NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F052185

Metagenome / Metatranscriptome Family F052185

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F052185
Family Type Metagenome / Metatranscriptome
Number of Sequences 143
Average Sequence Length 41 residues
Representative Sequence MKKKTALIVFGLVLVFGGATRSDAQVKRVQMHIAGYLCGN
Number of Associated Samples 100
Number of Associated Scaffolds 143

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 73.94 %
% of genes near scaffold ends (potentially truncated) 13.99 %
% of genes from short scaffolds (< 2000 bps) 80.42 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.804 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(9.091 % of family members)
Environment Ontology (ENVO) Unclassified
(30.070 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(60.839 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 52.94%    β-sheet: 0.00%    Coil/Unstructured: 47.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 143 Family Scaffolds
PF07681DoxX 6.29
PF00403HMA 3.50
PF13411MerR_1 2.10
PF01641SelR 1.40
PF00578AhpC-TSA 1.40
PF12704MacB_PCD 1.40
PF03595SLAC1 0.70
PF00311PEPcase 0.70
PF12270Cyt_c_ox_IV 0.70
PF13428TPR_14 0.70
PF07589PEP-CTERM 0.70
PF01053Cys_Met_Meta_PP 0.70
PF01022HTH_5 0.70
PF13424TPR_12 0.70
PF07690MFS_1 0.70
PF04073tRNA_edit 0.70
PF13557Phenol_MetA_deg 0.70
PF13429TPR_15 0.70
PF09990DUF2231 0.70
PF03544TonB_C 0.70
PF07885Ion_trans_2 0.70
PF01209Ubie_methyltran 0.70
PF04820Trp_halogenase 0.70
PF09278MerR-DNA-bind 0.70
PF12695Abhydrolase_5 0.70
PF13519VWA_2 0.70
PF00582Usp 0.70
PF00072Response_reg 0.70

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 143 Family Scaffolds
COG4270Uncharacterized membrane proteinFunction unknown [S] 6.29
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 6.29
COG2608Copper chaperone CopZInorganic ion transport and metabolism [P] 3.50
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 3.50
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 1.40
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.70
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.70
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.70
COG2352Phosphoenolpyruvate carboxylaseEnergy production and conversion [C] 0.70
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.70
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.70
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.70
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.70
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.70
COG1275Tellurite resistance protein TehA and related permeasesDefense mechanisms [V] 0.70
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.70
COG0789DNA-binding transcriptional regulator, MerR familyTranscription [K] 0.70
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.70
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.70
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.70
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.70
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.70

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.80 %
UnclassifiedrootN/A4.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886011|MRS1b_contig_8782280All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_81180Open in IMG/M
2162886012|MBSR1b_contig_8547268All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_81707Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101196415All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8772Open in IMG/M
3300000953|JGI11615J12901_10354797All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8896Open in IMG/M
3300000953|JGI11615J12901_10403850All Organisms → cellular organisms → Bacteria → Acidobacteria1111Open in IMG/M
3300000956|JGI10216J12902_124172037All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8804Open in IMG/M
3300003203|JGI25406J46586_10056375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_81290Open in IMG/M
3300004016|Ga0058689_10161313All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300004157|Ga0062590_102827632All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300004480|Ga0062592_101201082All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300005289|Ga0065704_10167828All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1310Open in IMG/M
3300005289|Ga0065704_10730918All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300005293|Ga0065715_10126471All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_82108Open in IMG/M
3300005294|Ga0065705_10198704Not Available1420Open in IMG/M
3300005332|Ga0066388_106531477All Organisms → cellular organisms → Bacteria → Acidobacteria588Open in IMG/M
3300005339|Ga0070660_100238049All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1482Open in IMG/M
3300005340|Ga0070689_100006965All Organisms → cellular organisms → Bacteria7876Open in IMG/M
3300005344|Ga0070661_101880021All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300005345|Ga0070692_11172221All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300005440|Ga0070705_100131380All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_81634Open in IMG/M
3300005440|Ga0070705_100243193All Organisms → cellular organisms → Bacteria → Acidobacteria1259Open in IMG/M
3300005441|Ga0070700_100021187All Organisms → cellular organisms → Bacteria3775Open in IMG/M
3300005444|Ga0070694_100176383All Organisms → cellular organisms → Bacteria → Acidobacteria1578Open in IMG/M
3300005444|Ga0070694_100626622All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8868Open in IMG/M
3300005457|Ga0070662_101254275All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300005458|Ga0070681_10051691All Organisms → cellular organisms → Bacteria4099Open in IMG/M
3300005458|Ga0070681_10471523All Organisms → cellular organisms → Bacteria → Acidobacteria1168Open in IMG/M
3300005458|Ga0070681_10864879All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300005458|Ga0070681_11605532Not Available576Open in IMG/M
3300005459|Ga0068867_100731697All Organisms → cellular organisms → Bacteria → Acidobacteria876Open in IMG/M
3300005459|Ga0068867_101393960All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300005530|Ga0070679_101058092All Organisms → cellular organisms → Bacteria → Acidobacteria756Open in IMG/M
3300005545|Ga0070695_100093785All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_82009Open in IMG/M
3300005545|Ga0070695_100361789All Organisms → cellular organisms → Bacteria → Acidobacteria1090Open in IMG/M
3300005547|Ga0070693_100128327All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1581Open in IMG/M
3300005562|Ga0058697_10174556All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300005564|Ga0070664_101246893All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8702Open in IMG/M
3300005564|Ga0070664_101307270All Organisms → cellular organisms → Bacteria → Acidobacteria685Open in IMG/M
3300005578|Ga0068854_102222823All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300005614|Ga0068856_101159087All Organisms → cellular organisms → Bacteria → Acidobacteria790Open in IMG/M
3300005617|Ga0068859_100081984All Organisms → cellular organisms → Bacteria3268Open in IMG/M
3300005617|Ga0068859_100467096Not Available1357Open in IMG/M
3300005617|Ga0068859_100833805All Organisms → cellular organisms → Bacteria → Acidobacteria1009Open in IMG/M
3300005618|Ga0068864_100522499Not Available1144Open in IMG/M
3300005719|Ga0068861_101352941All Organisms → cellular organisms → Bacteria → Acidobacteria694Open in IMG/M
3300005843|Ga0068860_100702387Not Available1021Open in IMG/M
3300005843|Ga0068860_101446576All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300005844|Ga0068862_100792764All Organisms → cellular organisms → Bacteria → Acidobacteria925Open in IMG/M
3300005844|Ga0068862_102272947All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300005886|Ga0075286_1020420All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8831Open in IMG/M
3300006058|Ga0075432_10474988All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300006169|Ga0082029_1288535All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8841Open in IMG/M
3300006173|Ga0070716_100822385All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8721Open in IMG/M
3300006196|Ga0075422_10578204All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300006755|Ga0079222_10099511All Organisms → cellular organisms → Bacteria1523Open in IMG/M
3300006755|Ga0079222_10810290All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300006755|Ga0079222_11519994All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300006804|Ga0079221_10304261All Organisms → cellular organisms → Bacteria → Acidobacteria937Open in IMG/M
3300006806|Ga0079220_10047543All Organisms → cellular organisms → Bacteria → Acidobacteria2004Open in IMG/M
3300006852|Ga0075433_10034220All Organisms → cellular organisms → Bacteria → Acidobacteria4362Open in IMG/M
3300006852|Ga0075433_10113146All Organisms → cellular organisms → Bacteria → Acidobacteria2407Open in IMG/M
3300006871|Ga0075434_100975366All Organisms → cellular organisms → Bacteria → Acidobacteria862Open in IMG/M
3300006894|Ga0079215_11066599All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300006904|Ga0075424_100475324All Organisms → cellular organisms → Bacteria → Acidobacteria1334Open in IMG/M
3300006904|Ga0075424_100656652All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300006904|Ga0075424_101186049All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8813Open in IMG/M
3300006954|Ga0079219_10003402All Organisms → cellular organisms → Bacteria4517Open in IMG/M
3300006954|Ga0079219_10201602All Organisms → cellular organisms → Bacteria → Acidobacteria1129Open in IMG/M
3300006954|Ga0079219_10257093All Organisms → cellular organisms → Bacteria → Acidobacteria1044Open in IMG/M
3300006954|Ga0079219_11528149All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8606Open in IMG/M
3300009094|Ga0111539_10083710All Organisms → cellular organisms → Bacteria → Acidobacteria3751Open in IMG/M
3300009094|Ga0111539_10474303All Organisms → cellular organisms → Bacteria → Acidobacteria1457Open in IMG/M
3300009147|Ga0114129_10314675All Organisms → cellular organisms → Bacteria2083Open in IMG/M
3300009162|Ga0075423_10861769All Organisms → cellular organisms → Bacteria → Acidobacteria959Open in IMG/M
3300009174|Ga0105241_10216991All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_81606Open in IMG/M
3300009176|Ga0105242_10785791All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8941Open in IMG/M
3300009176|Ga0105242_10950438All Organisms → cellular organisms → Bacteria → Acidobacteria863Open in IMG/M
3300009551|Ga0105238_11914592All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300010038|Ga0126315_10216826All Organisms → cellular organisms → Bacteria → Acidobacteria1158Open in IMG/M
3300010046|Ga0126384_10545916All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_81006Open in IMG/M
3300010046|Ga0126384_12017053All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8552Open in IMG/M
3300010046|Ga0126384_12189336All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300010047|Ga0126382_11616894All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300010358|Ga0126370_11020976All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8756Open in IMG/M
3300010359|Ga0126376_10000186All Organisms → cellular organisms → Bacteria29122Open in IMG/M
3300010359|Ga0126376_10001062All Organisms → cellular organisms → Bacteria14537Open in IMG/M
3300010359|Ga0126376_10004070All Organisms → cellular organisms → Bacteria → Acidobacteria8569Open in IMG/M
3300010362|Ga0126377_10338106All Organisms → cellular organisms → Bacteria → Acidobacteria1498Open in IMG/M
3300010362|Ga0126377_10815002All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8993Open in IMG/M
3300010396|Ga0134126_10757909All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_81099Open in IMG/M
3300010396|Ga0134126_13064098All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300010397|Ga0134124_10089220All Organisms → cellular organisms → Bacteria2664Open in IMG/M
3300010397|Ga0134124_11102413All Organisms → cellular organisms → Bacteria → Acidobacteria810Open in IMG/M
3300010397|Ga0134124_11275495All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8757Open in IMG/M
3300010399|Ga0134127_10073426All Organisms → cellular organisms → Bacteria → Acidobacteria2912Open in IMG/M
3300010399|Ga0134127_11367951All Organisms → cellular organisms → Bacteria → Acidobacteria778Open in IMG/M
3300010399|Ga0134127_13405116All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300010400|Ga0134122_10485604All Organisms → cellular organisms → Bacteria → Acidobacteria1114Open in IMG/M
3300010400|Ga0134122_10542948All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_81061Open in IMG/M
3300010403|Ga0134123_12593477All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300011333|Ga0127502_11344679All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300012093|Ga0136632_10043265All Organisms → cellular organisms → Bacteria → Acidobacteria2065Open in IMG/M
3300012958|Ga0164299_10781301All Organisms → cellular organisms → Bacteria → Acidobacteria678Open in IMG/M
3300013297|Ga0157378_12673332All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300013307|Ga0157372_11510356All Organisms → cellular organisms → Bacteria → Acidobacteria774Open in IMG/M
3300013308|Ga0157375_10017102All Organisms → cellular organisms → Bacteria6536Open in IMG/M
3300014326|Ga0157380_10066302All Organisms → cellular organisms → Bacteria → Acidobacteria2903Open in IMG/M
3300014497|Ga0182008_10584277All Organisms → cellular organisms → Bacteria → Acidobacteria625Open in IMG/M
3300015262|Ga0182007_10072544All Organisms → cellular organisms → Bacteria → Acidobacteria1128Open in IMG/M
3300015371|Ga0132258_12130742All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_81409Open in IMG/M
3300015371|Ga0132258_12648839All Organisms → cellular organisms → Bacteria → Acidobacteria1252Open in IMG/M
3300015374|Ga0132255_101040399All Organisms → cellular organisms → Bacteria → Acidobacteria1229Open in IMG/M
3300015374|Ga0132255_103800402All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300018422|Ga0190265_10000010All Organisms → cellular organisms → Bacteria258474Open in IMG/M
3300019487|Ga0187893_10834834All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300020146|Ga0196977_1000598All Organisms → cellular organisms → Bacteria17998Open in IMG/M
3300021445|Ga0182009_10037047All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1992Open in IMG/M
3300021445|Ga0182009_10097663All Organisms → cellular organisms → Bacteria → Acidobacteria1335Open in IMG/M
3300021445|Ga0182009_10181355All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_81016Open in IMG/M
3300021445|Ga0182009_10187739All Organisms → cellular organisms → Bacteria → Acidobacteria1000Open in IMG/M
3300021445|Ga0182009_10343072All Organisms → cellular organisms → Bacteria → Acidobacteria761Open in IMG/M
3300021445|Ga0182009_10368773All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8736Open in IMG/M
3300024179|Ga0247695_1000331All Organisms → cellular organisms → Bacteria → Acidobacteria6859Open in IMG/M
3300025912|Ga0207707_10531804All Organisms → cellular organisms → Bacteria → Acidobacteria1000Open in IMG/M
3300025924|Ga0207694_10407505All Organisms → cellular organisms → Bacteria → Acidobacteria1131Open in IMG/M
3300025925|Ga0207650_10182193All Organisms → cellular organisms → Bacteria → Acidobacteria1674Open in IMG/M
3300025930|Ga0207701_10802972All Organisms → cellular organisms → Bacteria → Acidobacteria792Open in IMG/M
3300025932|Ga0207690_10137612All Organisms → cellular organisms → Bacteria → Acidobacteria1795Open in IMG/M
3300025936|Ga0207670_10002043All Organisms → cellular organisms → Bacteria10583Open in IMG/M
3300025939|Ga0207665_10829757All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8731Open in IMG/M
3300025940|Ga0207691_10278839All Organisms → cellular organisms → Bacteria → Acidobacteria1438Open in IMG/M
3300026088|Ga0207641_10335347All Organisms → cellular organisms → Bacteria → Acidobacteria1438Open in IMG/M
3300026118|Ga0207675_101512842All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300027775|Ga0209177_10064546All Organisms → cellular organisms → Bacteria → Acidobacteria1077Open in IMG/M
3300027907|Ga0207428_10011858All Organisms → cellular organisms → Bacteria → Acidobacteria7680Open in IMG/M
3300028381|Ga0268264_10236124All Organisms → cellular organisms → Bacteria → Acidobacteria1691Open in IMG/M
3300030511|Ga0268241_10194363All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300031716|Ga0310813_10055349All Organisms → cellular organisms → Bacteria → Acidobacteria2939Open in IMG/M
3300031852|Ga0307410_10046714All Organisms → cellular organisms → Bacteria2890Open in IMG/M
3300032074|Ga0308173_12224498All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300032159|Ga0268251_10321622All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300033412|Ga0310810_10382621All Organisms → cellular organisms → Bacteria → Acidobacteria1463Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.09%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere8.39%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil7.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil7.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.90%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.20%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere2.10%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.40%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.40%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere1.40%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.40%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.40%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave1.40%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.70%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.70%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.70%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.70%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.70%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.70%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.70%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.70%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.70%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.70%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.70%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.70%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.70%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886011Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300004016Agave microbial communities from Guanajuato, Mexico - As.Ma.rzHost-AssociatedOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005886Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011333Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012093Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300020146Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13CEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300024179Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MRS1b_1000.000018702162886011Miscanthus RhizosphereMKKKAALVIFGLVLVFGGAIRSDAQVKQVQMHIAGY
MBSR1b_0678.000044802162886012Miscanthus RhizosphereMKKKAALVIFGLVLVFGGAIRSDAQVKQVQMHIAGYLCGN
INPhiseqgaiiFebDRAFT_10119641523300000364SoilMKKKAALIIGLVLVFGGATRSHAQVKRVRMHIAGYLCGN*
JGI11615J12901_1035479733300000953SoilMRKKAALVVFGVILILGAASHSGGQVKRVQMHIAGYLCGN*
JGI11615J12901_1040385013300000953SoilMKKKTALIIVGLVLVFGGATRSAAQVKRVQMHIAGYLCGN*
JGI10216J12902_12417203723300000956SoilMGKKVALIVFGLVVVLGGVTRSDAQVKRVQMHIAGYLCGN*
JGI25406J46586_1005637523300003203Tabebuia Heterophylla RhizosphereMKTKAALIVFSLVVVLGGATRSEAQVKRVQMHIAGYLCGN*
Ga0058689_1016131313300004016AgaveMKAKAVLIVLGLVLMVGGASRVEAQVKRVQMRIAGYLCGN*
Ga0062590_10282763223300004157SoilMKKKTALTVLGLALVFAGATRSEAQVKRVQMHIAGYLCGN*
Ga0062592_10120108223300004480SoilMKKKTALIVFGLVLVFGGATRSDAQVKRVQMHIAGYLCGN*
Ga0065704_1016782823300005289Switchgrass RhizosphereMKKKTALIVVGLVLVFGGATRSAAQVKRVQMHIAGYLCGN*
Ga0065704_1073091823300005289Switchgrass RhizosphereMKKKTALIVFGLVFVFGGATRSYAQVKRVQMHIAGYLCGN*
Ga0065715_1012647123300005293Miscanthus RhizosphereMQKKTSLVVLSLALVFGGATCASAQVKRVQMHIAGYLCGN*
Ga0065705_1019870413300005294Switchgrass RhizosphereMKKKTALIVLGLALVFAGATRSEAQVKRVQMHIAGYLCGN*
Ga0066388_10653147723300005332Tropical Forest SoilMKKKAVLIVFGLVLVFGGASRSAAQVKRVQMHIAGYLCGN*
Ga0070660_10023804933300005339Corn RhizosphereMIRRATLIVFGLVLVFGGAARSEAQVKRVQMHIAGYLCGN*
Ga0070689_10000696553300005340Switchgrass RhizosphereMKKKTVLIVLGLVLVFGSASRAGAQVRQVQMHIEGYLCGN*
Ga0070661_10188002113300005344Corn RhizosphereERQMRKRIAVIVFGLVLVCSVATRAEAQVKRVQMHIAGYLCGN*
Ga0070692_1117222123300005345Corn, Switchgrass And Miscanthus RhizosphereMKKKAVLIVFSLVFVFAGATRSEAQVKRVQMHIAGYLCGN*
Ga0070705_10013138023300005440Corn, Switchgrass And Miscanthus RhizosphereMKQKTALIVVGLILMFGSATRSEAQVKRVQMHIAGYLCGN*
Ga0070705_10024319323300005440Corn, Switchgrass And Miscanthus RhizosphereMKKKVALIIFGLVLVFGGATRSSAQVKRVQMHIAGYLCGN*
Ga0070700_10002118713300005441Corn, Switchgrass And Miscanthus RhizosphereMKKTTVLFTFGLVLLFGGATHSAAQVKRVQMHIAGYLCGN*
Ga0070694_10017638323300005444Corn, Switchgrass And Miscanthus RhizosphereMKKKAALIIGLVLVFGGAARSHAQVKRVRMHIAGYLCGN*
Ga0070694_10062662213300005444Corn, Switchgrass And Miscanthus RhizosphereMAALIQSGEKMKEKTALIVLGLALVFGGATRSDAQVKRVQMHIAGYLCGN*
Ga0070662_10125427523300005457Corn RhizosphereMKEKTALIVLGLALVFGGATRSDAQVKRVQMHIAGYLCGN*
Ga0070681_1005169173300005458Corn RhizosphereMQKKTSLIVLSLALVFGGATCASAQVKRVQMHIAGYLCGN*
Ga0070681_1047152313300005458Corn RhizosphereMKKKTALIVFGLLVVFASAMRSEAQVKRVQMHIAGYLCGN*
Ga0070681_1086487923300005458Corn RhizosphereMKQKITLIILGLVLVFGGASRAGAQVKRIQMHIAGYLCGN*
Ga0070681_1160553223300005458Corn RhizosphereMKKRVAVIVFGLVLVCSAATRAEAQVKRVQMHIAGYLCGN*
Ga0068867_10073169713300005459Miscanthus RhizosphereMMKKAALIVFGLILVFGGATRSDAQVKRVQMHIAGYLCGN*
Ga0068867_10139396023300005459Miscanthus RhizosphereMKKKTVLIVLGLVLVFGSASGAGAQVKQVQMHIAGYLCGN*
Ga0070679_10105809213300005530Corn RhizosphereMKKRVAVIVFGLVLVCSVATRAEAQVKRVQMHIAGYLCGN*
Ga0070695_10009378523300005545Corn, Switchgrass And Miscanthus RhizosphereMKEKTALIVLGLALVFGGATRSEAQVKRVQMHIAGYLCGN*
Ga0070695_10036178923300005545Corn, Switchgrass And Miscanthus RhizosphereMKKKAALIIGLVLVFGGANRSHAQVKRVRMHIAGYLCGN*
Ga0070693_10012832723300005547Corn, Switchgrass And Miscanthus RhizosphereMKKKAALIIFGLVLVFGGAIRSTAQVKRVQMHIAGYLCGN*
Ga0058697_1017455633300005562AgaveMKKKTALIVFGLVLVFGSASRSDAQVKRVQMHIAGYLCGN*
Ga0070664_10124689323300005564Corn RhizosphereMIKKAALIVCGLVLVFGSATRSAAQVKRVQMHIAGYLCGN*
Ga0070664_10130727023300005564Corn RhizosphereMEKKTALIVLGLVLVFGGATRTTAQVKRVQMHIAGYLCGN*
Ga0068854_10222282323300005578Corn RhizosphereMKKRIAVIVFGLVLVCSVATRAEAQVKRVQMHIAGYLCGN*
Ga0068856_10115908713300005614Corn RhizosphereMKKKVLIVFALVVVCGGATRSDAQVKRVQMHIAGYLCGN*
Ga0068859_10008198413300005617Switchgrass RhizosphereMKTKAVSLIILFVFLGSVVRSDAQVKQVQMHIAGYLCGN*
Ga0068859_10046709613300005617Switchgrass RhizosphereMKKTVLFTFGLVLLFGSASHSAAQVKRVQMHIAGYLCGN*
Ga0068859_10083380523300005617Switchgrass RhizosphereMKNTILFSLGLLLLFGSSGNSAAQVKRVQMHIAGYLCGN*
Ga0068864_10052249923300005618Switchgrass RhizosphereMKKKTVLIVLGLVLVFGSASRAGAQVKQVQMHIEGYLCGN*
Ga0068861_10135294123300005719Switchgrass RhizosphereLQRKFTLVFAGLILLFGGAFGCSAQVKRVQMHIAGYLCGN*
Ga0068860_10070238723300005843Switchgrass RhizosphereLQRKFTLVVAGLILLLGSAFGCGAQVKRVQMHIAGYLCGN*
Ga0068860_10144657623300005843Switchgrass RhizosphereMQKRTLLIVLGLVFVCVSGSGAVAQVKRVQMHIAGYLCGN*
Ga0068862_10079276423300005844Switchgrass RhizosphereMKKKTVLIVLGLVLVFGSASRAGAQVKRVQMHIEGYLCGN*
Ga0068862_10227294723300005844Switchgrass RhizosphereMKTKALLMVGLVLVFGCATRSSAQVKRVQMHIAGYLCGN*
Ga0075286_102042023300005886Rice Paddy SoilMIKKAALIVCGLVLVFGNATRSDAQVKRVQMHIAGYLCGN*
Ga0075432_1047498823300006058Populus RhizosphereMKKKAALTIVGLVFVFGGAIRSDAQVKRVQMHIAGYLCGN*
Ga0082029_128853513300006169Termite NestMTAYLIRREEMKKRAALFVFGLVLVLGGATRSDAQVKRVQMHIAGYLCGN*
Ga0070716_10082238523300006173Corn, Switchgrass And Miscanthus RhizosphereMKKKAILIMFGLCFVFVSAITAAAQVKRVQMHIAGYLCGN*
Ga0070716_10116881623300006173Corn, Switchgrass And Miscanthus RhizosphereMQKKTSLVVFSLALVFGGATCASAQVKRVQMHIAGYLCGN*
Ga0075422_1057820423300006196Populus RhizosphereMKKKTALIVFGLVLVLAGVTRSEAQVKRVQMHIAGYLCGN*
Ga0079222_1009951133300006755Agricultural SoilMKKKVALIVFGLVLVFGGATRAEAQVKRVQMHIAGYLCSN*
Ga0079222_1081029023300006755Agricultural SoilMLGKLFRISFGLVLLFGVLSSSEAQVKRVQMHIAGYLCGN*
Ga0079222_1151999423300006755Agricultural SoilMKQKLTLIVLGLVLVFGGASRAGAQVKRIQMHIAGYLCGN*
Ga0079221_1030426113300006804Agricultural SoilKKMKQKLTLIVLGLVLVFGGASRAGAQVKRIQMHIAGYLCGN*
Ga0079220_1004754323300006806Agricultural SoilMKKKTALILFAVALGFGIATRSDAQVKRVQMHIAGYLCGN*
Ga0075433_1003422043300006852Populus RhizosphereMKEKAALIVFGLVLVFGGATSSDAQVKRVQMHIAGYLCGN*
Ga0075433_1011314633300006852Populus RhizosphereMKKKSALIVFGLVLIFGGASSSPAQVKRVQMHIAGYLCGN*
Ga0075434_10097536623300006871Populus RhizosphereMKKKVALIIFALVVVFGGATRSEAQVKRVQMHIAGYLCGN*
Ga0079215_1106659923300006894Agricultural SoilNIQSGEKKMKGKAVLSLFVLILIFGGATRSSAQVKRVQMHIAGYLCGN*
Ga0075424_10047532413300006904Populus RhizosphereKKKAALIIGLVLVFGGATRSHAQVKRVRMHIAGYLCGN*
Ga0075424_10065665233300006904Populus RhizosphereMKKRVALIIFGLVVVFGSATRSKAQVKRVQMHIAGYLCGN*
Ga0075424_10118604913300006904Populus RhizosphereMKQKTALIVLGLALVFGGATRSDAQVKRVQMHIAGYLCGN*
Ga0079219_1000340293300006954Agricultural SoilMKKKTALILLAVALGFGIATRSDAQVKRVQMHIAGYLCGN*
Ga0079219_1020160223300006954Agricultural SoilMKKKVALIVFGLVLVFGGATRAEAQVKRVQMHIAGYLCGN*
Ga0079219_1025709323300006954Agricultural SoilMNKTAVLFVFALFVLCLTATHGAAQVKRVQMHIAGYLCGN*
Ga0079219_1152814923300006954Agricultural SoilMKQKLTLIVLGLVLVFGGASRADAQVKRVQMHIAGYLCGN*
Ga0111539_1008371053300009094Populus RhizosphereMKTRTVPIVLGLIFVFGNGSGAIAQVRRVQMHIAGYLCGN*
Ga0111539_1047430313300009094Populus RhizosphereALIIGLVLVFGGATRSHAQVKRVRMHIAGYLCGN*
Ga0114129_1031467543300009147Populus RhizosphereMRKNTALIVFGLLLVFGSASRSSAQVKQVQMHIAGYLCGN*
Ga0075423_1086176933300009162Populus RhizosphereMKKKVALIIFGLVVVFGGATRSKAQVKRVQMHIAGYLCGN*
Ga0105241_1021699123300009174Corn RhizosphereMKEKTALIFFGLALVLGGATRSDAQVKRVQMHIAGYLCGN*
Ga0105242_1078579123300009176Miscanthus RhizosphereMLIYSGEEMIKKAALIVFGLVLVFGGATRSDAQVKRVQMHIAGYLCGN*
Ga0105242_1095043813300009176Miscanthus RhizosphereKMKKTSLFTFGLLLLFGSATHSAAQVKRVQMHIAGYLCGN*
Ga0105238_1191459223300009551Corn RhizosphereMKKKTALIVFGLVLVLGGATHSGAQVKRVQMHIAGYLCGN*
Ga0126315_1021682623300010038Serpentine SoilMKKKIALIVFGLVLVFGSASRSEAQVKRVQMHIAGYLCGN*
Ga0126384_1054591623300010046Tropical Forest SoilMKKKTALSVLGLVLVFSAATRSAAQVRRVQMHIAGYLCGN*
Ga0126384_1201705313300010046Tropical Forest SoilMKRKAILSLFGLCLMFDAATSAAAQVKRVQMHIAGYLCGN*
Ga0126384_1218933613300010046Tropical Forest SoilKMKKKTALIVFGLALVLGGATRSDAQVKRVQMHIAGYLCGN*
Ga0126382_1161689423300010047Tropical Forest SoilMKKKAALIVFGLVLVFGSASRSDAQVKRVQMHIAGYLCGN*
Ga0126370_1102097613300010358Tropical Forest SoilMKKKTALVVFGLILVFGGAVRSTAQVKRVQMHIAGYLCGN*
Ga0126376_10000186293300010359Tropical Forest SoilMKKKTALIVFGLALVLGGATRSDGQVKRVQMHIAGYLCGN*
Ga0126376_10001062143300010359Tropical Forest SoilMKKKAALIVFGLVLVFGGATRSAAQVKRVQMHIAGYLCGN*
Ga0126376_1000407063300010359Tropical Forest SoilVAAFDLPGEKMKKKTALIVFGVALVFGGATRSDAQVKRVQMHIAGYLCGN*
Ga0126377_1033810623300010362Tropical Forest SoilMKQRVTLIVFGLVIIFGGAARSAAQVKRVQMHIAGYLCGN*
Ga0126377_1081500223300010362Tropical Forest SoilLIWINLEKKMKKRAVLLIIVLVLVFGGAARSTAQVKRVQMHIAGYLCGN*
Ga0134126_1075790923300010396Terrestrial SoilMKEKVALIIFSLVFVFGGATRAEAQVKRVQMHIAGYLCGN*
Ga0134126_1306409813300010396Terrestrial SoilMKKKTAVIIFGLALVFAGATRSEAQVQRVQMHIAGYLCGN*
Ga0134124_1008922033300010397Terrestrial SoilMKKQTALIVFGLVVVFGGATRAGAQVKRVQMHIAGYLCGN*
Ga0134124_1110241323300010397Terrestrial SoilMVMVVESGEKMKKKTALIVFGLVLVLSGATRSSAQVKRVQMHIAGYLCGN*
Ga0134124_1127549523300010397Terrestrial SoilMQKKTSLIVFSLALVFGGATCASAQVKRVQMHIAGYLCGN*
Ga0134127_1007342663300010399Terrestrial SoilSGEKMKKKTALLVFGLVLVFGGATRSNAQVKRVQMHIAGYLCGN*
Ga0134127_1136795123300010399Terrestrial SoilMKKKTALIVFGLVLVFSGATRSEAQVKRVQMHIAGYLCGN*
Ga0134127_1340511613300010399Terrestrial SoilIRSEEMIKKAALIVCGLVLVFGSAARSDAQVKRVQMHIAGYLCGN*
Ga0134122_1048560423300010400Terrestrial SoilMKKKAALIIFGLVLVFGGATRSTAQVKRVQMHIAGYLCGN*
Ga0134122_1054294813300010400Terrestrial SoilMKRTKVLFVFMLLLGGATHAAAQVKRVQMHIAGYL
Ga0134123_1259347723300010403Terrestrial SoilMKKKTALIVFGLVLVFGGATRSNAQVKRVQMHIAGYLCGN*
Ga0127502_1134467913300011333SoilKKAVISFGLLLLFGGATQSAAQVKRVQMRIAGYLCGN*
Ga0136632_1004326523300012093Polar Desert SandMKKHSLLALLGLVMVFGGATTSKAEVKRVQMHIAGYLCGN*
Ga0164299_1078130123300012958SoilMIKKAALIICGLVLVFGSAARSDAQVKRVQMHIAGYLCGN*
Ga0157378_1267333223300013297Miscanthus RhizosphereMKKKSVLIVLGLVLVFGSASGAGAQVKQVQMHIAGYLCGN*
Ga0157372_1151035623300013307Corn RhizosphereMKKKTALIVFGLVLVFGGVSRSEAQVKRVQMHIAGYLCGN*
Ga0157375_1001710223300013308Miscanthus RhizosphereMKKKAALAIVGLVLVFGGAIRSQAQVKRVQMHIAGYLCGN*
Ga0157380_1006630233300014326Switchgrass RhizosphereMKKKTVLIVLGLVLVFGSASGAGAQVKRVQMHIAGYLCGN*
Ga0182008_1058427713300014497RhizosphereQQHRREKMKQKITLIILGLVLVFGGASRAGAQVKRIQMHIAGYLCGN*
Ga0182007_1007254423300015262RhizosphereMKKKVALIIFSLVFVFGGATRSEAQVKRVQMHIAGYLCGN*
Ga0132258_1213074223300015371Arabidopsis RhizosphereMKKKIALLVFGLAVVFVGAARSDAQVKRVQMHIAGYLCGN*
Ga0132258_1264883923300015371Arabidopsis RhizosphereMKNKTALIVFGLVLVFGGATRSDAQVKRVQMHIAGYLCGN*
Ga0132255_10104039923300015374Arabidopsis RhizosphereMKNTVLIIFGLLVLFGSSGNSAAQVKRIQMHIAGYLCGN*
Ga0132255_10380040223300015374Arabidopsis RhizosphereMKKKTALLIVGLVLVFGGATRSAAQVKRVQMHIAGYLCGN*
Ga0190265_100000102113300018422SoilMKTKSLLIAFTLIVLFGNASSSNAQVKQVQMHIAGYLCGN
Ga0187893_1083483423300019487Microbial Mat On RocksMIKKTALIVFGLVLVFGGATRSAAQVKRVQMHIAGYLCGN
Ga0196977_1000598123300020146SoilMIKQAALIIFGLVLVFGGATRSEAQVKRVQMHIAGYLCGN
Ga0182009_1003704733300021445SoilGDLQHRREKMKQKITLIILGLVLVFGGASRAGAQVKRIQMHIAGYLCGN
Ga0182009_1009766333300021445SoilMKQIATLIGLGLVLVFGGATRSAAQVKRVQMHIAGYLCGN
Ga0182009_1018135523300021445SoilMIKKATLIVFSLVVVFGGATRSYAQVKRVQMHIAGYLCGN
Ga0182009_1018773923300021445SoilMIKKAALIVFCLFVMFGGATRSQAQVKRVQMHIAGYLCGN
Ga0182009_1034307223300021445SoilMKKKVALIIFSLVFVFGGATRSEAQVKRVQMHIAGYLCGN
Ga0182009_1036877313300021445SoilMKQKITLIILGLVLVFGGASRAGAQVKRIQMHIAG
Ga0247695_100033133300024179SoilMKKRTALIVFGLCLVLCSVTNAAAQVKRVQMHIAGYLCGN
Ga0207707_1053180413300025912Corn RhizosphereGDLQQHRREKMKQKITLIILGLVLVFGGASRAGAQVKRIQMHIAGYLCGN
Ga0207694_1040750523300025924Corn RhizosphereMKKTTVLFTFGLVLLFGGATHSAAQVKRVQMHIAGYLCGN
Ga0207650_1018219323300025925Switchgrass RhizosphereMKTVLLTGLLIIGGCAVRCDAQVKRIQMHIAGYLCGN
Ga0207701_1080297223300025930Corn, Switchgrass And Miscanthus RhizosphereMKKKTVLIVLGLVLVFGSATGAGAQVKQVQMHIAGYLCGN
Ga0207690_1013761213300025932Corn RhizosphereMIRRATLIVFGLVLVFGGAARSEAQVKRVQMHIAGYLCGN
Ga0207670_1000204353300025936Switchgrass RhizosphereMKKKTVLIVLGLVLVFGSASRAGAQVRQVQMHIEGYLCGN
Ga0207665_1082975723300025939Corn, Switchgrass And Miscanthus RhizosphereMKKKAILIMFGLCFVFVSAITAAAQVKRVQMHIAGYLCGN
Ga0207691_1027883923300025940Miscanthus RhizosphereMKKKTVLIVLGLVLVFGSASGAGAQVKRVQMHIAGYLCGN
Ga0207641_1033534723300026088Switchgrass RhizosphereMKKKAALIIGLVLVFGGATRSHAQVKRVRMHIAGYLCGN
Ga0207675_10151284223300026118Switchgrass RhizosphereRTLLIVLGLVLVCASGSGAVAQVKRVQMHIAGYLCGN
Ga0209177_1006454633300027775Agricultural SoilMKKKTALILFAVALGFGIATRSDAQVKRVQMHIAGYLCGN
Ga0207428_1001185863300027907Populus RhizosphereMKKTTVIFTFGLMLLFGGATHSSAQVKRVQMHIAGYLCGN
Ga0268264_1023612423300028381Switchgrass RhizosphereMKKKTVLIVLGLVLVFGSASRAGAQVKQVQMHIEGYLCGN
Ga0268241_1019436313300030511SoilMKKKAALIVFVLVVVFGGATRSEAQVKRVQMHIAGYLCGN
Ga0310813_1005534973300031716SoilMKKKTALSVFCLVLVFGGVTRSEAQVKRVQMHIAGYLCGN
Ga0307410_1004671433300031852RhizosphereMRKKTALILFGLVLVFGSASRSDAQVKRVQMHIGGYLCGN
Ga0308173_1222449813300032074SoilLYQEKEMKKKAALLVVGLVLVFGGATRSNAQVKRVQMHIAGYLCGN
Ga0268251_1032162223300032159AgaveMKKKMALIVFGLVLVFGSASRSEAQVKRVQMHIAGYLCGN
Ga0310810_1038262123300033412SoilMKILLTFGLVLLLGGAVHTSAQVKRIQMHIAGYLCGN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.