NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F052164

Metagenome / Metatranscriptome Family F052164

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F052164
Family Type Metagenome / Metatranscriptome
Number of Sequences 143
Average Sequence Length 50 residues
Representative Sequence LKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Number of Associated Samples 131
Number of Associated Scaffolds 143

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.90 %
% of genes from short scaffolds (< 2000 bps) 94.41 %
Associated GOLD sequencing projects 128
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.986 % of family members)
Environment Ontology (ENVO) Unclassified
(27.273 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.357 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 59.18%    β-sheet: 0.00%    Coil/Unstructured: 40.82%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001145|JGI12682J13319_1011157All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300001154|JGI12636J13339_1010923All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1396Open in IMG/M
3300002245|JGIcombinedJ26739_101125454All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300003367|JGI26338J50219_1019630All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus588Open in IMG/M
3300004092|Ga0062389_104912867All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus504Open in IMG/M
3300005434|Ga0070709_10185328All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1464Open in IMG/M
3300005445|Ga0070708_101075553All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus754Open in IMG/M
3300005468|Ga0070707_101623603All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300005535|Ga0070684_102151732All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300005541|Ga0070733_10806247All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus630Open in IMG/M
3300006050|Ga0075028_100775454All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus582Open in IMG/M
3300006059|Ga0075017_101104489All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus619Open in IMG/M
3300006086|Ga0075019_10754645All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus618Open in IMG/M
3300006172|Ga0075018_10530283All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300006174|Ga0075014_100933585All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus521Open in IMG/M
3300006354|Ga0075021_11185091All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300006903|Ga0075426_10889135All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus672Open in IMG/M
3300009143|Ga0099792_10068650All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1781Open in IMG/M
3300009552|Ga0116138_1143157All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300009623|Ga0116133_1053554All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1001Open in IMG/M
3300009635|Ga0116117_1225501All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300009644|Ga0116121_1210700All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus619Open in IMG/M
3300009759|Ga0116101_1173291All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300009764|Ga0116134_1222024All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300010341|Ga0074045_10237504All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1209Open in IMG/M
3300010361|Ga0126378_12139279All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus638Open in IMG/M
3300010379|Ga0136449_101003533All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1343Open in IMG/M
3300011120|Ga0150983_16357795All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1299Open in IMG/M
3300012206|Ga0137380_10411571All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1200Open in IMG/M
3300012350|Ga0137372_10061621All Organisms → cellular organisms → Bacteria → Acidobacteria3265Open in IMG/M
3300012917|Ga0137395_11057695All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300012929|Ga0137404_11645815All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300012971|Ga0126369_12363946All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300012989|Ga0164305_12071643All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300014161|Ga0181529_10261668All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus982Open in IMG/M
3300014165|Ga0181523_10714947All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300014167|Ga0181528_10059693All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus2104Open in IMG/M
3300014167|Ga0181528_10219693All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1026Open in IMG/M
3300014169|Ga0181531_10293539All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus994Open in IMG/M
3300014201|Ga0181537_10323231All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1059Open in IMG/M
3300014201|Ga0181537_10826290All Organisms → cellular organisms → Bacteria → Acidobacteria628Open in IMG/M
3300014489|Ga0182018_10689456All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300014491|Ga0182014_10076628All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus2120Open in IMG/M
3300014654|Ga0181525_10368125All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus788Open in IMG/M
3300014838|Ga0182030_11732114All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300016357|Ga0182032_11149874All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus667Open in IMG/M
3300017946|Ga0187879_10781201All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300017948|Ga0187847_10131441All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1371Open in IMG/M
3300017955|Ga0187817_10186845All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1320Open in IMG/M
3300017973|Ga0187780_10756971All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus702Open in IMG/M
3300017974|Ga0187777_11271741All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300017988|Ga0181520_10778548All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus647Open in IMG/M
3300018002|Ga0187868_1116195All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1012Open in IMG/M
3300018006|Ga0187804_10112574All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1125Open in IMG/M
3300018007|Ga0187805_10145007All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1079Open in IMG/M
3300018008|Ga0187888_1416781All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300018013|Ga0187873_1341848All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300018030|Ga0187869_10424446All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300018040|Ga0187862_10541553All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus695Open in IMG/M
3300018044|Ga0187890_10254650All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus988Open in IMG/M
3300018046|Ga0187851_10259136All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1017Open in IMG/M
3300018046|Ga0187851_10463708All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus721Open in IMG/M
3300018046|Ga0187851_10693569All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300018047|Ga0187859_10140304All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1279Open in IMG/M
3300018058|Ga0187766_10256396All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1120Open in IMG/M
3300018088|Ga0187771_11668069All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300020010|Ga0193749_1032538All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1013Open in IMG/M
3300020580|Ga0210403_10298184All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1321Open in IMG/M
3300020580|Ga0210403_10799660All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus750Open in IMG/M
3300021168|Ga0210406_10300473All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1305Open in IMG/M
3300021171|Ga0210405_10118366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus2092Open in IMG/M
3300021180|Ga0210396_10289158All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1452Open in IMG/M
3300021181|Ga0210388_10723490All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus866Open in IMG/M
3300021181|Ga0210388_11302275All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300021402|Ga0210385_10084110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus2190Open in IMG/M
3300021402|Ga0210385_11366138All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300021404|Ga0210389_10426178All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1043Open in IMG/M
3300021405|Ga0210387_10365394All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1276Open in IMG/M
3300021407|Ga0210383_10696348All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus873Open in IMG/M
3300021420|Ga0210394_10783299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus833Open in IMG/M
3300022506|Ga0242648_1043430All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus665Open in IMG/M
3300022721|Ga0242666_1136340All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300023101|Ga0224557_1167786All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus793Open in IMG/M
3300023255|Ga0224547_1024848All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus769Open in IMG/M
3300024225|Ga0224572_1088420All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300025320|Ga0209171_10522332All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300025414|Ga0208935_1038120All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus639Open in IMG/M
3300025434|Ga0208690_1051485All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus645Open in IMG/M
3300025627|Ga0208220_1070362All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus984Open in IMG/M
3300025906|Ga0207699_10073058All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus2102Open in IMG/M
3300026469|Ga0257169_1038506All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus731Open in IMG/M
3300026514|Ga0257168_1022000All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1324Open in IMG/M
3300027432|Ga0209421_1027881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1100Open in IMG/M
3300027521|Ga0209524_1073105All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus721Open in IMG/M
3300027591|Ga0209733_1050792All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1097Open in IMG/M
3300027696|Ga0208696_1035347All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1799Open in IMG/M
3300027745|Ga0209908_10199546All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300027826|Ga0209060_10263340All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus789Open in IMG/M
3300027853|Ga0209274_10114622All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1338Open in IMG/M
3300028037|Ga0265349_1017679All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300028572|Ga0302152_10140123All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus772Open in IMG/M
3300028747|Ga0302219_10181081All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus811Open in IMG/M
3300028780|Ga0302225_10510225All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300028798|Ga0302222_10131291All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus991Open in IMG/M
3300028798|Ga0302222_10221792All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus739Open in IMG/M
3300028879|Ga0302229_10085047All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1514Open in IMG/M
3300028882|Ga0302154_10286364All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus813Open in IMG/M
3300029636|Ga0222749_10406313All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus722Open in IMG/M
3300029882|Ga0311368_10791014All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus647Open in IMG/M
3300029903|Ga0247271_111208All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1283Open in IMG/M
3300029908|Ga0311341_10479000All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium711Open in IMG/M
3300029913|Ga0311362_10780566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus796Open in IMG/M
3300029915|Ga0311358_10404489All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1102Open in IMG/M
3300029916|Ga0302148_1088430All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus880Open in IMG/M
3300029952|Ga0311346_10382334All Organisms → cellular organisms → Bacteria → Acidobacteria1380Open in IMG/M
3300030013|Ga0302178_10503415All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300030020|Ga0311344_10367845All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1340Open in IMG/M
3300030520|Ga0311372_11633982All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus782Open in IMG/M
3300030760|Ga0265762_1032926All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus990Open in IMG/M
3300030815|Ga0265746_1027796All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus717Open in IMG/M
3300030974|Ga0075371_11632292All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300030991|Ga0073994_12416007All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300031027|Ga0302308_10287184All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1020Open in IMG/M
3300031057|Ga0170834_100142486All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1005Open in IMG/M
3300031234|Ga0302325_11412208All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus904Open in IMG/M
3300031234|Ga0302325_11871697All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus748Open in IMG/M
3300031446|Ga0170820_17473726All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300031474|Ga0170818_115050450All Organisms → cellular organisms → Bacteria → Acidobacteria635Open in IMG/M
3300031525|Ga0302326_11064672All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1128Open in IMG/M
3300031525|Ga0302326_12030450All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus741Open in IMG/M
3300031525|Ga0302326_12376970All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300031754|Ga0307475_11156640All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300031788|Ga0302319_10428501All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1458Open in IMG/M
3300031788|Ga0302319_11231269All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus689Open in IMG/M
3300031823|Ga0307478_10240390All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1468Open in IMG/M
3300031962|Ga0307479_10608690All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1074Open in IMG/M
3300032205|Ga0307472_102027357All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300032515|Ga0348332_13509872All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300032805|Ga0335078_10851728All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1103Open in IMG/M
3300032828|Ga0335080_10219393All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus2086Open in IMG/M
3300032895|Ga0335074_10372716All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1569Open in IMG/M
3300033004|Ga0335084_10500044All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1249Open in IMG/M
3300033818|Ga0334804_004626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus6454Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.99%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa9.79%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland8.39%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog6.29%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog6.99%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.59%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.90%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.50%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.50%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.80%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.80%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.10%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.10%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.10%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.40%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.40%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.40%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.40%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.40%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.70%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.70%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.70%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.70%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.70%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.70%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.70%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.70%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.70%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.70%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001145Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2EnvironmentalOpen in IMG/M
3300001154Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003367Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300022506Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022721Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300023255Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14EnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025434Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025627Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027521Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300028037Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029903Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703EnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029916Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1EnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030974Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12682J13319_101115733300001145Forest SoilAVGALKFGGLFEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVR*
JGI12636J13339_101092333300001154Forest SoilAGMHVAVGALKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS*
JGIcombinedJ26739_10112545433300002245Forest SoilNVILPVYAGMHVAVGALKFGGLFEHQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGIS*
JGI26338J50219_101963023300003367Bog Forest SoilFEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVR*
Ga0062389_10491286723300004092Bog Forest SoilILPVYAGMHVAIGALKFGGLFEPQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVARGTAGVS*
Ga0070709_1018532833300005434Corn, Switchgrass And Miscanthus RhizosphereVGALKFGGLFEHQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGVS*
Ga0070708_10107555313300005445Corn, Switchgrass And Miscanthus RhizospherePVYAGMHVAVGALKFGGLFEHQVHHQFSHARHFLGAILCLMVSGLLRLGEFFVTKGTAGVS*
Ga0070707_10162360323300005468Corn, Switchgrass And Miscanthus RhizosphereAGMHVAVGALKFGGLFEHQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGVS*
Ga0070684_10215173213300005535Corn RhizosphereAVGALKFGGLFEHQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVS*
Ga0070733_1080624733300005541Surface SoilMHVAVGALKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS*
Ga0075028_10077545433300006050WatershedsHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS*
Ga0075017_10110448933300006059WatershedsVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS*
Ga0075019_1075464533300006086WatershedsHQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVARGTAGVS*
Ga0075018_1053028313300006172WatershedsYAGMHVAVGALKFGGLFEHQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGVS*
Ga0075014_10093358513300006174WatershedsLFEHQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGIS*
Ga0075021_1118509123300006354WatershedsAVGALKFGGLFEHQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTEGVS*
Ga0075426_1088913533300006903Populus RhizosphereQVHHQFNHARHFLGAILCLMVSGLLRLGEFFVTKGTAGVS*
Ga0099792_1006865013300009143Vadose Zone SoilMHVAVGALKFGGLFEHQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGVS*
Ga0116138_114315713300009552PeatlandNVILPVYAGMHVAVGALKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS*
Ga0116133_105355413300009623PeatlandHHQFNHTRHFVCAILCLMASGLLRLGEFFVTRGTAGVS*
Ga0116117_122550113300009635PeatlandFGGLFEHQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS*
Ga0116121_121070013300009644PeatlandHHQFNHTRHFLGAILCLMASGLLRLGEFFVARGTAGVS*
Ga0116101_117329123300009759PeatlandEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVR*
Ga0116134_122202433300009764PeatlandVYAGMQVAVGAMKFGGLFENQLHHQFSHARHFLGAILCLLVSGLLRLGEFFVTRGTAGVS
Ga0074045_1023750413300010341Bog Forest SoilANVILPVYAGMHVAVGAIKLGGLFEQQVHHQFNHARHFLGAILCLLASGLIRLGEFFVARGTAGVS*
Ga0126378_1213927933300010361Tropical Forest SoilALKLGGLLDRWSHHQLDHTRNFLGAILCLLVSGLVRLGEFFVSKGTAGVS*
Ga0136449_10100353333300010379Peatlands SoilLKFGGLFEQQVHHQFNHTRHFLGAIPCLLVSGLLRLGEFFVARGTAGVS*
Ga0150983_1635779513300011120Forest SoilQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS*
Ga0137380_1041157113300012206Vadose Zone SoilHQFNHTRPFLGAILCLMVSGLLRLGEFFLTKGTAGVS*
Ga0137372_1006162113300012350Vadose Zone SoilQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGVS*
Ga0137395_1105769513300012917Vadose Zone SoilLKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS*
Ga0137404_1164581513300012929Vadose Zone SoilILPVYAGMHVAVAALKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS*
Ga0126369_1236394613300012971Tropical Forest SoilKLGGLLDRWSHHQLDHTRNFLGAILCLLISGLVRLGEFFVTRGTAGVS*
Ga0164305_1207164313300012989SoilSALKFGGLFEHQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGVS*
Ga0181529_1026166813300014161BogMHVAVGALKFGGLFEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVR*
Ga0181523_1071494723300014165BogEHQVHHQFNHTRHFVGPILCLMASGLLRLGEFFVTRGTAGVS*
Ga0181528_1005969333300014167BogFGGLFEHQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGVS*
Ga0181528_1021969313300014167BogPVYAGMHVAVGALKFGGLFEQQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGVS*
Ga0181531_1029353933300014169BogGALKFGGLFEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVR*
Ga0181537_1032323113300014201BogKFGGLFEQQVHHQFNHTLHFLGAILCLMASGLLRLGEFFVTKGTAGVS*
Ga0181537_1082629033300014201BogVGALKFGGLFEHQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVARGTAGVS*
Ga0182018_1068945613300014489PalsaNVILPVYAGMHVAVGALKFGGLFEHQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS*
Ga0182014_1007662813300014491BogDSAREAHFLGAILCLMASGLLRLGEFFVTKGTAGVS*
Ga0181525_1036812533300014654BogFANVILPVYAGMHVAVGALKFGGLFEQQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGVS*
Ga0182030_1173211413300014838BogVAVGALKFGGLFEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVARGTAGVR*
Ga0182032_1114987413300016357SoilTVGALKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVAKGTAGVS
Ga0187879_1078120113300017946PeatlandHQFSHARHFLGAILCLLVSGLLRLGEFFVTRCTAGVS
Ga0187847_1013144133300017948PeatlandFGGLFENQLHHQFSHARHFLGAILCLLVSGLLRLGEFFVTRGTAGVS
Ga0187817_1018684533300017955Freshwater SedimentMHVAVGALKFGGLFEHQVHHQFNHARHFLGAILCLMVSGLLRLGEFFVTKGTAGVS
Ga0187780_1075697113300017973Tropical PeatlandGGLFEHQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVAKGTAGVS
Ga0187777_1127174113300017974Tropical PeatlandMHVAVGALKFGGLFEHQVHHQFSHARHFLGAILCLMASGLLRLGEFFVAKGTAGVS
Ga0181520_1077854833300017988BogGGLFENQLHHQFSHARHFLGAILCLLVSGLLRLGEFFVTRGTAGVS
Ga0187868_111619513300018002PeatlandGGLFEQQVHHQFNHARHFLGAILCLLASGLIRLGEFFVARGTAGVS
Ga0187804_1011257433300018006Freshwater SedimentFEHQVQHQFNHTRHFLGAILCLMASGLLRLGEFFVARGTAGVS
Ga0187805_1014500713300018007Freshwater SedimentKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVAKGTAGVS
Ga0187888_141678113300018008PeatlandAVGALKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0187873_134184823300018013PeatlandMQVAVGAMKFGGLFENQLHHQFSHARHFLGAILCLLVSGLLRLGEFFVTRGTAGVS
Ga0187869_1042444613300018030PeatlandILPVYAGMQVAVGAMKFGGLFENQLHHQFSHARHFLGAILCLLVSGLLRLGEFFVTRGTAGVS
Ga0187862_1054155313300018040PeatlandVYAGMHVAVGALKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0187890_1025465013300018044PeatlandPVYAGMHVTVGALKFGGLFEHQVHHQFNHTRHFVGAILCLMASGLLRLGEFFVARGTAGV
Ga0187851_1025913633300018046PeatlandQVAVGAMKFGGLFENQLHHQFSHARHFLGAILCLLVSGLLRLGEFFVTRGTAGVS
Ga0187851_1046370813300018046PeatlandVILPVYAGMHVAVGALKFGGLFEQQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVARGTAGVS
Ga0187851_1069356913300018046PeatlandQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGVS
Ga0187859_1014030433300018047PeatlandGAIKLGGLFEQQVHHQFNHARHFLGAILCLLASGLIRLGEFFVARGTAGVS
Ga0187766_1025639613300018058Tropical PeatlandLFEQQVHHQFNHTRHFLGAVLCLMASGLLRLGEFFVAKGTAGVS
Ga0187771_1166806913300018088Tropical PeatlandANVILPVYAAMHVTVGALKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVAKGTAGVS
Ga0193749_103253833300020010SoilLKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0210403_1029818433300020580SoilHQFNHTRHFLGAILCLMVSGLLRLGEFFVARGTAGVS
Ga0210403_1079966033300020580SoilQFNHTRHFVGAILCLMASGLLRLGEFLVTKGTAGVS
Ga0210406_1030047333300021168SoilVYAGMHVAVGALKFGGLFEHQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0210405_1011836613300021171SoilGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0210396_1028915813300021180SoilFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0210388_1072349013300021181SoilGGLFEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVR
Ga0210388_1130227513300021181SoilFGGLFEHQVHHQFNHTRHFVGAILCLMASGLLRLGEFFVTRGTAGVS
Ga0210385_1008411033300021402SoilGMHVAVGALKFGGLFEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVR
Ga0210385_1136613823300021402SoilPVYAGMHVTVGALKFGGLFEHQVHHQFNHTRHFVGAILCLMASGLLRLGEFFVTRGTAGV
Ga0210389_1042617813300021404SoilHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0210387_1036539433300021405SoilFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0210383_1069634813300021407SoilVGALKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0210394_1078329913300021420SoilFANVILPVYAGMHVAVGALKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0242648_104343013300022506SoilQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGVS
Ga0242666_113634013300022721SoilVAVGALKFGGLFEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVR
Ga0224557_116778613300023101SoilGLFEQQVHHQFNHARHFLGAILCLLASGLIRLGEFFVARGTAGVS
Ga0224547_102484813300023255SoilYAGMHVAVGALKFGGLFEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVR
Ga0224572_108842023300024225RhizosphereLPVYAGMHVTVGALKFGGLFEPQVHHQFNHTRHFVGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0209171_1052233213300025320Iron-Sulfur Acid SpringVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0208935_103812033300025414PeatlandFNHTRHFLGAILCLMASGLLRLGEFFVARGTAGVS
Ga0208690_105148513300025434PeatlandQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVARGTAGVS
Ga0208220_107036213300025627Arctic Peat SoilNVILPVYAGMHVAVGALKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0207699_1007305833300025906Corn, Switchgrass And Miscanthus RhizosphereAGMHVAVGALKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0257169_103850633300026469SoilMHVAVGALKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0257168_102200033300026514SoilGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0209421_102788113300027432Forest SoilFGGLFEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVR
Ga0209524_107310513300027521Forest SoilLPVFAGMHVAVGALKFGGLFEHQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGIS
Ga0209733_105079213300027591Forest SoilGALKFGGLFEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVR
Ga0208696_103534713300027696Peatlands SoilKFGGLFEQQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGVS
Ga0209908_1019954613300027745Thawing PermafrostEVLNVCLLYTSFANVILPVYAGMHVAVGALKFGGLFEHQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGVS
Ga0209060_1026334013300027826Surface SoilKFGGLFEHQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0209274_1011462213300027853SoilHHQFNHTRHFVGAILCLMASGLLRLGEFFVTRGTAGVS
Ga0265349_101767923300028037SoilVYAGMHVAVGALKFGGLFEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVR
Ga0302152_1014012333300028572BogEHQVHHQFNHTRHFVGAILCLMASGLLRLGEFFVARGTAGVS
Ga0302219_1018108133300028747PalsaLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0302225_1051022513300028780PalsaHQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVARGTAGVS
Ga0302222_1013129133300028798PalsaKFGGLFEHQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVARGTAGVS
Ga0302222_1022179233300028798PalsaFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0302229_1008504733300028879PalsaKFGGLFEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVR
Ga0302154_1028636413300028882BogHHQFSHARHFLGAILCLLVSGLLRLGEFFVTRGTAGVS
Ga0222749_1040631333300029636SoilFSHARHFLGAILCLMVSGILRLGEFFVTKGTAGIS
Ga0311368_1079101413300029882PalsaAIGALKFGGLFEHQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVARGTAGVS
Ga0247271_11120833300029903SoilNVILPVYAGMHVAIGALKFGGLFEHQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVARGTAGVS
Ga0311341_1047900033300029908BogMHVTVGALKFGGLFEPQVHHQFNHTRHFVGAILCLMASGLLRLGEFFVTKGTAGV
Ga0311362_1078056633300029913BogPVYAGMHVAVGALKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGV
Ga0311358_1040448933300029915BogVHHQFNHTRHFLGAILCLMASGLLRLGEFFVARGTAGVS
Ga0302148_108843033300029916BogFSHARHFLGAILCLLVSGLLRLGEFFVTRGTAGVS
Ga0311346_1038233433300029952BogMHVTVGALKFGGLFEPQVHHQFNHTRHFVGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0302178_1050341523300030013PalsaLKFGGLFEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVR
Ga0311344_1036784533300030020BogLKFGGLFEHQVHHQLNHTRHFVGAILCLMASGLLRLGEFFVTRGTAGVS
Ga0311372_1163398233300030520PalsaHQFNHTRHFLGAILCLMASGLLRLGEFFVARGTAGVS
Ga0265762_103292633300030760SoilYAGMHVAVGALKFGGLFEHQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0265746_102779633300030815SoilHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0075371_1163229213300030974SoilHQVHHQFNHTRHFLGAVLCLMVSGLLRLGEFFVTKGTAGVS
Ga0073994_1241600713300030991SoilFANVILPVYAGMHVAVGALKFGGLFEHQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGVS
Ga0302308_1028718413300031027PalsaILPVYAGMHVAVGALKFGGLFEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVR
Ga0170834_10014248613300031057Forest SoilPVYAGMHVAVGALQFGGLFEHQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVTKGTAGV
Ga0302325_1141220833300031234PalsaVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVR
Ga0302325_1187169713300031234PalsaALKFGGLFEHQVHHQFNHTRHFLGAILCLMVSGLLRLGEFFVARGTAGVS
Ga0170820_1747372623300031446Forest SoilQVHHQFNHTRHFVGAILCLMASGLLRLGEFLVTKGTAGVS
Ga0170818_11505045033300031474Forest SoilVGALEFGGLFEHQVHHQFNHTRHFVGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0302326_1106467233300031525PalsaGLFEPQVHHQFSESRHFLGAILCLLASGLLRLGEFFVARGIPGVR
Ga0302326_1203045033300031525PalsaFGGLFEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVARGTAGVR
Ga0302326_1237697033300031525PalsaNVILPVYAGMHVAVGALKFGGLFEQQVHHQFSHTRHFLGAILCLMVSGLLRLGEFFVTRGTAGVR
Ga0307475_1115664013300031754Hardwood Forest SoilALKFGGLFENQVHHQFNHARHFLGAILCLMVSGLLRLGEFFVTKGTAGVS
Ga0302319_1042850133300031788BogLKLGGLFEHQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVARGTAGVS
Ga0302319_1123126933300031788BogEQQVHHQFNHARHFLGAILCLLASGLIRLGEFFVARGTAGVS
Ga0307478_1024039033300031823Hardwood Forest SoilGALKFGGLFEHQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0307479_1060869013300031962Hardwood Forest SoilMHVAVGALKVGGLLDRWSHHQLDHTRNFLGAILCLLVSGLVRLGEFFVARGTAGVS
Ga0307472_10202735723300032205Hardwood Forest SoilLPMYAGMHVAVGALKFGGLFEQQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVTKGTAGVS
Ga0348332_1350987213300032515Plant LitterHHQFNHTRHFLGAILCLMASGLLRLGEFFVARGTAGVS
Ga0335078_1085172813300032805SoilFEHQVHHQFNHTRHFVGAILCLIASGLLRLGEFFVTRGTAGVS
Ga0335080_1021939313300032828SoilNVILPVYAAMHVTVGALKFGGLFEHQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVARGTAGVS
Ga0335074_1037271633300032895SoilLPVYAAMHVTVGALKFGGLFEHQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVARGTAGVS
Ga0335084_1050004433300033004SoilTVGALKFGGLFEHQVHHQFNHTRHFLGAILCLMASGLLRLGEFFVARGTAGVS
Ga0334804_004626_6292_64413300033818SoilMKFGGLFENQLHHQFSHARHFLGAILCLLVSGLLRLGEFFVTRGTAGVS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.