| Basic Information | |
|---|---|
| Family ID | F052185 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 143 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKKKTALIVFGLVLVFGGATRSDAQVKRVQMHIAGYLCGN |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 73.94 % |
| % of genes near scaffold ends (potentially truncated) | 13.99 % |
| % of genes from short scaffolds (< 2000 bps) | 80.42 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.804 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (9.091 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.070 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (60.839 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF07681 | DoxX | 6.29 |
| PF00403 | HMA | 3.50 |
| PF13411 | MerR_1 | 2.10 |
| PF01641 | SelR | 1.40 |
| PF00578 | AhpC-TSA | 1.40 |
| PF12704 | MacB_PCD | 1.40 |
| PF03595 | SLAC1 | 0.70 |
| PF00311 | PEPcase | 0.70 |
| PF12270 | Cyt_c_ox_IV | 0.70 |
| PF13428 | TPR_14 | 0.70 |
| PF07589 | PEP-CTERM | 0.70 |
| PF01053 | Cys_Met_Meta_PP | 0.70 |
| PF01022 | HTH_5 | 0.70 |
| PF13424 | TPR_12 | 0.70 |
| PF07690 | MFS_1 | 0.70 |
| PF04073 | tRNA_edit | 0.70 |
| PF13557 | Phenol_MetA_deg | 0.70 |
| PF13429 | TPR_15 | 0.70 |
| PF09990 | DUF2231 | 0.70 |
| PF03544 | TonB_C | 0.70 |
| PF07885 | Ion_trans_2 | 0.70 |
| PF01209 | Ubie_methyltran | 0.70 |
| PF04820 | Trp_halogenase | 0.70 |
| PF09278 | MerR-DNA-bind | 0.70 |
| PF12695 | Abhydrolase_5 | 0.70 |
| PF13519 | VWA_2 | 0.70 |
| PF00582 | Usp | 0.70 |
| PF00072 | Response_reg | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 6.29 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 6.29 |
| COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 3.50 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 3.50 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 1.40 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.70 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.70 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.70 |
| COG2352 | Phosphoenolpyruvate carboxylase | Energy production and conversion [C] | 0.70 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.70 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.70 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.70 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.70 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG1275 | Tellurite resistance protein TehA and related permeases | Defense mechanisms [V] | 0.70 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
| COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.70 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.70 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.70 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.70 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.80 % |
| Unclassified | root | N/A | 4.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886011|MRS1b_contig_8782280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 1180 | Open in IMG/M |
| 2162886012|MBSR1b_contig_8547268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 1707 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101196415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 772 | Open in IMG/M |
| 3300000953|JGI11615J12901_10354797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 896 | Open in IMG/M |
| 3300000953|JGI11615J12901_10403850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
| 3300000956|JGI10216J12902_124172037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 804 | Open in IMG/M |
| 3300003203|JGI25406J46586_10056375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 1290 | Open in IMG/M |
| 3300004016|Ga0058689_10161313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300004157|Ga0062590_102827632 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300004480|Ga0062592_101201082 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005289|Ga0065704_10167828 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1310 | Open in IMG/M |
| 3300005289|Ga0065704_10730918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300005293|Ga0065715_10126471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 2108 | Open in IMG/M |
| 3300005294|Ga0065705_10198704 | Not Available | 1420 | Open in IMG/M |
| 3300005332|Ga0066388_106531477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300005339|Ga0070660_100238049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1482 | Open in IMG/M |
| 3300005340|Ga0070689_100006965 | All Organisms → cellular organisms → Bacteria | 7876 | Open in IMG/M |
| 3300005344|Ga0070661_101880021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300005345|Ga0070692_11172221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300005440|Ga0070705_100131380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 1634 | Open in IMG/M |
| 3300005440|Ga0070705_100243193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1259 | Open in IMG/M |
| 3300005441|Ga0070700_100021187 | All Organisms → cellular organisms → Bacteria | 3775 | Open in IMG/M |
| 3300005444|Ga0070694_100176383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1578 | Open in IMG/M |
| 3300005444|Ga0070694_100626622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 868 | Open in IMG/M |
| 3300005457|Ga0070662_101254275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300005458|Ga0070681_10051691 | All Organisms → cellular organisms → Bacteria | 4099 | Open in IMG/M |
| 3300005458|Ga0070681_10471523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1168 | Open in IMG/M |
| 3300005458|Ga0070681_10864879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300005458|Ga0070681_11605532 | Not Available | 576 | Open in IMG/M |
| 3300005459|Ga0068867_100731697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300005459|Ga0068867_101393960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300005530|Ga0070679_101058092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300005545|Ga0070695_100093785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 2009 | Open in IMG/M |
| 3300005545|Ga0070695_100361789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1090 | Open in IMG/M |
| 3300005547|Ga0070693_100128327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1581 | Open in IMG/M |
| 3300005562|Ga0058697_10174556 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300005564|Ga0070664_101246893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 702 | Open in IMG/M |
| 3300005564|Ga0070664_101307270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300005578|Ga0068854_102222823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300005614|Ga0068856_101159087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300005617|Ga0068859_100081984 | All Organisms → cellular organisms → Bacteria | 3268 | Open in IMG/M |
| 3300005617|Ga0068859_100467096 | Not Available | 1357 | Open in IMG/M |
| 3300005617|Ga0068859_100833805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1009 | Open in IMG/M |
| 3300005618|Ga0068864_100522499 | Not Available | 1144 | Open in IMG/M |
| 3300005719|Ga0068861_101352941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300005843|Ga0068860_100702387 | Not Available | 1021 | Open in IMG/M |
| 3300005843|Ga0068860_101446576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300005844|Ga0068862_100792764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300005844|Ga0068862_102272947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300005886|Ga0075286_1020420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 831 | Open in IMG/M |
| 3300006058|Ga0075432_10474988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300006169|Ga0082029_1288535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 841 | Open in IMG/M |
| 3300006173|Ga0070716_100822385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 721 | Open in IMG/M |
| 3300006196|Ga0075422_10578204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300006755|Ga0079222_10099511 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300006755|Ga0079222_10810290 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300006755|Ga0079222_11519994 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300006804|Ga0079221_10304261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300006806|Ga0079220_10047543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2004 | Open in IMG/M |
| 3300006852|Ga0075433_10034220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4362 | Open in IMG/M |
| 3300006852|Ga0075433_10113146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2407 | Open in IMG/M |
| 3300006871|Ga0075434_100975366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300006894|Ga0079215_11066599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300006904|Ga0075424_100475324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1334 | Open in IMG/M |
| 3300006904|Ga0075424_100656652 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300006904|Ga0075424_101186049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 813 | Open in IMG/M |
| 3300006954|Ga0079219_10003402 | All Organisms → cellular organisms → Bacteria | 4517 | Open in IMG/M |
| 3300006954|Ga0079219_10201602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1129 | Open in IMG/M |
| 3300006954|Ga0079219_10257093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300006954|Ga0079219_11528149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 606 | Open in IMG/M |
| 3300009094|Ga0111539_10083710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3751 | Open in IMG/M |
| 3300009094|Ga0111539_10474303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1457 | Open in IMG/M |
| 3300009147|Ga0114129_10314675 | All Organisms → cellular organisms → Bacteria | 2083 | Open in IMG/M |
| 3300009162|Ga0075423_10861769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300009174|Ga0105241_10216991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 1606 | Open in IMG/M |
| 3300009176|Ga0105242_10785791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 941 | Open in IMG/M |
| 3300009176|Ga0105242_10950438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300009551|Ga0105238_11914592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300010038|Ga0126315_10216826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
| 3300010046|Ga0126384_10545916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 1006 | Open in IMG/M |
| 3300010046|Ga0126384_12017053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 552 | Open in IMG/M |
| 3300010046|Ga0126384_12189336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300010047|Ga0126382_11616894 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300010358|Ga0126370_11020976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 756 | Open in IMG/M |
| 3300010359|Ga0126376_10000186 | All Organisms → cellular organisms → Bacteria | 29122 | Open in IMG/M |
| 3300010359|Ga0126376_10001062 | All Organisms → cellular organisms → Bacteria | 14537 | Open in IMG/M |
| 3300010359|Ga0126376_10004070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8569 | Open in IMG/M |
| 3300010362|Ga0126377_10338106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1498 | Open in IMG/M |
| 3300010362|Ga0126377_10815002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 993 | Open in IMG/M |
| 3300010396|Ga0134126_10757909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 1099 | Open in IMG/M |
| 3300010396|Ga0134126_13064098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300010397|Ga0134124_10089220 | All Organisms → cellular organisms → Bacteria | 2664 | Open in IMG/M |
| 3300010397|Ga0134124_11102413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300010397|Ga0134124_11275495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 757 | Open in IMG/M |
| 3300010399|Ga0134127_10073426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2912 | Open in IMG/M |
| 3300010399|Ga0134127_11367951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300010399|Ga0134127_13405116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300010400|Ga0134122_10485604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1114 | Open in IMG/M |
| 3300010400|Ga0134122_10542948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 1061 | Open in IMG/M |
| 3300010403|Ga0134123_12593477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300011333|Ga0127502_11344679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300012093|Ga0136632_10043265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2065 | Open in IMG/M |
| 3300012958|Ga0164299_10781301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300013297|Ga0157378_12673332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300013307|Ga0157372_11510356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300013308|Ga0157375_10017102 | All Organisms → cellular organisms → Bacteria | 6536 | Open in IMG/M |
| 3300014326|Ga0157380_10066302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2903 | Open in IMG/M |
| 3300014497|Ga0182008_10584277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300015262|Ga0182007_10072544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
| 3300015371|Ga0132258_12130742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 1409 | Open in IMG/M |
| 3300015371|Ga0132258_12648839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1252 | Open in IMG/M |
| 3300015374|Ga0132255_101040399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1229 | Open in IMG/M |
| 3300015374|Ga0132255_103800402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300018422|Ga0190265_10000010 | All Organisms → cellular organisms → Bacteria | 258474 | Open in IMG/M |
| 3300019487|Ga0187893_10834834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300020146|Ga0196977_1000598 | All Organisms → cellular organisms → Bacteria | 17998 | Open in IMG/M |
| 3300021445|Ga0182009_10037047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1992 | Open in IMG/M |
| 3300021445|Ga0182009_10097663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1335 | Open in IMG/M |
| 3300021445|Ga0182009_10181355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 1016 | Open in IMG/M |
| 3300021445|Ga0182009_10187739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
| 3300021445|Ga0182009_10343072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300021445|Ga0182009_10368773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 736 | Open in IMG/M |
| 3300024179|Ga0247695_1000331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6859 | Open in IMG/M |
| 3300025912|Ga0207707_10531804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
| 3300025924|Ga0207694_10407505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
| 3300025925|Ga0207650_10182193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1674 | Open in IMG/M |
| 3300025930|Ga0207701_10802972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300025932|Ga0207690_10137612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1795 | Open in IMG/M |
| 3300025936|Ga0207670_10002043 | All Organisms → cellular organisms → Bacteria | 10583 | Open in IMG/M |
| 3300025939|Ga0207665_10829757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_57_8 | 731 | Open in IMG/M |
| 3300025940|Ga0207691_10278839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1438 | Open in IMG/M |
| 3300026088|Ga0207641_10335347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1438 | Open in IMG/M |
| 3300026118|Ga0207675_101512842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300027775|Ga0209177_10064546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
| 3300027907|Ga0207428_10011858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7680 | Open in IMG/M |
| 3300028381|Ga0268264_10236124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1691 | Open in IMG/M |
| 3300030511|Ga0268241_10194363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300031716|Ga0310813_10055349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2939 | Open in IMG/M |
| 3300031852|Ga0307410_10046714 | All Organisms → cellular organisms → Bacteria | 2890 | Open in IMG/M |
| 3300032074|Ga0308173_12224498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300032159|Ga0268251_10321622 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300033412|Ga0310810_10382621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1463 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 8.39% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 7.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 7.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.90% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.20% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.40% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.40% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.40% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.70% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.70% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.70% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.70% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.70% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.70% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.70% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.70% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300020146 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MRS1b_1000.00001870 | 2162886011 | Miscanthus Rhizosphere | MKKKAALVIFGLVLVFGGAIRSDAQVKQVQMHIAGY |
| MBSR1b_0678.00004480 | 2162886012 | Miscanthus Rhizosphere | MKKKAALVIFGLVLVFGGAIRSDAQVKQVQMHIAGYLCGN |
| INPhiseqgaiiFebDRAFT_1011964152 | 3300000364 | Soil | MKKKAALIIGLVLVFGGATRSHAQVKRVRMHIAGYLCGN* |
| JGI11615J12901_103547973 | 3300000953 | Soil | MRKKAALVVFGVILILGAASHSGGQVKRVQMHIAGYLCGN* |
| JGI11615J12901_104038501 | 3300000953 | Soil | MKKKTALIIVGLVLVFGGATRSAAQVKRVQMHIAGYLCGN* |
| JGI10216J12902_1241720372 | 3300000956 | Soil | MGKKVALIVFGLVVVLGGVTRSDAQVKRVQMHIAGYLCGN* |
| JGI25406J46586_100563752 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MKTKAALIVFSLVVVLGGATRSEAQVKRVQMHIAGYLCGN* |
| Ga0058689_101613131 | 3300004016 | Agave | MKAKAVLIVLGLVLMVGGASRVEAQVKRVQMRIAGYLCGN* |
| Ga0062590_1028276322 | 3300004157 | Soil | MKKKTALTVLGLALVFAGATRSEAQVKRVQMHIAGYLCGN* |
| Ga0062592_1012010822 | 3300004480 | Soil | MKKKTALIVFGLVLVFGGATRSDAQVKRVQMHIAGYLCGN* |
| Ga0065704_101678282 | 3300005289 | Switchgrass Rhizosphere | MKKKTALIVVGLVLVFGGATRSAAQVKRVQMHIAGYLCGN* |
| Ga0065704_107309182 | 3300005289 | Switchgrass Rhizosphere | MKKKTALIVFGLVFVFGGATRSYAQVKRVQMHIAGYLCGN* |
| Ga0065715_101264712 | 3300005293 | Miscanthus Rhizosphere | MQKKTSLVVLSLALVFGGATCASAQVKRVQMHIAGYLCGN* |
| Ga0065705_101987041 | 3300005294 | Switchgrass Rhizosphere | MKKKTALIVLGLALVFAGATRSEAQVKRVQMHIAGYLCGN* |
| Ga0066388_1065314772 | 3300005332 | Tropical Forest Soil | MKKKAVLIVFGLVLVFGGASRSAAQVKRVQMHIAGYLCGN* |
| Ga0070660_1002380493 | 3300005339 | Corn Rhizosphere | MIRRATLIVFGLVLVFGGAARSEAQVKRVQMHIAGYLCGN* |
| Ga0070689_1000069655 | 3300005340 | Switchgrass Rhizosphere | MKKKTVLIVLGLVLVFGSASRAGAQVRQVQMHIEGYLCGN* |
| Ga0070661_1018800211 | 3300005344 | Corn Rhizosphere | ERQMRKRIAVIVFGLVLVCSVATRAEAQVKRVQMHIAGYLCGN* |
| Ga0070692_111722212 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKKAVLIVFSLVFVFAGATRSEAQVKRVQMHIAGYLCGN* |
| Ga0070705_1001313802 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQKTALIVVGLILMFGSATRSEAQVKRVQMHIAGYLCGN* |
| Ga0070705_1002431932 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKKVALIIFGLVLVFGGATRSSAQVKRVQMHIAGYLCGN* |
| Ga0070700_1000211871 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKTTVLFTFGLVLLFGGATHSAAQVKRVQMHIAGYLCGN* |
| Ga0070694_1001763832 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKKAALIIGLVLVFGGAARSHAQVKRVRMHIAGYLCGN* |
| Ga0070694_1006266221 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MAALIQSGEKMKEKTALIVLGLALVFGGATRSDAQVKRVQMHIAGYLCGN* |
| Ga0070662_1012542752 | 3300005457 | Corn Rhizosphere | MKEKTALIVLGLALVFGGATRSDAQVKRVQMHIAGYLCGN* |
| Ga0070681_100516917 | 3300005458 | Corn Rhizosphere | MQKKTSLIVLSLALVFGGATCASAQVKRVQMHIAGYLCGN* |
| Ga0070681_104715231 | 3300005458 | Corn Rhizosphere | MKKKTALIVFGLLVVFASAMRSEAQVKRVQMHIAGYLCGN* |
| Ga0070681_108648792 | 3300005458 | Corn Rhizosphere | MKQKITLIILGLVLVFGGASRAGAQVKRIQMHIAGYLCGN* |
| Ga0070681_116055322 | 3300005458 | Corn Rhizosphere | MKKRVAVIVFGLVLVCSAATRAEAQVKRVQMHIAGYLCGN* |
| Ga0068867_1007316971 | 3300005459 | Miscanthus Rhizosphere | MMKKAALIVFGLILVFGGATRSDAQVKRVQMHIAGYLCGN* |
| Ga0068867_1013939602 | 3300005459 | Miscanthus Rhizosphere | MKKKTVLIVLGLVLVFGSASGAGAQVKQVQMHIAGYLCGN* |
| Ga0070679_1010580921 | 3300005530 | Corn Rhizosphere | MKKRVAVIVFGLVLVCSVATRAEAQVKRVQMHIAGYLCGN* |
| Ga0070695_1000937852 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKEKTALIVLGLALVFGGATRSEAQVKRVQMHIAGYLCGN* |
| Ga0070695_1003617892 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKKAALIIGLVLVFGGANRSHAQVKRVRMHIAGYLCGN* |
| Ga0070693_1001283272 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKKAALIIFGLVLVFGGAIRSTAQVKRVQMHIAGYLCGN* |
| Ga0058697_101745563 | 3300005562 | Agave | MKKKTALIVFGLVLVFGSASRSDAQVKRVQMHIAGYLCGN* |
| Ga0070664_1012468932 | 3300005564 | Corn Rhizosphere | MIKKAALIVCGLVLVFGSATRSAAQVKRVQMHIAGYLCGN* |
| Ga0070664_1013072702 | 3300005564 | Corn Rhizosphere | MEKKTALIVLGLVLVFGGATRTTAQVKRVQMHIAGYLCGN* |
| Ga0068854_1022228232 | 3300005578 | Corn Rhizosphere | MKKRIAVIVFGLVLVCSVATRAEAQVKRVQMHIAGYLCGN* |
| Ga0068856_1011590871 | 3300005614 | Corn Rhizosphere | MKKKVLIVFALVVVCGGATRSDAQVKRVQMHIAGYLCGN* |
| Ga0068859_1000819841 | 3300005617 | Switchgrass Rhizosphere | MKTKAVSLIILFVFLGSVVRSDAQVKQVQMHIAGYLCGN* |
| Ga0068859_1004670961 | 3300005617 | Switchgrass Rhizosphere | MKKTVLFTFGLVLLFGSASHSAAQVKRVQMHIAGYLCGN* |
| Ga0068859_1008338052 | 3300005617 | Switchgrass Rhizosphere | MKNTILFSLGLLLLFGSSGNSAAQVKRVQMHIAGYLCGN* |
| Ga0068864_1005224992 | 3300005618 | Switchgrass Rhizosphere | MKKKTVLIVLGLVLVFGSASRAGAQVKQVQMHIEGYLCGN* |
| Ga0068861_1013529412 | 3300005719 | Switchgrass Rhizosphere | LQRKFTLVFAGLILLFGGAFGCSAQVKRVQMHIAGYLCGN* |
| Ga0068860_1007023872 | 3300005843 | Switchgrass Rhizosphere | LQRKFTLVVAGLILLLGSAFGCGAQVKRVQMHIAGYLCGN* |
| Ga0068860_1014465762 | 3300005843 | Switchgrass Rhizosphere | MQKRTLLIVLGLVFVCVSGSGAVAQVKRVQMHIAGYLCGN* |
| Ga0068862_1007927642 | 3300005844 | Switchgrass Rhizosphere | MKKKTVLIVLGLVLVFGSASRAGAQVKRVQMHIEGYLCGN* |
| Ga0068862_1022729472 | 3300005844 | Switchgrass Rhizosphere | MKTKALLMVGLVLVFGCATRSSAQVKRVQMHIAGYLCGN* |
| Ga0075286_10204202 | 3300005886 | Rice Paddy Soil | MIKKAALIVCGLVLVFGNATRSDAQVKRVQMHIAGYLCGN* |
| Ga0075432_104749882 | 3300006058 | Populus Rhizosphere | MKKKAALTIVGLVFVFGGAIRSDAQVKRVQMHIAGYLCGN* |
| Ga0082029_12885351 | 3300006169 | Termite Nest | MTAYLIRREEMKKRAALFVFGLVLVLGGATRSDAQVKRVQMHIAGYLCGN* |
| Ga0070716_1008223852 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKKAILIMFGLCFVFVSAITAAAQVKRVQMHIAGYLCGN* |
| Ga0070716_1011688162 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MQKKTSLVVFSLALVFGGATCASAQVKRVQMHIAGYLCGN* |
| Ga0075422_105782042 | 3300006196 | Populus Rhizosphere | MKKKTALIVFGLVLVLAGVTRSEAQVKRVQMHIAGYLCGN* |
| Ga0079222_100995113 | 3300006755 | Agricultural Soil | MKKKVALIVFGLVLVFGGATRAEAQVKRVQMHIAGYLCSN* |
| Ga0079222_108102902 | 3300006755 | Agricultural Soil | MLGKLFRISFGLVLLFGVLSSSEAQVKRVQMHIAGYLCGN* |
| Ga0079222_115199942 | 3300006755 | Agricultural Soil | MKQKLTLIVLGLVLVFGGASRAGAQVKRIQMHIAGYLCGN* |
| Ga0079221_103042611 | 3300006804 | Agricultural Soil | KKMKQKLTLIVLGLVLVFGGASRAGAQVKRIQMHIAGYLCGN* |
| Ga0079220_100475432 | 3300006806 | Agricultural Soil | MKKKTALILFAVALGFGIATRSDAQVKRVQMHIAGYLCGN* |
| Ga0075433_100342204 | 3300006852 | Populus Rhizosphere | MKEKAALIVFGLVLVFGGATSSDAQVKRVQMHIAGYLCGN* |
| Ga0075433_101131463 | 3300006852 | Populus Rhizosphere | MKKKSALIVFGLVLIFGGASSSPAQVKRVQMHIAGYLCGN* |
| Ga0075434_1009753662 | 3300006871 | Populus Rhizosphere | MKKKVALIIFALVVVFGGATRSEAQVKRVQMHIAGYLCGN* |
| Ga0079215_110665992 | 3300006894 | Agricultural Soil | NIQSGEKKMKGKAVLSLFVLILIFGGATRSSAQVKRVQMHIAGYLCGN* |
| Ga0075424_1004753241 | 3300006904 | Populus Rhizosphere | KKKAALIIGLVLVFGGATRSHAQVKRVRMHIAGYLCGN* |
| Ga0075424_1006566523 | 3300006904 | Populus Rhizosphere | MKKRVALIIFGLVVVFGSATRSKAQVKRVQMHIAGYLCGN* |
| Ga0075424_1011860491 | 3300006904 | Populus Rhizosphere | MKQKTALIVLGLALVFGGATRSDAQVKRVQMHIAGYLCGN* |
| Ga0079219_100034029 | 3300006954 | Agricultural Soil | MKKKTALILLAVALGFGIATRSDAQVKRVQMHIAGYLCGN* |
| Ga0079219_102016022 | 3300006954 | Agricultural Soil | MKKKVALIVFGLVLVFGGATRAEAQVKRVQMHIAGYLCGN* |
| Ga0079219_102570932 | 3300006954 | Agricultural Soil | MNKTAVLFVFALFVLCLTATHGAAQVKRVQMHIAGYLCGN* |
| Ga0079219_115281492 | 3300006954 | Agricultural Soil | MKQKLTLIVLGLVLVFGGASRADAQVKRVQMHIAGYLCGN* |
| Ga0111539_100837105 | 3300009094 | Populus Rhizosphere | MKTRTVPIVLGLIFVFGNGSGAIAQVRRVQMHIAGYLCGN* |
| Ga0111539_104743031 | 3300009094 | Populus Rhizosphere | ALIIGLVLVFGGATRSHAQVKRVRMHIAGYLCGN* |
| Ga0114129_103146754 | 3300009147 | Populus Rhizosphere | MRKNTALIVFGLLLVFGSASRSSAQVKQVQMHIAGYLCGN* |
| Ga0075423_108617693 | 3300009162 | Populus Rhizosphere | MKKKVALIIFGLVVVFGGATRSKAQVKRVQMHIAGYLCGN* |
| Ga0105241_102169912 | 3300009174 | Corn Rhizosphere | MKEKTALIFFGLALVLGGATRSDAQVKRVQMHIAGYLCGN* |
| Ga0105242_107857912 | 3300009176 | Miscanthus Rhizosphere | MLIYSGEEMIKKAALIVFGLVLVFGGATRSDAQVKRVQMHIAGYLCGN* |
| Ga0105242_109504381 | 3300009176 | Miscanthus Rhizosphere | KMKKTSLFTFGLLLLFGSATHSAAQVKRVQMHIAGYLCGN* |
| Ga0105238_119145922 | 3300009551 | Corn Rhizosphere | MKKKTALIVFGLVLVLGGATHSGAQVKRVQMHIAGYLCGN* |
| Ga0126315_102168262 | 3300010038 | Serpentine Soil | MKKKIALIVFGLVLVFGSASRSEAQVKRVQMHIAGYLCGN* |
| Ga0126384_105459162 | 3300010046 | Tropical Forest Soil | MKKKTALSVLGLVLVFSAATRSAAQVRRVQMHIAGYLCGN* |
| Ga0126384_120170531 | 3300010046 | Tropical Forest Soil | MKRKAILSLFGLCLMFDAATSAAAQVKRVQMHIAGYLCGN* |
| Ga0126384_121893361 | 3300010046 | Tropical Forest Soil | KMKKKTALIVFGLALVLGGATRSDAQVKRVQMHIAGYLCGN* |
| Ga0126382_116168942 | 3300010047 | Tropical Forest Soil | MKKKAALIVFGLVLVFGSASRSDAQVKRVQMHIAGYLCGN* |
| Ga0126370_110209761 | 3300010358 | Tropical Forest Soil | MKKKTALVVFGLILVFGGAVRSTAQVKRVQMHIAGYLCGN* |
| Ga0126376_1000018629 | 3300010359 | Tropical Forest Soil | MKKKTALIVFGLALVLGGATRSDGQVKRVQMHIAGYLCGN* |
| Ga0126376_1000106214 | 3300010359 | Tropical Forest Soil | MKKKAALIVFGLVLVFGGATRSAAQVKRVQMHIAGYLCGN* |
| Ga0126376_100040706 | 3300010359 | Tropical Forest Soil | VAAFDLPGEKMKKKTALIVFGVALVFGGATRSDAQVKRVQMHIAGYLCGN* |
| Ga0126377_103381062 | 3300010362 | Tropical Forest Soil | MKQRVTLIVFGLVIIFGGAARSAAQVKRVQMHIAGYLCGN* |
| Ga0126377_108150022 | 3300010362 | Tropical Forest Soil | LIWINLEKKMKKRAVLLIIVLVLVFGGAARSTAQVKRVQMHIAGYLCGN* |
| Ga0134126_107579092 | 3300010396 | Terrestrial Soil | MKEKVALIIFSLVFVFGGATRAEAQVKRVQMHIAGYLCGN* |
| Ga0134126_130640981 | 3300010396 | Terrestrial Soil | MKKKTAVIIFGLALVFAGATRSEAQVQRVQMHIAGYLCGN* |
| Ga0134124_100892203 | 3300010397 | Terrestrial Soil | MKKQTALIVFGLVVVFGGATRAGAQVKRVQMHIAGYLCGN* |
| Ga0134124_111024132 | 3300010397 | Terrestrial Soil | MVMVVESGEKMKKKTALIVFGLVLVLSGATRSSAQVKRVQMHIAGYLCGN* |
| Ga0134124_112754952 | 3300010397 | Terrestrial Soil | MQKKTSLIVFSLALVFGGATCASAQVKRVQMHIAGYLCGN* |
| Ga0134127_100734266 | 3300010399 | Terrestrial Soil | SGEKMKKKTALLVFGLVLVFGGATRSNAQVKRVQMHIAGYLCGN* |
| Ga0134127_113679512 | 3300010399 | Terrestrial Soil | MKKKTALIVFGLVLVFSGATRSEAQVKRVQMHIAGYLCGN* |
| Ga0134127_134051161 | 3300010399 | Terrestrial Soil | IRSEEMIKKAALIVCGLVLVFGSAARSDAQVKRVQMHIAGYLCGN* |
| Ga0134122_104856042 | 3300010400 | Terrestrial Soil | MKKKAALIIFGLVLVFGGATRSTAQVKRVQMHIAGYLCGN* |
| Ga0134122_105429481 | 3300010400 | Terrestrial Soil | MKRTKVLFVFMLLLGGATHAAAQVKRVQMHIAGYL |
| Ga0134123_125934772 | 3300010403 | Terrestrial Soil | MKKKTALIVFGLVLVFGGATRSNAQVKRVQMHIAGYLCGN* |
| Ga0127502_113446791 | 3300011333 | Soil | KKAVISFGLLLLFGGATQSAAQVKRVQMRIAGYLCGN* |
| Ga0136632_100432652 | 3300012093 | Polar Desert Sand | MKKHSLLALLGLVMVFGGATTSKAEVKRVQMHIAGYLCGN* |
| Ga0164299_107813012 | 3300012958 | Soil | MIKKAALIICGLVLVFGSAARSDAQVKRVQMHIAGYLCGN* |
| Ga0157378_126733322 | 3300013297 | Miscanthus Rhizosphere | MKKKSVLIVLGLVLVFGSASGAGAQVKQVQMHIAGYLCGN* |
| Ga0157372_115103562 | 3300013307 | Corn Rhizosphere | MKKKTALIVFGLVLVFGGVSRSEAQVKRVQMHIAGYLCGN* |
| Ga0157375_100171022 | 3300013308 | Miscanthus Rhizosphere | MKKKAALAIVGLVLVFGGAIRSQAQVKRVQMHIAGYLCGN* |
| Ga0157380_100663023 | 3300014326 | Switchgrass Rhizosphere | MKKKTVLIVLGLVLVFGSASGAGAQVKRVQMHIAGYLCGN* |
| Ga0182008_105842771 | 3300014497 | Rhizosphere | QQHRREKMKQKITLIILGLVLVFGGASRAGAQVKRIQMHIAGYLCGN* |
| Ga0182007_100725442 | 3300015262 | Rhizosphere | MKKKVALIIFSLVFVFGGATRSEAQVKRVQMHIAGYLCGN* |
| Ga0132258_121307422 | 3300015371 | Arabidopsis Rhizosphere | MKKKIALLVFGLAVVFVGAARSDAQVKRVQMHIAGYLCGN* |
| Ga0132258_126488392 | 3300015371 | Arabidopsis Rhizosphere | MKNKTALIVFGLVLVFGGATRSDAQVKRVQMHIAGYLCGN* |
| Ga0132255_1010403992 | 3300015374 | Arabidopsis Rhizosphere | MKNTVLIIFGLLVLFGSSGNSAAQVKRIQMHIAGYLCGN* |
| Ga0132255_1038004022 | 3300015374 | Arabidopsis Rhizosphere | MKKKTALLIVGLVLVFGGATRSAAQVKRVQMHIAGYLCGN* |
| Ga0190265_10000010211 | 3300018422 | Soil | MKTKSLLIAFTLIVLFGNASSSNAQVKQVQMHIAGYLCGN |
| Ga0187893_108348342 | 3300019487 | Microbial Mat On Rocks | MIKKTALIVFGLVLVFGGATRSAAQVKRVQMHIAGYLCGN |
| Ga0196977_100059812 | 3300020146 | Soil | MIKQAALIIFGLVLVFGGATRSEAQVKRVQMHIAGYLCGN |
| Ga0182009_100370473 | 3300021445 | Soil | GDLQHRREKMKQKITLIILGLVLVFGGASRAGAQVKRIQMHIAGYLCGN |
| Ga0182009_100976633 | 3300021445 | Soil | MKQIATLIGLGLVLVFGGATRSAAQVKRVQMHIAGYLCGN |
| Ga0182009_101813552 | 3300021445 | Soil | MIKKATLIVFSLVVVFGGATRSYAQVKRVQMHIAGYLCGN |
| Ga0182009_101877392 | 3300021445 | Soil | MIKKAALIVFCLFVMFGGATRSQAQVKRVQMHIAGYLCGN |
| Ga0182009_103430722 | 3300021445 | Soil | MKKKVALIIFSLVFVFGGATRSEAQVKRVQMHIAGYLCGN |
| Ga0182009_103687731 | 3300021445 | Soil | MKQKITLIILGLVLVFGGASRAGAQVKRIQMHIAG |
| Ga0247695_10003313 | 3300024179 | Soil | MKKRTALIVFGLCLVLCSVTNAAAQVKRVQMHIAGYLCGN |
| Ga0207707_105318041 | 3300025912 | Corn Rhizosphere | GDLQQHRREKMKQKITLIILGLVLVFGGASRAGAQVKRIQMHIAGYLCGN |
| Ga0207694_104075052 | 3300025924 | Corn Rhizosphere | MKKTTVLFTFGLVLLFGGATHSAAQVKRVQMHIAGYLCGN |
| Ga0207650_101821932 | 3300025925 | Switchgrass Rhizosphere | MKTVLLTGLLIIGGCAVRCDAQVKRIQMHIAGYLCGN |
| Ga0207701_108029722 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKKTVLIVLGLVLVFGSATGAGAQVKQVQMHIAGYLCGN |
| Ga0207690_101376121 | 3300025932 | Corn Rhizosphere | MIRRATLIVFGLVLVFGGAARSEAQVKRVQMHIAGYLCGN |
| Ga0207670_100020435 | 3300025936 | Switchgrass Rhizosphere | MKKKTVLIVLGLVLVFGSASRAGAQVRQVQMHIEGYLCGN |
| Ga0207665_108297572 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKKAILIMFGLCFVFVSAITAAAQVKRVQMHIAGYLCGN |
| Ga0207691_102788392 | 3300025940 | Miscanthus Rhizosphere | MKKKTVLIVLGLVLVFGSASGAGAQVKRVQMHIAGYLCGN |
| Ga0207641_103353472 | 3300026088 | Switchgrass Rhizosphere | MKKKAALIIGLVLVFGGATRSHAQVKRVRMHIAGYLCGN |
| Ga0207675_1015128422 | 3300026118 | Switchgrass Rhizosphere | RTLLIVLGLVLVCASGSGAVAQVKRVQMHIAGYLCGN |
| Ga0209177_100645463 | 3300027775 | Agricultural Soil | MKKKTALILFAVALGFGIATRSDAQVKRVQMHIAGYLCGN |
| Ga0207428_100118586 | 3300027907 | Populus Rhizosphere | MKKTTVIFTFGLMLLFGGATHSSAQVKRVQMHIAGYLCGN |
| Ga0268264_102361242 | 3300028381 | Switchgrass Rhizosphere | MKKKTVLIVLGLVLVFGSASRAGAQVKQVQMHIEGYLCGN |
| Ga0268241_101943631 | 3300030511 | Soil | MKKKAALIVFVLVVVFGGATRSEAQVKRVQMHIAGYLCGN |
| Ga0310813_100553497 | 3300031716 | Soil | MKKKTALSVFCLVLVFGGVTRSEAQVKRVQMHIAGYLCGN |
| Ga0307410_100467143 | 3300031852 | Rhizosphere | MRKKTALILFGLVLVFGSASRSDAQVKRVQMHIGGYLCGN |
| Ga0308173_122244981 | 3300032074 | Soil | LYQEKEMKKKAALLVVGLVLVFGGATRSNAQVKRVQMHIAGYLCGN |
| Ga0268251_103216222 | 3300032159 | Agave | MKKKMALIVFGLVLVFGSASRSEAQVKRVQMHIAGYLCGN |
| Ga0310810_103826212 | 3300033412 | Soil | MKILLTFGLVLLLGGAVHTSAQVKRIQMHIAGYLCGN |
| ⦗Top⦘ |