPPTPQRCMKTSYLSYLIELLQSDQWKGVSHNIDIAKGKYKIPKTWTEFLKRR |
| Ga0222713_101278262 | 3300021962 | Estuarine Water | MKTSYLSYLIELLQLQEWRNESEAIDIAKGKYAIPKTWNEFLKRR |
| Ga0222712_100053622 | 3300021963 | Estuarine Water | MKPSYLGYLIELLQLDEWRNQSEAIDIAKGKYAIPKTWDEFLKRR |
| Ga0212025_10021033 | 3300022057 | Aqueous | MKTSYLSYLIELLQSDEWKGKSHNIDIAKGKYKIPQTWTEFLKRR |
| Ga0224495_102434052 | 3300022208 | Sediment | MKTSYLSYLIELLQSDEWRGVSRNIDIAKGKHKIPKTW |
| Ga0210003_10197563 | 3300024262 | Deep Subsurface | MKTSYLSYLIELLQADRWKGVSHNVDIAKGKYEMPTTWTEFLKRR |
| Ga0244775_100112842 | 3300024346 | Estuarine | MKTSYLSYLIELLQTDEWKGKSHNIDIAKGKYRMPKSWTEFLKRR |
| Ga0244776_100329231 | 3300024348 | Estuarine | IELLQSDQWKGVSHNIDIAKGKYRIPKTWTEFLKRR |
| Ga0208667_10010243 | 3300025070 | Marine | MKKSYLSYLIELLQADEWRGESENIEIAKGKYRIPNNWSEFLKRR |
| Ga0208298_10968102 | 3300025084 | Marine | LIELLQADEWRGESENIEIAKGKYRIPNNWSEFLKRR |
| Ga0208004_10382401 | 3300025630 | Aqueous | MKTSYLSYLIELLQSDEWKGKSHNIDIAKGKYRIPKTWTEFLKRR |
| Ga0208004_11249092 | 3300025630 | Aqueous | MKPSYLSYLIELLQLDEWRKQSEAIDIAKGKYAIPKTWDEFLKRR |
| Ga0208795_10329432 | 3300025655 | Aqueous | YDNGQGSPPTPQRCMKTSYLSYLIELLQSDQWRGVSHNIDIAKGKYKIPKTWTEFLKRR |
| Ga0208898_10072905 | 3300025671 | Aqueous | MKTSYLSYLIELLQSDTWKGKSPNIDIAKGKYRMPQSWTEFLKRR |
| Ga0208898_10136212 | 3300025671 | Aqueous | MKTSYLSYLIELLQANDWRGVSKNVDIAKGKYQLPTSWTEYFKRR |
| Ga0208899_10294392 | 3300025759 | Aqueous | MKTSYLSYLIELLQSDDWKGVSHNIDIAKGKYRMPQTWTEFLKRR |
| Ga0208542_10590142 | 3300025818 | Aqueous | MKPTYLGYLIELLQASEYRKVSKNIDIAKGKYAIPRTWKEFLNRR |
| Ga0208673_10166112 | 3300027192 | Estuarine | MKTSYLSYLIELLQSDEWKGAGENVEIAKGRHKLPTNWK |
| Ga0208677_10437491 | 3300027216 | Estuarine | MKTSYLSYLIELLQSDQWKGVSHNIDIAKGKYRIPKTWTEF |
| Ga0208439_10765202 | 3300027278 | Estuarine | LSYLIELLQTDEWKGKSHNIDIAKGKYRMPKSWTEFLKRR |
| Ga0207994_10607851 | 3300027416 | Estuarine | MKTSYLSYLIELLQSNQWKGVSHNIDIAKGKYRIPKTWTEFLKRR |
| Ga0209704_10549992 | 3300027693 | Freshwater Sediment | MKPSYLGYLIELLQVSEWRKESEAIDIAKGKYAIPKTWDEFLKRR |
| Ga0209287_100390202 | 3300027792 | Freshwater Sediment | MKQTYLGYLIELLQVNEWRKQSEAIDIAKGKYAIPKTWDEFLKRR |
| Ga0209287_102719972 | 3300027792 | Freshwater Sediment | MKQTYLGYLIELLQVDDWRKQSEAIDIAKGKYAIPKTWDEFL |
| Ga0209635_107835912 | 3300027888 | Marine Sediment | MKTSYLSYLIELLQSDEWKGVSHNVDIAKGKYKIPQTWTEFLKRR |
| Ga0209536_1028316662 | 3300027917 | Marine Sediment | LSTHQRSMKPSYLSYLIELLQLDEWRKQSEAIDIAKGKYAIPKTWDEFLKRR |
| Ga0256382_10376402 | 3300028022 | Seawater | MKNSYLSYLIELLQSDEWKGISHNVEIAKGKYKIPKTWNEFLKRR |
| Ga0307488_102225042 | 3300031519 | Sackhole Brine | MKKSYLSYLIELLQADDWKGESECIDIAKGKYKIPKNWNDFIKGR |
| Ga0307380_102464522 | 3300031539 | Soil | MKKSYLGYLIELLQSDEWRGVSDNIDIAKGKYKIPKTWTEFLKRR |
| Ga0307380_102786712 | 3300031539 | Soil | MKQGYLSYLIELLQLDEWRNESEAIDIAKGKHAIPKTWDEFLKRR |
| Ga0307380_103028732 | 3300031539 | Soil | MKPSYLGYLIELLQASEYRKVSDAIDIAKGKNAIPRTWKEFLNRR |
| Ga0307380_104140721 | 3300031539 | Soil | YLIELLQLDEWRNESEAIDIAKGKHAIPKTWDEFLKRR |
| Ga0307379_101792682 | 3300031565 | Soil | MKTSYLSYLIELLQSDEWKGKSQNIDIAKGKYRMPQTWTEFLKRR |
| Ga0307379_108262992 | 3300031565 | Soil | MKPSYLGYLIELLQASEYRKTSEAIDIAKGKNAIPRTWKEFLNRR |
| Ga0307376_101111501 | 3300031578 | Soil | CQCQYDYGQGSPPTTQRCMKTSYLGYLIELLQADRWKGVSHNIDIAKGKYKIPKTWTELLKRR |
| Ga0307376_106875362 | 3300031578 | Soil | MKQGYLSYLIELLQVDEWRNESEAIDIAKGKYAIPKTWDEFLKRR |
| Ga0307375_101493092 | 3300031669 | Soil | IELLQLDEWRNESEAIDIAKGKHAIPKTWDEFLKRR |
| Ga0307377_100942152 | 3300031673 | Soil | MKQGYLGYLIELLQVDEWRNESEAIDIAKGKYAIPKTWDEFLKRR |
| Ga0307377_101944212 | 3300031673 | Soil | MKTSYLGYLIELLQAERWKGVSHNIDIAKGKYKIPKTWTELLKRR |
| Ga0315909_1000546022 | 3300031857 | Freshwater | MKPSYLGYLIELLQLDEWRNESEAIDMAKGKHAIPKTWDEFLKRR |
| Ga0315909_100891462 | 3300031857 | Freshwater | MKPTYLGYLIELLQASEYRKTSEAIDIAKGKNAIPRTWKEFLNRR |
| Ga0315909_102271622 | 3300031857 | Freshwater | MKPSYLGYLIELLQVDDWRNQSEAIDIAKGKYAIPKTWDEFLKRR |
| Ga0315909_106994461 | 3300031857 | Freshwater | MKPTYLGYLIELLQASEYRKVSEHIDIAKGKYAIPRTW |
| Ga0315904_102696662 | 3300031951 | Freshwater | MKPSYLGYLIELLQLDEWRSESEAIDIAKGKHAIPKTWDEFLKRR |
| Ga0316616_1032071802 | 3300033521 | Soil | IRTPERSMKPSYLGYLIELLQLDEWRNESEAIDIAKGKHAIPKTWDEFLKRR |
| Ga0334994_0022147_4094_4204 | 3300033993 | Freshwater | IELLQLEEWRKESEAIDIAKGKYAIPKTWDEFLKRR |
| Ga0334994_0213950_889_1029 | 3300033993 | Freshwater | MKTGYLSYLIELLQLEEWRKESEAIDIAKGKYAIPKTWDEFLKIRR |
| Ga0334983_0775029_380_502 | 3300034060 | Freshwater | MKPTYLSYLIELLQASDYRNVSDTIDIAKGKNAIPRTWKEF |
| Ga0334995_0126044_1_123 | 3300034062 | Freshwater | MKTGYLSYLIELLQLEEWRKESEAIDIAKGKYAIPKTWDEF |
| Ga0334995_0536962_1_123 | 3300034062 | Freshwater | SYLIELLQLEEWRKESEAIDIAKGKYAIPKTWDEFLKIRR |
| Ga0310130_0000499_10344_10490 | 3300034073 | Fracking Water | MKPSYLGYLIELLQASEYRNAPETIEIAKGKYAIPKTWQEFLKRRRWP |
| Ga0310130_0001758_10235_10372 | 3300034073 | Fracking Water | MKPTYLGYLIELLQASEYRKVSDNIDIAKGKYAIPRTWKEFLNRR |
| Ga0335036_0008599_4383_4520 | 3300034106 | Freshwater | MKPTYLSYLIELLQASDYRNLSETIDIAKGKNAIPRTWKEFLKRR |
| Ga0335048_0497387_2_130 | 3300034356 | Freshwater | TYLSYLIELLQASDYRNVSDTIDIAKGKNAIPRTWKEFLKRR |
| Ga0348335_110553_704_838 | 3300034374 | Aqueous | KTSYLSYLIELLQSDDWKGVSHNIDIAKGKYRMPQTWTEFLKRR |
| Ga0348337_127967_2_112 | 3300034418 | Aqueous | IELLQSDNWKGVSHNIDIAKGKYRMPQTWTEFLKRR |
| ⦗Top⦘ |