| Basic Information | |
|---|---|
| Family ID | F052225 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 143 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LYAGILLNPGDLLEIEFDTPTPSRLPAIVRSRNGFCFGLEFITPLPA |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 17.48 % |
| % of genes near scaffold ends (potentially truncated) | 83.92 % |
| % of genes from short scaffolds (< 2000 bps) | 73.43 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.804 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.287 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.671 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.839 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 30.67% Coil/Unstructured: 69.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF00753 | Lactamase_B | 58.74 |
| PF03976 | PPK2 | 7.69 |
| PF00282 | Pyridoxal_deC | 2.80 |
| PF07995 | GSDH | 2.80 |
| PF13507 | GATase_5 | 1.40 |
| PF07238 | PilZ | 1.40 |
| PF01850 | PIN | 1.40 |
| PF00691 | OmpA | 1.40 |
| PF06114 | Peptidase_M78 | 0.70 |
| PF14525 | AraC_binding_2 | 0.70 |
| PF09339 | HTH_IclR | 0.70 |
| PF13450 | NAD_binding_8 | 0.70 |
| PF07642 | BBP2 | 0.70 |
| PF01980 | TrmO | 0.70 |
| PF00665 | rve | 0.70 |
| PF13247 | Fer4_11 | 0.70 |
| PF03459 | TOBE | 0.70 |
| PF00535 | Glycos_transf_2 | 0.70 |
| PF02646 | RmuC | 0.70 |
| PF09364 | XFP_N | 0.70 |
| PF00581 | Rhodanese | 0.70 |
| PF16177 | ACAS_N | 0.70 |
| PF04536 | TPM_phosphatase | 0.70 |
| PF00196 | GerE | 0.70 |
| PF05193 | Peptidase_M16_C | 0.70 |
| PF02585 | PIG-L | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 7.69 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 2.80 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 2.80 |
| COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 0.70 |
| COG1720 | tRNA (Thr-GGU) A37 N6-methylase | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.70 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.70 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.70 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.70 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.80 % |
| Unclassified | root | N/A | 4.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10012234 | All Organisms → cellular organisms → Bacteria | 5632 | Open in IMG/M |
| 3300000955|JGI1027J12803_103857368 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300001546|JGI12659J15293_10102437 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300001593|JGI12635J15846_10086259 | Not Available | 2284 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100112606 | All Organisms → cellular organisms → Bacteria | 2556 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100509235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1081 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100736633 | Not Available | 865 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101195460 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300002917|JGI25616J43925_10096606 | Not Available | 1223 | Open in IMG/M |
| 3300004081|Ga0063454_101056742 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300004152|Ga0062386_100065402 | Not Available | 2756 | Open in IMG/M |
| 3300005177|Ga0066690_10500658 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300005436|Ga0070713_100712392 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300005436|Ga0070713_102074914 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005445|Ga0070708_100000808 | All Organisms → cellular organisms → Bacteria | 23605 | Open in IMG/M |
| 3300005541|Ga0070733_10660109 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300005591|Ga0070761_10022217 | All Organisms → cellular organisms → Bacteria | 3535 | Open in IMG/M |
| 3300005602|Ga0070762_10495393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300005764|Ga0066903_107204147 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005921|Ga0070766_10279553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300006028|Ga0070717_10014592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6049 | Open in IMG/M |
| 3300006052|Ga0075029_100949085 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006059|Ga0075017_100085928 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
| 3300006059|Ga0075017_100097971 | All Organisms → cellular organisms → Bacteria | 2039 | Open in IMG/M |
| 3300006059|Ga0075017_100279303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1228 | Open in IMG/M |
| 3300006102|Ga0075015_100358152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300006162|Ga0075030_100007612 | All Organisms → cellular organisms → Bacteria | 9657 | Open in IMG/M |
| 3300006162|Ga0075030_100028284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4792 | Open in IMG/M |
| 3300006163|Ga0070715_10355657 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300006176|Ga0070765_100027754 | All Organisms → cellular organisms → Bacteria | 4354 | Open in IMG/M |
| 3300006176|Ga0070765_100873137 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300006806|Ga0079220_11176681 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300006893|Ga0073928_10168434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1749 | Open in IMG/M |
| 3300007258|Ga0099793_10578059 | Not Available | 562 | Open in IMG/M |
| 3300009174|Ga0105241_10785616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300009524|Ga0116225_1366804 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300009700|Ga0116217_10074778 | All Organisms → cellular organisms → Bacteria | 2368 | Open in IMG/M |
| 3300009826|Ga0123355_10016732 | All Organisms → cellular organisms → Bacteria | 11571 | Open in IMG/M |
| 3300010048|Ga0126373_12036160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300010358|Ga0126370_11159269 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300010358|Ga0126370_11816456 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300010361|Ga0126378_10100274 | All Organisms → cellular organisms → Bacteria | 2856 | Open in IMG/M |
| 3300010361|Ga0126378_10156249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2327 | Open in IMG/M |
| 3300010361|Ga0126378_13317285 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010376|Ga0126381_100038254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5797 | Open in IMG/M |
| 3300010376|Ga0126381_100098323 | All Organisms → cellular organisms → Bacteria | 3729 | Open in IMG/M |
| 3300010376|Ga0126381_104188387 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300010376|Ga0126381_104602077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300010379|Ga0136449_103488565 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300011270|Ga0137391_11312289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300012203|Ga0137399_10584734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
| 3300012210|Ga0137378_10067494 | All Organisms → cellular organisms → Bacteria | 3242 | Open in IMG/M |
| 3300012210|Ga0137378_11832454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300012361|Ga0137360_10815832 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012362|Ga0137361_10410782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1243 | Open in IMG/M |
| 3300012957|Ga0164303_11123740 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300012971|Ga0126369_11833094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300012977|Ga0134087_10767032 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300014199|Ga0181535_10864877 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300014199|Ga0181535_10865975 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300014655|Ga0181516_10096815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1489 | Open in IMG/M |
| 3300017932|Ga0187814_10265454 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300017961|Ga0187778_10465943 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300017970|Ga0187783_10585645 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300017973|Ga0187780_10690312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300017975|Ga0187782_10054944 | All Organisms → cellular organisms → Bacteria | 2898 | Open in IMG/M |
| 3300017975|Ga0187782_10415016 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300017975|Ga0187782_11397890 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300017975|Ga0187782_11631638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300017993|Ga0187823_10276304 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300018046|Ga0187851_10522492 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300018057|Ga0187858_10795025 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300018088|Ga0187771_10178084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1758 | Open in IMG/M |
| 3300018088|Ga0187771_10717014 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300018088|Ga0187771_11750425 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300018468|Ga0066662_10896081 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300020579|Ga0210407_10018256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5205 | Open in IMG/M |
| 3300020580|Ga0210403_10966500 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300020582|Ga0210395_10208539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1466 | Open in IMG/M |
| 3300020583|Ga0210401_11473627 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300021171|Ga0210405_10103450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2248 | Open in IMG/M |
| 3300021180|Ga0210396_10378306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1246 | Open in IMG/M |
| 3300021181|Ga0210388_11429694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300021401|Ga0210393_10015929 | All Organisms → cellular organisms → Bacteria | 5818 | Open in IMG/M |
| 3300021405|Ga0210387_10060836 | All Organisms → cellular organisms → Bacteria | 3065 | Open in IMG/M |
| 3300021405|Ga0210387_10700180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300021433|Ga0210391_10809543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300021474|Ga0210390_10106035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2348 | Open in IMG/M |
| 3300021475|Ga0210392_11447207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 514 | Open in IMG/M |
| 3300021477|Ga0210398_10203304 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300021478|Ga0210402_10061613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3298 | Open in IMG/M |
| 3300022724|Ga0242665_10155194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300024220|Ga0224568_1020258 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300025898|Ga0207692_10053125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2062 | Open in IMG/M |
| 3300025929|Ga0207664_10752272 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300025929|Ga0207664_11736772 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300025939|Ga0207665_10023162 | All Organisms → cellular organisms → Bacteria | 4090 | Open in IMG/M |
| 3300026359|Ga0257163_1081321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300027545|Ga0209008_1008658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2416 | Open in IMG/M |
| 3300027559|Ga0209222_1012726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1688 | Open in IMG/M |
| 3300027591|Ga0209733_1134587 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300027605|Ga0209329_1008745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1884 | Open in IMG/M |
| 3300027609|Ga0209221_1051695 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300027625|Ga0208044_1063883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1138 | Open in IMG/M |
| 3300027738|Ga0208989_10052888 | Not Available | 1403 | Open in IMG/M |
| 3300027821|Ga0209811_10226874 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300027824|Ga0209040_10117557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1479 | Open in IMG/M |
| 3300027842|Ga0209580_10170652 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300027846|Ga0209180_10105686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1607 | Open in IMG/M |
| 3300027867|Ga0209167_10189970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1091 | Open in IMG/M |
| 3300027874|Ga0209465_10213263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 964 | Open in IMG/M |
| 3300027889|Ga0209380_10043414 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
| 3300027898|Ga0209067_10239948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300027905|Ga0209415_10323976 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300027908|Ga0209006_10039159 | All Organisms → cellular organisms → Bacteria | 4281 | Open in IMG/M |
| 3300027908|Ga0209006_10081335 | All Organisms → cellular organisms → Bacteria | 2882 | Open in IMG/M |
| 3300027911|Ga0209698_10007455 | All Organisms → cellular organisms → Bacteria | 11481 | Open in IMG/M |
| 3300027911|Ga0209698_10167571 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
| 3300027986|Ga0209168_10000196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 68546 | Open in IMG/M |
| 3300030503|Ga0311370_10111162 | All Organisms → cellular organisms → Bacteria | 3853 | Open in IMG/M |
| 3300030707|Ga0310038_10213925 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300030761|Ga0265722_103290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300031234|Ga0302325_11423252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300031446|Ga0170820_12380853 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300031446|Ga0170820_15985033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300031446|Ga0170820_16354203 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300031474|Ga0170818_115552801 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300031545|Ga0318541_10239756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
| 3300031715|Ga0307476_10289207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1201 | Open in IMG/M |
| 3300031718|Ga0307474_10002760 | All Organisms → cellular organisms → Bacteria | 12630 | Open in IMG/M |
| 3300031754|Ga0307475_11422559 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031788|Ga0302319_10912969 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300031821|Ga0318567_10478254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300031910|Ga0306923_10821023 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300031962|Ga0307479_11863958 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300032160|Ga0311301_10025231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 16105 | Open in IMG/M |
| 3300032160|Ga0311301_12858145 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300032261|Ga0306920_101194128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1099 | Open in IMG/M |
| 3300032783|Ga0335079_10306056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1733 | Open in IMG/M |
| 3300032805|Ga0335078_10000066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 195786 | Open in IMG/M |
| 3300032898|Ga0335072_10296014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1818 | Open in IMG/M |
| 3300032898|Ga0335072_11379905 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300034130|Ga0370494_074658 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.29% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.99% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.20% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.80% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.10% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.40% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.40% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.40% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.40% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.40% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.70% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.70% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.70% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.70% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.70% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024220 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030761 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300034130 | Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100122346 | 3300000567 | Peatlands Soil | MVLYAGILLNPGDLLELEFDTPFHSRIPAIVRSRNGFCFGLEFIAPLPS* |
| JGI1027J12803_1038573681 | 3300000955 | Soil | AGILLNPGDLLEIEFDTPTHSRMTAIVRSKNGFCFGLEFITPLPS* |
| JGI12659J15293_101024372 | 3300001546 | Forest Soil | PGDLLEIEFETPTLSRLTAIVRSRNGFCFGLEFITPLPS* |
| JGI12635J15846_100862591 | 3300001593 | Forest Soil | YAGVLLNPGDLLEIEFDTAQHSRMTGIVRSRNGFCLGVEFLAPLPA* |
| JGIcombinedJ26739_1001126063 | 3300002245 | Forest Soil | GLLLKPGDLLEVEFGIPHRLRMMAIVRYRDGYCFGLEFTAPLPSQ* |
| JGIcombinedJ26739_1005092351 | 3300002245 | Forest Soil | PGDLLEVEFGIPHRLRMMAIVRYRDGYCFGLEFTAPLPSQ* |
| JGIcombinedJ26739_1007366332 | 3300002245 | Forest Soil | GGMLLYAGILLNPGDMLELEFSTPSQSRMTAVVRYRDGFCFGLEFIAPITA* |
| JGIcombinedJ26739_1011954602 | 3300002245 | Forest Soil | LSQGGMVLYAGALLNPGDVLEIQFDTACHSKMTAIVRSRDGFCFGLEFLAPLPT* |
| JGI25616J43925_100966061 | 3300002917 | Grasslands Soil | LYAGILLNPGDLLEVEFDTPTQSRMTAIVRSRNGFCFGLEFIAPLPS* |
| Ga0063454_1010567422 | 3300004081 | Soil | TEISQGGMVLYAGILLNPGDLLEVEFGMPTASRMTAIVRSRNGFCFGLEFITPLPS* |
| Ga0062386_1000654021 | 3300004152 | Bog Forest Soil | NPGDLLEIEFETPVPSRVPAIVRTRNGFCFGLEFIAPLPA* |
| Ga0066690_105006581 | 3300005177 | Soil | MVLYAGILLNPGDLLEIEFDMPTHSRMTAIVRSKTGFCFGLEFIAPLPA* |
| Ga0070713_1007123921 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | NPGDLLEVEFENPTPSRMPAIVRSKNGFCFGLEFITPLPS* |
| Ga0070713_1020749142 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | EGGMTLYAGILLNPGDLLEIEFDTPTHSRMPAIVRSKNGFCFGLEFITPLPS* |
| Ga0070708_1000008085 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEGGMLLYAGILLNPGDMLELEFSTPSHSRMKAVVRYRDGYCFGLEFIAPITA* |
| Ga0070733_106601091 | 3300005541 | Surface Soil | RGTELSQGGMTLYAGILLNPGDLLEIEFDTPTPSRMPAIVRSKNGFCFGLEFITPLPT* |
| Ga0070761_100222173 | 3300005591 | Soil | MVLYAGILLSPGDLLEVEFDTPSRSHLTAIVRSKNGFCFGLEFLAPLPD* |
| Ga0070762_104953932 | 3300005602 | Soil | MVLYAGVLLNPGDLLEIEFDTAQHSRMTGIVRSRNGFCLGVEFLAPLPA* |
| Ga0066903_1072041471 | 3300005764 | Tropical Forest Soil | LLNPGDLLEVEFDTPVHSRVPAIVRSKSGFCFGLEFITPLPS* |
| Ga0070766_102795532 | 3300005921 | Soil | GMVLYAGVLLNPGDLLEIEFETPVPSRVPAIVRSRSGFCFGLEFIAPLPA* |
| Ga0070717_100145921 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEGGMVLYAGILLNPGDLLEIEFDTPTPSRLPAIVRSRNGFCFGLEF |
| Ga0075029_1009490851 | 3300006052 | Watersheds | GDLLEIEFDTPVHSRMPAIVRSKNGFCFGLEFITPLPS* |
| Ga0075017_1000859283 | 3300006059 | Watersheds | MVLYAGILLNPGDLLEIEFDTPIHSRMPAIVRSRSGFCFGLEFITPLPA* |
| Ga0075017_1000979712 | 3300006059 | Watersheds | MVLYAGILLNPGDLLEIEFDTPVHSRMPAIVRSRSGFCFGLEFITPLPA* |
| Ga0075017_1002793031 | 3300006059 | Watersheds | LYAGVLLNPGDLLEIEFDTPVHSRVSAIVRSRNGFCFGLEFIAPLPA* |
| Ga0075015_1003581522 | 3300006102 | Watersheds | MSEGGMVLYAGILLNPGDLLEIEFDTPVHSRMPAIVRSRSGFCFGLEFITPLPA* |
| Ga0075030_1000076122 | 3300006162 | Watersheds | MVLYAGIMLNPGDLLEVEFEIPGRSRMIAVVRERSGYCFGVEFIAPLQTA* |
| Ga0075030_1000282841 | 3300006162 | Watersheds | AGILLNPGDLLEIEFDTPVNSRVPAIVRSRDGYCFGLEFISPLPA* |
| Ga0070715_103556571 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | DLLEIEFDTPTPSRLPAIVRSRNGFCFGLEFITPLPA* |
| Ga0070765_1000277545 | 3300006176 | Soil | GDLLEVEFDMPTPSRLPAIVRSRNGFCFGLEFITPLPA* |
| Ga0070765_1008731372 | 3300006176 | Soil | ELSEGGMVLYAGILLSPGDLLELEFDTPTHSRVPAIVRSRNGFCFGLEFIAPLPS* |
| Ga0079220_111766811 | 3300006806 | Agricultural Soil | DLLEVEFENPTPSRMPAIVRSKNGFCFGLEFITPLPS* |
| Ga0073928_101684341 | 3300006893 | Iron-Sulfur Acid Spring | GGMELYAGLWLKPGDLLEVEFGIPCRLRMMAVVRHRSGYCFGLEFIAPLQT* |
| Ga0099793_105780591 | 3300007258 | Vadose Zone Soil | MLLYAGILLNPGDMLELEFSTPSHSRMKAVVRYRDGYCFGLEFIAPITA* |
| Ga0105241_107856161 | 3300009174 | Corn Rhizosphere | NPGDLLEVEFDMPTASRMPAIVRSRNGFCFGLEFISPLPS* |
| Ga0116225_13668042 | 3300009524 | Peatlands Soil | GILLNPGDLLELEFDTPFHSRIPAIVRSRNGFCFGLEFIAPLPS* |
| Ga0116217_100747783 | 3300009700 | Peatlands Soil | SEGGMVLYAGILLNPGDLLEIEFDTPVLSRITAIVRSRNGFCFGLEFITPLPA* |
| Ga0123355_100167325 | 3300009826 | Termite Gut | MTLDAGILLHSGDRPELEFETATFAFVPAIARSPNGFCFGFEFITPLPA* |
| Ga0126373_120361601 | 3300010048 | Tropical Forest Soil | QGGMVLYAGILLNPGDLLEVEFDMPTPSRLPAIVRSRNGFCFGLEFITPLPA* |
| Ga0126370_111592692 | 3300010358 | Tropical Forest Soil | GDLLEVEFENPTPSRMPAIVRSKNGFCFGLEFITPLPS* |
| Ga0126370_118164562 | 3300010358 | Tropical Forest Soil | SQGGMMLYAGIMLNPGDLLEIEFDTPVNSKVPAIVRSRDGYCFGLEFITPLPS* |
| Ga0126378_101002741 | 3300010361 | Tropical Forest Soil | NPGDLLEVEFDTPTNSRLTAIVRSKSGFCFGLEFITPLPS* |
| Ga0126378_101562491 | 3300010361 | Tropical Forest Soil | ELSQGGMVLYAGILLNEGDLLEVEFEMPTLSRVPAIVRSRNGFCFGLEFITPLPA* |
| Ga0126378_133172852 | 3300010361 | Tropical Forest Soil | DLLEVEFDTPTHSRLTAIVRSKSGFCFGLEFITPLPS* |
| Ga0126381_1000382547 | 3300010376 | Tropical Forest Soil | MSEGGMTLYAGILLNPGDLLEVEFDFPRHSRVPAIVGSKSGFCFGPEFITLLPS* |
| Ga0126381_1000983235 | 3300010376 | Tropical Forest Soil | GDLLEVEFEMPTLSRVPAIVRSRNGFCFGLEFITPLPA* |
| Ga0126381_1041883871 | 3300010376 | Tropical Forest Soil | NPGDLLEVEFENPTPSRMPAIVRSKNGFCFRLEFITPLPS* |
| Ga0126381_1046020771 | 3300010376 | Tropical Forest Soil | NPGDLLEVEFDMPTPSRLPAIVRSRHGFCFGLEFITPLPS* |
| Ga0136449_1034885651 | 3300010379 | Peatlands Soil | EGGMVLYAGILLNPGDLLEIEFDTPAPSRLPAIVRFRSGFCFGLEFITPLPA* |
| Ga0137391_113122892 | 3300011270 | Vadose Zone Soil | DMLELEFNTPSHSRMTAVVRYRNGYCFGLEFVAPITT* |
| Ga0137399_105847341 | 3300012203 | Vadose Zone Soil | MVLYAGILLSPGDLLEIEFDMPTHSRMTAIVRSKTGFCFGLEFIAPLPA* |
| Ga0137378_100674941 | 3300012210 | Vadose Zone Soil | MVLYAGILLNPGDLLEIEIDTPSPSRLTAIVRSRNGFCFGLEFLT |
| Ga0137378_118324541 | 3300012210 | Vadose Zone Soil | ELSEGGMVLYAGILLNPGDLLEIEMDTPSPSRLTAIVRSRNGFCFGLEFLTPLPA* |
| Ga0137360_108158321 | 3300012361 | Vadose Zone Soil | ISEGGMVRYAGILLKPGDLLEIEFDMPTHSRMTAIVRSKTGFCFGLEFIAPLPA* |
| Ga0137361_104107822 | 3300012362 | Vadose Zone Soil | MSEGGMLLYAGILLNPGDMLELEFSTPSHSRMKAVVRYRDGYCFGLEFIAP |
| Ga0164303_111237401 | 3300012957 | Soil | LYAGILLNPGDLLEIEFDTPVHSRMPAIVRSKSGFCFGLEFITPLPS* |
| Ga0126369_118330941 | 3300012971 | Tropical Forest Soil | LNPGDLLEVEFENPTPSRMPAIVRSKNGFCFGLEFITPLPS* |
| Ga0134087_107670321 | 3300012977 | Grasslands Soil | LLEVEFDMPTSSRLPAIVRSRNGFCFGLEFISPLPS* |
| Ga0181535_108648772 | 3300014199 | Bog | EIEFDTPVPSRMPAIVRTRNGFCFGLEFITPLPA* |
| Ga0181535_108659752 | 3300014199 | Bog | AGILLNPGDLLEIEFDTPAPSRLPAIVRFRSGFCFGLEFITPLPA* |
| Ga0181516_100968151 | 3300014655 | Bog | GMVLYAGILLSPGDLLEVEFDMPSRSHLTAIVRSKNGFCFGLEFLAPLPD* |
| Ga0187814_102654542 | 3300017932 | Freshwater Sediment | LEIEFDTPVHSRMPAIVRSRNGFCFGLEFITPLPA |
| Ga0187778_104659431 | 3300017961 | Tropical Peatland | MVLYAGILLNPGDLLELEFDAPYHSRVSAIVRSRNGFCFGLEFISPLPA |
| Ga0187783_105856452 | 3300017970 | Tropical Peatland | MVLYAGILVKPGDLLEIEFDMPMPSRMPAIVRSRSGFCFGLEFITPLPA |
| Ga0187780_106903122 | 3300017973 | Tropical Peatland | MSQGGMVLYAGIMLNPGDLLELEFDTPFHSRIPAIVRSRNGFCFGLEFIAPLPS |
| Ga0187782_100549443 | 3300017975 | Tropical Peatland | LLNPGDLLEVEFDTPTPSRMPAIVRSRNGFCFGLEFITPLPS |
| Ga0187782_104150161 | 3300017975 | Tropical Peatland | DLLEVEFDTPTPSRMPAIVRSRNGFCFGLEFITPLPS |
| Ga0187782_113978901 | 3300017975 | Tropical Peatland | PGDLLEVEFDTPHSRATAIVRYRSGFCFGLEFISPLPA |
| Ga0187782_116316381 | 3300017975 | Tropical Peatland | PGDLLQLEFDAPYHSRVSAIVRSRNGFCFGLEFISPLPA |
| Ga0187823_102763041 | 3300017993 | Freshwater Sediment | EMSEGGMVLYAGILLNPGDLLEVEFDTPVHSRMPAIVRSRNGFCFGLEFITPLPA |
| Ga0187851_105224921 | 3300018046 | Peatland | ARILLNPGDLLEIEFDTPSPSRLPAIVRSRSGFCFGLEFISPLPA |
| Ga0187858_107950251 | 3300018057 | Peatland | LEIEFDTPVHSRMTAIVRSRTGFSFGLEFITPLPS |
| Ga0187771_101780841 | 3300018088 | Tropical Peatland | MAVYAGILLNPGDLLEVEFDMPFHSRVPAIVRSRNGFCFGLEF |
| Ga0187771_107170141 | 3300018088 | Tropical Peatland | MVLYAGILLNPGDLLEIEFDMPFHSRVPAIVRSRSGFCYGLEFLVPLAT |
| Ga0187771_117504251 | 3300018088 | Tropical Peatland | GDLLELEFDAPTHSRVSAIVRSRNGFCFGLEFVSPLPV |
| Ga0066662_108960812 | 3300018468 | Grasslands Soil | GGMVLYAGILLNPGDLLEVEFDMPTASRMTAIVRSRNGFCFGLEFITPLPS |
| Ga0210407_100182566 | 3300020579 | Soil | YAGIWLKPGDLLEIEFGIPCHLRMMAIVRDRSGFCFGLEFIAPLPTEPES |
| Ga0210403_109665001 | 3300020580 | Soil | GDVLEIEFDTPAPSRLPAIVRSRNGFCFGLEFITPLPA |
| Ga0210395_102085391 | 3300020582 | Soil | LYAGILLNPGDLLEIEFDTPAPSRLPAIVRSRNGFCFGLEFITPLPA |
| Ga0210401_114736271 | 3300020583 | Soil | RGTELSEGGMVLYAGILLNPGDLLEIEFDTPVRSRMTAIVRSKNGFCFGLEFITPLPA |
| Ga0210405_101034501 | 3300021171 | Soil | VLYAGILLNPGDLLEIEFDTPAPSRLPAIVRSRNGFCFGLEFITPLPA |
| Ga0210396_103783062 | 3300021180 | Soil | GGMVLYAGILLNPGDLLEIEFDTPVRSRMTAIVRSKNGFCFGLEFITPLPA |
| Ga0210388_114296941 | 3300021181 | Soil | MVLYAGILVNPGDLLEVEFDFPSRSKMTAIVRSRTGFCFGLEFIAPLPS |
| Ga0210393_100159291 | 3300021401 | Soil | DLLELEFDMPVQSRIPAVVRSRNGFCFGLEFIAPLPS |
| Ga0210387_100608363 | 3300021405 | Soil | AGILLNPGDLLEIEFDTPVHSRMTAIVRSRNGFCFGLEFITPLPA |
| Ga0210387_107001801 | 3300021405 | Soil | LEIEFDTPTPSRLPAIVRSRNGFCFGLEFITPLPA |
| Ga0210391_108095432 | 3300021433 | Soil | GMELYAGIWLKPGDLLEVEFGIPYRLRMMAVVRHRSGFCFGLEFIAPLQT |
| Ga0210390_101060352 | 3300021474 | Soil | MSQGGMVLYAGILLNPGDLLEIEFDTPVHSRMPAIVRSRSGFCFGLEFITPLPA |
| Ga0210392_114472072 | 3300021475 | Soil | VNPGDLLEVEFDFPSRSKMTAIVRSRTGFCFGLEFIAPLPS |
| Ga0210398_102033042 | 3300021477 | Soil | LYAGLLLKPGDLLEVEFGIPHRLRMMAIVRYRDGYCFGLEFTAPLPSQ |
| Ga0210402_100616131 | 3300021478 | Soil | NPGDLLEIEFDTPAPSRLPAIVRSRNGFCFGLEFITPLPA |
| Ga0242665_101551942 | 3300022724 | Soil | WLKPGDLLEIEFGIPCHLRMMAIVRDRSGFCFGLEFIAPLPTEPES |
| Ga0224568_10202581 | 3300024220 | Plant Litter | VLYAGILLNPGDLLEIEFDTPTPSRLPAIVRSRSGFCFGLEFISPLPA |
| Ga0207692_100531253 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LYAGILLNPGDLLEIEFDTPTPSRLPAIVRSRNGFCFGLEFITPLPA |
| Ga0207664_107522721 | 3300025929 | Agricultural Soil | NPGDLLEIEFDTPTHSRMPAIVRSKNGFCFGLEFITPLPS |
| Ga0207664_117367721 | 3300025929 | Agricultural Soil | LYAGILLNPGDLLEVEFDMPTASRMPAIVRSRNGFCFGLEFISPLPS |
| Ga0207665_100231625 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | DLLEVEFDTPVHSRVPAIVRSKSGFCFGLEFITPLPS |
| Ga0257163_10813211 | 3300026359 | Soil | DLLEVEFDTPTQSRMTAIVRSRNGFCFGLEFIAPLPS |
| Ga0209008_10086584 | 3300027545 | Forest Soil | GMELYAGLLLKPGDLLEVEFGIPHRLRMMAIVRYRDGYCFGLEFTAPLPSQ |
| Ga0209222_10127261 | 3300027559 | Forest Soil | GGMVLYAGILLSPGDLLEVEFDMPSRSHLTAIVRSKNGFCFGLEFLAPLPD |
| Ga0209733_11345871 | 3300027591 | Forest Soil | YAGILLNPGDLLEIEFETPMPSRLTAIVRSRNGFCFGLEFITPLPS |
| Ga0209329_10087451 | 3300027605 | Forest Soil | LYAGIMLNPGDLLEVEFGVPGRFRVMAVVRYCSGYWFGLEFV |
| Ga0209221_10516951 | 3300027609 | Forest Soil | SPGDLLEVEFDTPTRSHLTAIVRSKNGFCFGLEFLAPLPD |
| Ga0208044_10638832 | 3300027625 | Peatlands Soil | LNPGDLLEIEFDTPVLSRITAIVRSRNGFCFGLEFITPLPA |
| Ga0208989_100528881 | 3300027738 | Forest Soil | GMLLNPGDLLEIEFDTPTQSRMTAIVRSRNGFCFGLEFIAPLPS |
| Ga0209811_102268741 | 3300027821 | Surface Soil | GILLNPGDLLEIEFDTPTPSRMPAIVRSKNGFCFGLEFITPLPS |
| Ga0209040_101175571 | 3300027824 | Bog Forest Soil | MTLYAGILLNPGDLLEIEFDTPTPSRMPAIVRTRNGFCFGLEFITPLPA |
| Ga0209580_101706522 | 3300027842 | Surface Soil | MLYAGILLNPGDLLEIEFDTPVNSRVPAIVRSRDGYCFGLEFITPLPA |
| Ga0209180_101056862 | 3300027846 | Vadose Zone Soil | MSEGGMLLYAGILLNPGDMLELEFSTPSHSRMKAVVRYRDGYCFGLEFIAPITA |
| Ga0209167_101899701 | 3300027867 | Surface Soil | NPGDLLEIEFDTPVRSRMTAIVRSKNGFCFGLEFITPLPA |
| Ga0209465_102132632 | 3300027874 | Tropical Forest Soil | LNPGDLLEVEFDTPTHSRLTAIVRSKTGFCFGLEFITPLPS |
| Ga0209380_100434142 | 3300027889 | Soil | MSQGGMVLYAGVLLNPGDLLEIEFETPVPSRVPAIVRSRSGFCFGLEFIAPLPA |
| Ga0209067_102399481 | 3300027898 | Watersheds | GTEMSEGGMVLYAGILLNPGDLLEIEFDTPVHSRMPAIVRSRNGFCFGLEFITPLPA |
| Ga0209415_103239762 | 3300027905 | Peatlands Soil | LEIEFDTPAPSRLPAIVRFRSGFCFGLEFITPLPA |
| Ga0209006_100391591 | 3300027908 | Forest Soil | ILLNPGDLLELEFDMPFHSRVPAVVRSRNGFCFGLEFIAPLPA |
| Ga0209006_100813353 | 3300027908 | Forest Soil | MVLYAGVLLNPGDLLEIEFDTAQHSRMTGIVRSRNGFCLGVEFLAPLPA |
| Ga0209698_100074553 | 3300027911 | Watersheds | MVLYAGIMLNPGDLLEVEFEIPGRSRMIAVVRERSGYCFGVEFIAPLQTA |
| Ga0209698_101675712 | 3300027911 | Watersheds | MVLYAGILLNPGDLLEIEFDTPVHSRMPAIVRSRSGFCFGLEFITPLPA |
| Ga0209168_1000019661 | 3300027986 | Surface Soil | NPGDLLEIEFDTPTPSRMPAIVRSRNGFCFGLEFITPLPS |
| Ga0311370_101111621 | 3300030503 | Palsa | AGILLSPGDLLEVEFDTPTRSHLTAIVRSKNGFCFGLEFLAPLPD |
| Ga0310038_102139252 | 3300030707 | Peatlands Soil | LLNPGDLLEIEFDTPVLSRITAIVRSRNGFCFGLEFITPLPA |
| Ga0265722_1032901 | 3300030761 | Soil | MVLYAGILLSPGDLLEVEFDMPSRSHLTAIVRSKNGFCFGLEFLAPLPD |
| Ga0302325_114232522 | 3300031234 | Palsa | VLYAGVLLNPGDLLEIEFDTAQHSRMTGIVRSRNGFCLGVEFLAPLPA |
| Ga0170820_123808532 | 3300031446 | Forest Soil | GMVLYAGILLNPGDLLEIEFDTPVHSRMTAIVRSRNGFCFGLEFITPLPA |
| Ga0170820_159850332 | 3300031446 | Forest Soil | GDLLEIEFDTPVPSRLPAIVRSRNGFCFGLEFITPLPS |
| Ga0170820_163542031 | 3300031446 | Forest Soil | ILLNPGDLLELEFDMPFHSRVPAVVRSRNGFCFGLEFIAPLPS |
| Ga0170818_1155528011 | 3300031474 | Forest Soil | LLNPGDLLEIEFDTPVHSRMTAIVRSRNGFCFGLEFITPLPA |
| Ga0318541_102397562 | 3300031545 | Soil | TLYAGILLNPGDLLEVEFDTPTPSRLPAIVRSKNGFCFGLEFIIPLRG |
| Ga0307476_102892072 | 3300031715 | Hardwood Forest Soil | VLLNPGDLLEIEFETPVPSRVPAIVRSRNGFCFGLEFIAPLPA |
| Ga0307474_1000276010 | 3300031718 | Hardwood Forest Soil | LSEGGMVLYAGILLNPGDLLEIEFETPTLSKMTAVVRSRNGFCFGLEFITPLPQ |
| Ga0307475_114225591 | 3300031754 | Hardwood Forest Soil | ELSEGGMVLYAGILLNPGDLLEVEFDTPVHSRLTAIVRSRTGFCFGLEFIAPLPA |
| Ga0302319_109129692 | 3300031788 | Bog | GDLLEIEFDTPSPSRLPAIVRSRSGYCFGLEFISPLPA |
| Ga0318567_104782542 | 3300031821 | Soil | GDLLEVEFDTPTPSRLPAIVRSKNGFCFGLEFIIPLRG |
| Ga0306923_108210232 | 3300031910 | Soil | PGDLLEVEFDFPTHSRVPAIVRSKNGFCFGLEFITPLPS |
| Ga0307479_118639581 | 3300031962 | Hardwood Forest Soil | LYAGILLNPGDLLEIEFDTPNLSRVPAIVRSRNGFCFGLEFITPLPA |
| Ga0311301_1002523115 | 3300032160 | Peatlands Soil | LSQGGMVLYAGILVNPGDLLELEFDMPVHSRVPAIVRTRNGFCFGLEFIAPLPA |
| Ga0311301_128581451 | 3300032160 | Peatlands Soil | YAGILLNPGDLLEIEFDTPVHSRMTAIVRSKNGFCFGLEFITPLPA |
| Ga0306920_1011941281 | 3300032261 | Soil | YAGILLNPGDLLEVEFDFPTHSRVPAIVRSKNGFCFGLEFITPLPS |
| Ga0335079_103060563 | 3300032783 | Soil | AGILLNPGDLLEIEIDTPTPSRIPAIVRSKNGFCFGLEFITPLPA |
| Ga0335078_1000006678 | 3300032805 | Soil | MLLYAGLLAKPGDLLEVEFETPQRCRSMAIVRSRSGYSFGLEFISPLPA |
| Ga0335072_102960141 | 3300032898 | Soil | MVLYAGILLNPGDLLEIEFDTPIHSRMPAIVRSRNGFCFGLEFITPLPA |
| Ga0335072_113799051 | 3300032898 | Soil | TELSQGGMVLYAGILLNPGDLLEIEFDAPLHSHMTAIVRSRNGFCFGLEFITPLPA |
| Ga0370494_074658_704_853 | 3300034130 | Untreated Peat Soil | MMLYAGILLNPGDSLEVEFDTPVHSRMTAIVRSRSGFSFGLEFITPLNV |
| ⦗Top⦘ |