| Basic Information | |
|---|---|
| Family ID | F052152 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 143 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MADESAKGILGHLPPWPRKALNNSVIAMEQAYRQRKGLP |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.33 % |
| % of genes near scaffold ends (potentially truncated) | 98.60 % |
| % of genes from short scaffolds (< 2000 bps) | 85.31 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.811 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.685 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.678 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.944 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.90% β-sheet: 0.00% Coil/Unstructured: 79.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF00762 | Ferrochelatase | 76.22 |
| PF00180 | Iso_dh | 5.59 |
| PF03477 | ATP-cone | 1.40 |
| PF03320 | FBPase_glpX | 1.40 |
| PF07884 | VKOR | 0.70 |
| PF13620 | CarboxypepD_reg | 0.70 |
| PF00510 | COX3 | 0.70 |
| PF00271 | Helicase_C | 0.70 |
| PF12867 | DinB_2 | 0.70 |
| PF02254 | TrkA_N | 0.70 |
| PF00115 | COX1 | 0.70 |
| PF17131 | LolA_like | 0.70 |
| PF15975 | Flot | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG0276 | Protoheme ferro-lyase (ferrochelatase) | Coenzyme transport and metabolism [H] | 76.22 |
| COG1494 | Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase or related protein | Carbohydrate transport and metabolism [G] | 1.40 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 0.70 |
| COG4243 | Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation | General function prediction only [R] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.81 % |
| Unclassified | root | N/A | 11.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10040999 | All Organisms → cellular organisms → Bacteria | 2588 | Open in IMG/M |
| 3300005178|Ga0066688_10410124 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300005184|Ga0066671_10670637 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005332|Ga0066388_106889350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300005435|Ga0070714_100820492 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300005438|Ga0070701_10580098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300005450|Ga0066682_10135791 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300005518|Ga0070699_101797609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300005532|Ga0070739_10168622 | Not Available | 1144 | Open in IMG/M |
| 3300005566|Ga0066693_10314023 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005607|Ga0070740_10238875 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300005616|Ga0068852_100270594 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300005891|Ga0075283_1069439 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005896|Ga0075282_1001654 | All Organisms → cellular organisms → Bacteria | 2167 | Open in IMG/M |
| 3300005995|Ga0066790_10494849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300006041|Ga0075023_100492210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300006050|Ga0075028_100504557 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300006059|Ga0075017_100496886 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300006173|Ga0070716_100188075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1362 | Open in IMG/M |
| 3300006176|Ga0070765_101685649 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300006176|Ga0070765_101774556 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300006354|Ga0075021_10772235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300006797|Ga0066659_10979481 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300006881|Ga0068865_102213036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300007076|Ga0075435_100097501 | All Organisms → cellular organisms → Bacteria | 2433 | Open in IMG/M |
| 3300007265|Ga0099794_10625979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300009088|Ga0099830_10085378 | All Organisms → cellular organisms → Bacteria | 2325 | Open in IMG/M |
| 3300009545|Ga0105237_10278765 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300009623|Ga0116133_1018941 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300009624|Ga0116105_1001969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4563 | Open in IMG/M |
| 3300009645|Ga0116106_1033631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1753 | Open in IMG/M |
| 3300009683|Ga0116224_10463251 | Not Available | 604 | Open in IMG/M |
| 3300009824|Ga0116219_10771606 | Not Available | 525 | Open in IMG/M |
| 3300010343|Ga0074044_11080301 | Not Available | 526 | Open in IMG/M |
| 3300010360|Ga0126372_12825190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300012096|Ga0137389_10446140 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300012200|Ga0137382_10636805 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300012205|Ga0137362_10118676 | All Organisms → cellular organisms → Bacteria | 2242 | Open in IMG/M |
| 3300012206|Ga0137380_11004024 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300012207|Ga0137381_10193643 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300012683|Ga0137398_11140012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300012925|Ga0137419_10656612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300012929|Ga0137404_10589450 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300012960|Ga0164301_10302793 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300012984|Ga0164309_10736359 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300013307|Ga0157372_11970632 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300015264|Ga0137403_10079952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3304 | Open in IMG/M |
| 3300016371|Ga0182034_10019280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4041 | Open in IMG/M |
| 3300017930|Ga0187825_10221050 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300017932|Ga0187814_10407192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300017933|Ga0187801_10319694 | Not Available | 634 | Open in IMG/M |
| 3300017940|Ga0187853_10173388 | Not Available | 1022 | Open in IMG/M |
| 3300017943|Ga0187819_10182811 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300017955|Ga0187817_10223716 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300017955|Ga0187817_10263234 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300017970|Ga0187783_10001009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 20796 | Open in IMG/M |
| 3300017970|Ga0187783_10263159 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300017972|Ga0187781_10282779 | Not Available | 1176 | Open in IMG/M |
| 3300017974|Ga0187777_10431293 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300017975|Ga0187782_10116368 | All Organisms → cellular organisms → Bacteria | 1974 | Open in IMG/M |
| 3300017975|Ga0187782_10297832 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300018005|Ga0187878_1090382 | Not Available | 1270 | Open in IMG/M |
| 3300018012|Ga0187810_10411044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300018040|Ga0187862_10703809 | Not Available | 590 | Open in IMG/M |
| 3300018058|Ga0187766_11263246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300018085|Ga0187772_10273832 | Not Available | 1151 | Open in IMG/M |
| 3300018086|Ga0187769_10404912 | Not Available | 1026 | Open in IMG/M |
| 3300018086|Ga0187769_10938140 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300020581|Ga0210399_10335341 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300020581|Ga0210399_10566449 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300020581|Ga0210399_10966768 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300020583|Ga0210401_10473938 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300020583|Ga0210401_10679950 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300020583|Ga0210401_11144136 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300020583|Ga0210401_11244237 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300021170|Ga0210400_10008146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8610 | Open in IMG/M |
| 3300021170|Ga0210400_10312239 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300021170|Ga0210400_11336934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300021181|Ga0210388_10451871 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300021405|Ga0210387_10129573 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
| 3300021405|Ga0210387_10432593 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300021407|Ga0210383_10382791 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300021420|Ga0210394_10549790 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300021432|Ga0210384_11014559 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300021433|Ga0210391_10476460 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300021433|Ga0210391_11311187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300021475|Ga0210392_11103396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300021478|Ga0210402_10576986 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300021560|Ga0126371_11385494 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300021560|Ga0126371_13527590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300022726|Ga0242654_10192616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300022730|Ga0224570_113664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300025500|Ga0208686_1020192 | Not Available | 1728 | Open in IMG/M |
| 3300025900|Ga0207710_10325493 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300025905|Ga0207685_10291971 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300025928|Ga0207700_10707675 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300025939|Ga0207665_10122345 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300025939|Ga0207665_10623662 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300025981|Ga0207640_10984851 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300026088|Ga0207641_10721018 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300026142|Ga0207698_11544884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300026277|Ga0209350_1004941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4659 | Open in IMG/M |
| 3300026294|Ga0209839_10016405 | All Organisms → cellular organisms → Bacteria | 2973 | Open in IMG/M |
| 3300026310|Ga0209239_1244888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300026334|Ga0209377_1347855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300026530|Ga0209807_1221218 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300026540|Ga0209376_1077005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1789 | Open in IMG/M |
| 3300026557|Ga0179587_10478126 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300027370|Ga0209010_1095170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300027497|Ga0208199_1097956 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300027570|Ga0208043_1169654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300027604|Ga0208324_1010564 | All Organisms → cellular organisms → Bacteria | 3006 | Open in IMG/M |
| 3300027768|Ga0209772_10147907 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300027829|Ga0209773_10021794 | All Organisms → cellular organisms → Bacteria | 2517 | Open in IMG/M |
| 3300027846|Ga0209180_10400929 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300027854|Ga0209517_10134143 | Not Available | 1609 | Open in IMG/M |
| 3300027862|Ga0209701_10680769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300027867|Ga0209167_10761265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300027879|Ga0209169_10013403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4522 | Open in IMG/M |
| 3300027879|Ga0209169_10077942 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300027905|Ga0209415_10099618 | All Organisms → cellular organisms → Bacteria | 3199 | Open in IMG/M |
| 3300027908|Ga0209006_10433832 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300028792|Ga0307504_10208205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300028906|Ga0308309_10298146 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300028906|Ga0308309_11157343 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300030659|Ga0316363_10028282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2902 | Open in IMG/M |
| 3300030659|Ga0316363_10140229 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300030659|Ga0316363_10348822 | Not Available | 583 | Open in IMG/M |
| 3300030904|Ga0308198_1100778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300031231|Ga0170824_128482704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300031708|Ga0310686_108117149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300031823|Ga0307478_11194229 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300031954|Ga0306926_11048346 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300032174|Ga0307470_11708263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300032180|Ga0307471_100048180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3489 | Open in IMG/M |
| 3300032180|Ga0307471_104275811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300032828|Ga0335080_12394529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300032892|Ga0335081_11128841 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300033158|Ga0335077_11581440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300033405|Ga0326727_11044887 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300033475|Ga0310811_10730300 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.79% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.59% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.20% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.20% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.10% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.10% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.40% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.40% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.70% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.70% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.70% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.70% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.70% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300005896 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2 | Host-Associated | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100409994 | 3300000567 | Peatlands Soil | MADDSAKGVLGHLPPWPRKALNNSVIGMEQAYRQRKGLPLLTDA |
| Ga0066688_104101242 | 3300005178 | Soil | MADEVKTGILGHLPPLPRPALNNSVIAMEQAYRQRKGLPLLSDADVEALKAG |
| Ga0066671_106706371 | 3300005184 | Soil | MSDESTKTAGGALGRLPKWPRKALNNSVISAEQAYRQRSGLPLLTDADIEAL |
| Ga0066388_1068893501 | 3300005332 | Tropical Forest Soil | MAGESKGILGHLPPLPRKALNNSVIGMEQAYRQRKGLPLLS |
| Ga0070714_1008204921 | 3300005435 | Agricultural Soil | MADESKSGILGRLPPLPRPALNNSVIGMEQAYRQRKGLTLLT |
| Ga0070701_105800981 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGLTLLTEDDIEALKA |
| Ga0066682_101357911 | 3300005450 | Soil | MPDESKGILGHLPPLPRAALNNSVIGMEQAYRKRKGLPLLTDAD |
| Ga0070699_1017976092 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MADEQSKTGVLGHLPPLPRKPLNNSVIAMEQAYRQRKGLPVLTEAEM |
| Ga0070739_101686222 | 3300005532 | Surface Soil | MAENAGVLGNLPPLPRKPLNNSVIAAEQAFRKRKGLPLLSDDDIAALKAGE |
| Ga0070735_100230425 | 3300005534 | Surface Soil | MADESKTAGGMLGHLPPWPRKPLNNSVIAMEQAYR |
| Ga0066693_103140231 | 3300005566 | Soil | MADESPKSVANGVLGHLPPWPRPALNNSVIGMEQAYRQRKNLPP |
| Ga0070740_102388752 | 3300005607 | Surface Soil | MADESKGILGHLPPWPRNALNNSVIAMEQAYRQRKGLPM |
| Ga0068852_1002705943 | 3300005616 | Corn Rhizosphere | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGLTLLTEADI |
| Ga0075283_10694392 | 3300005891 | Rice Paddy Soil | MADESKGILGHLPPWPRAALNNSVIAMEQAYRKRKDLPLISDAD |
| Ga0075282_10016543 | 3300005896 | Rice Paddy Soil | MADGQSKPAGMLGHLPPWPRKPLNNSVIAMEQAYRQRK |
| Ga0066790_104948492 | 3300005995 | Soil | MADESNAGILGHLPPLPRPALNNSVIGMEQAYRQRKGLTLLTDAD |
| Ga0075023_1004922102 | 3300006041 | Watersheds | MADETKTAGVLGHLPPWPRAALNNSVIGMEQAYRQRKGLPLLTDADIEALKA |
| Ga0075028_1005045572 | 3300006050 | Watersheds | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGL |
| Ga0075017_1004968863 | 3300006059 | Watersheds | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGLPLL |
| Ga0070716_1001880751 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MADEQSKAGGILGHLPTLPRKPLNNSVIAMEQAYRQRKGLPALTDAEVEA |
| Ga0070765_1016856492 | 3300006176 | Soil | MADESANAGGILGHLPPWPRKALNNSVIAMEQAYRQRKGL |
| Ga0070765_1017745562 | 3300006176 | Soil | MADESAKAGGILGRLPPWPRNALNNSVIAMEQAYRQR |
| Ga0075021_107722352 | 3300006354 | Watersheds | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGLTLLTDADIEALKA |
| Ga0066659_109794811 | 3300006797 | Soil | MADESPKSVANGVLGHLPPWPRPALNNSVIGMEQAYRQRKNLPQL |
| Ga0068865_1022130361 | 3300006881 | Miscanthus Rhizosphere | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGLTLLTD |
| Ga0075435_1000975011 | 3300007076 | Populus Rhizosphere | MADEQSKAGGILGHLPPLPRKPLNNSVIGMEQAYRQR |
| Ga0099794_106259791 | 3300007265 | Vadose Zone Soil | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGLPL |
| Ga0099830_100853783 | 3300009088 | Vadose Zone Soil | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGLT |
| Ga0105237_102787653 | 3300009545 | Corn Rhizosphere | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGLTLLTEADIEALK |
| Ga0116133_10189413 | 3300009623 | Peatland | MADESANGGILGHLPPWPRNALNNSVIAMEQAYRQRKGLPLLSD |
| Ga0116105_10019696 | 3300009624 | Peatland | MADKSANGGILGHLPPWPRNALNNSVIAMEQAYRQRKGLPLLSDADIEAL |
| Ga0116106_10336311 | 3300009645 | Peatland | MADDSPKSVVNGLLGHLPPWPRKQLSNSLIAMEQACRKREGLPLLSDADI |
| Ga0116224_104632511 | 3300009683 | Peatlands Soil | MADDSSKSVVNSVLGHLPPWPRKQLSNSLIAMEQACRKR |
| Ga0116219_107716062 | 3300009824 | Peatlands Soil | MADDSPKSVVNGLLGHLPPWPRKQLSNSLIAMEQACRK |
| Ga0074044_110803011 | 3300010343 | Bog Forest Soil | MADDSTKSAANSVLGHLPPWPRKQLSNSLIAMEQACRKREGLPLLTDAD |
| Ga0126372_128251902 | 3300010360 | Tropical Forest Soil | MAETIEKPAGVLGGLPPLPRKPLNNSVISAEQAYRKRKGLPLL |
| Ga0137389_104461402 | 3300012096 | Vadose Zone Soil | MADQSSKSVVNGVLGHLPPWPRQALNNSVIGMEQAYRQRKGLPPLSDEDIAA |
| Ga0137382_106368052 | 3300012200 | Vadose Zone Soil | MADESPKSVANGVLGHLPPWPRPALNNSVIGMEQAYRQRKNLPLLTDE |
| Ga0137362_101186763 | 3300012205 | Vadose Zone Soil | MADESKTGILGRLPPLPREALNNSVIGMEQAYRQRKGL |
| Ga0137380_110040241 | 3300012206 | Vadose Zone Soil | MADESKGVLGHLPPLPRKALNNSVIGMEQAYRQRKGL |
| Ga0137381_101936433 | 3300012207 | Vadose Zone Soil | MAEQSSKSVVNGVLGQLPPWPRQALNNSVIGMEQAYRQRKGLP |
| Ga0150984_1125915221 | 3300012469 | Avena Fatua Rhizosphere | MADESAKGVRGRLPAWPRNALNNSVISAEQAYRKRSGLPLLTDAD |
| Ga0137398_111400122 | 3300012683 | Vadose Zone Soil | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGLQLLTDADIE |
| Ga0137419_106566121 | 3300012925 | Vadose Zone Soil | MADESKTGILGHLPPLPRPALNNSVVGMEQAYRQRKGLPLLTDAD |
| Ga0137404_105894502 | 3300012929 | Vadose Zone Soil | MADESPKSVANGVLGHLPPWPRPALNNSVIGMEQAYRQRK |
| Ga0164301_103027931 | 3300012960 | Soil | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGLPLLTDAD |
| Ga0164309_107363591 | 3300012984 | Soil | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGLQLLTDADIEALKA |
| Ga0157372_119706321 | 3300013307 | Corn Rhizosphere | MADEQSKTGVLGHLPPLPRKPLNNSVIAMEQAYRQRK |
| Ga0137403_100799521 | 3300015264 | Vadose Zone Soil | MADESPKSVANGVLGHLPPWPRPALNNSVIGMEQAYRQRKNLPLLTD |
| Ga0182034_100192801 | 3300016371 | Soil | MADDSPKSVVNGFLGHLPPWPRKALNNWVIGMEQACRQRKGLPLLTDADIEA |
| Ga0187825_102210501 | 3300017930 | Freshwater Sediment | MADESAKGILGHLPPWPRKALNNSVIAMEQAYRQRKGLP |
| Ga0187814_104071921 | 3300017932 | Freshwater Sediment | MADESANAGGILGHLPPWPRKALNNSVIAMEQAYRQRKGLALLTDADVEALK |
| Ga0187801_103196941 | 3300017933 | Freshwater Sediment | MADDSPKGVVNGVLGHLPPWPRKQLSNSFIAMEQAGRKREGLPL |
| Ga0187853_101733881 | 3300017940 | Peatland | MADDSPKSVVNGLLGHLPPWPRKQLSNSLIAMEQACRQREGLPLLSDADI |
| Ga0187819_101828111 | 3300017943 | Freshwater Sediment | MADESAKGGVLGHLPPWPRKALNNSVIGMEQAYRQRKGLPLLSDADI |
| Ga0187817_102237162 | 3300017955 | Freshwater Sediment | MADESAKGGVLGHLPPWPRKALNNSVIGMEQAYRQ |
| Ga0187817_102632341 | 3300017955 | Freshwater Sediment | MADESAKAGVLGHLPPWPRKALNNSVIGMEQAYRQRKGLPL |
| Ga0187783_100010091 | 3300017970 | Tropical Peatland | MADESAEGIQSGILGHLPPWPRKALNNSVIAMEQAYRQRKGLP |
| Ga0187783_102631592 | 3300017970 | Tropical Peatland | MADESAEGVRNGILGHLPPWPRKALNNSVIAMEQAYR |
| Ga0187781_102827792 | 3300017972 | Tropical Peatland | VADETPKSVVNRALGHLPPWPRKALSNSAVAMEQAWR |
| Ga0187777_104312932 | 3300017974 | Tropical Peatland | MADESAEGIQNGILGHLPPWPRQELNNSVIAMEQAYRQRK |
| Ga0187782_101163683 | 3300017975 | Tropical Peatland | MADESAEGVRNGILGHLPPWPRKALNNSVIAMEQAYRQRKGLPSLTDA |
| Ga0187782_102978322 | 3300017975 | Tropical Peatland | MADESGKGVANGVLGHLPPWPRKALNNSVIAMEQAYRQRK |
| Ga0187878_10903821 | 3300018005 | Peatland | MADDSPKSVVNGVLGHLPPWPRKALGNSIIAMEQACRQREGLPLLT |
| Ga0187810_104110441 | 3300018012 | Freshwater Sediment | MADESAKGGVLGHLPPWPRKALNNSVIGMEQAYRQRKG |
| Ga0187862_107038091 | 3300018040 | Peatland | MADDSTKSVGNGVLGHLPPLPRKQLSNSLIAMEQACRKRE |
| Ga0187766_112632462 | 3300018058 | Tropical Peatland | MADDSKILGHLPPLPRKALNNSVIGMEQAYRQRKGLAPLSDAEIEALKAGV |
| Ga0187772_102738322 | 3300018085 | Tropical Peatland | VADDSPKNVVNGLLGHLPPWPRKVLNSSVVAMEQAYRQRKGLLMLSEEEIRALKAGE |
| Ga0187769_104049122 | 3300018086 | Tropical Peatland | MADDSPKSVVNGLLGHLPPWPRKQLSNSLIAMEQACRQREGLPLLSDAEIG |
| Ga0187769_109381401 | 3300018086 | Tropical Peatland | MHEGSGMADESGKGVANGVLGHLPPWPRKALNNSVIAMEQA |
| Ga0210399_103353411 | 3300020581 | Soil | MADESANGVLGHLPPWPRQALNNSVIGMEQAYRQRK |
| Ga0210399_105664491 | 3300020581 | Soil | MADESANAGGILGHLPPWPRKALNNSVIAMEQAYRQRKGLPVLSDADIEA |
| Ga0210399_109667682 | 3300020581 | Soil | MADESAKAGGILGRLPPWPRNALNNSVIAMEQAYRQRKGLPMLSDADIEA |
| Ga0210401_104739382 | 3300020583 | Soil | MADESANAGGILGHLPPWPRKALNNSVIAMEQAYR |
| Ga0210401_106799501 | 3300020583 | Soil | MADESAKGGILGHLPPWPRNALNNSVIAMEQAYRQRKGLSLLSDA |
| Ga0210401_111441361 | 3300020583 | Soil | MTDESAKAGVLGRLPPWPRQALNNSVIAMEQAYRQRKGL |
| Ga0210401_112442372 | 3300020583 | Soil | MADESAKAGGILGHLPPWPRQALNNSVIGMEQAYRQRK |
| Ga0210400_100081461 | 3300021170 | Soil | MAEESKGVLGHLPPLPRPALNNSVIGMEQAYRQRKGLPLLSDAD |
| Ga0210400_103122392 | 3300021170 | Soil | MADESAKAGGVLGHLPPWPRNALNNSVIGMEQAYRQRKGLPLL |
| Ga0210400_113369341 | 3300021170 | Soil | MADESANAGGILGHLPPWPRKALNNSVIAMEQAYRQRKGLPVLSD |
| Ga0210388_104518712 | 3300021181 | Soil | MADESANAGGILGHLPPWPRKALNNSVIAMEQAYRQRKGLPVLTDAD |
| Ga0210387_101295733 | 3300021405 | Soil | MADESANAGGILGHLPPWPRNALNNSVIAMEQAYRQ |
| Ga0210387_104325931 | 3300021405 | Soil | MADESANAGGILGHLPPWPRNALNNSVIAMEQAYRQR |
| Ga0210383_103827912 | 3300021407 | Soil | MADESANGGVLGHLPPWPRNALNNSVIAMEQAYRQRKGLPLLSDADIEA |
| Ga0210394_105497901 | 3300021420 | Soil | MADESANAGGILGHLPPWPRKALNNSVIAMEQAYRQRKG |
| Ga0210384_110145592 | 3300021432 | Soil | MADESAKGGVLGHLPAWPRKALNNSVIGMEQAYRQRKGLPLLTDAD |
| Ga0210391_104764602 | 3300021433 | Soil | MADESAKGGVLGHLPPWPRNALNNSVIAMEQAYRQRKGLPLLSDADIEA |
| Ga0210391_113111871 | 3300021433 | Soil | MADESAGGGVLGHLPPWPRQALNNSVIAMEQAYRQ |
| Ga0210392_111033962 | 3300021475 | Soil | MADESAKAGGILGHLPPWPRQALNNSVIAMEQAYRQRKGLPALSDA |
| Ga0210402_105769861 | 3300021478 | Soil | MADESAKAGGILGHLPPWPRQALNNSVIAMEQAYRQRKGLSLLSDADIEA |
| Ga0126371_113854941 | 3300021560 | Tropical Forest Soil | MADESKGILGHLPPLPRKALNNSVIGMEQAYRQRKG |
| Ga0126371_135275901 | 3300021560 | Tropical Forest Soil | MADESKGVLGHLPPLPRPALNNSVIAMEQAYRKRKGLPLLSDADIEAL |
| Ga0242654_101926161 | 3300022726 | Soil | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGLQL |
| Ga0224570_1136642 | 3300022730 | Rhizosphere | MADESANAGGILGHLPPLPRKALNNSVIGMEQAYRQRKGLPLLSDAD |
| Ga0208686_10201921 | 3300025500 | Peatland | MADDSPKSVGNGVLGHLPPLPRRALSNSFLAMEQASRQRE |
| Ga0207710_103254931 | 3300025900 | Switchgrass Rhizosphere | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGLPLLSDADIEALK |
| Ga0207685_102919712 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRK |
| Ga0207700_107076751 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MADEQSKAGGILGHLPPLPRKPLNNSVIGMEQAYRQRKGLPALTDAEVEALKA |
| Ga0207665_101223451 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGLQLLTDADIEALK |
| Ga0207665_106236621 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MADESKTGILGRLPPLPRPALNNSVIGMEQAYRQRK |
| Ga0207640_109848511 | 3300025981 | Corn Rhizosphere | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKG |
| Ga0207641_107210182 | 3300026088 | Switchgrass Rhizosphere | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGLTLLTEADIEAL |
| Ga0207698_115448841 | 3300026142 | Corn Rhizosphere | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGLTLLTEADIE |
| Ga0209350_10049417 | 3300026277 | Grasslands Soil | MADESPKSVANGVLGHLPPWPRPALNNSVIGMEQAYRQRKNLPPLTDE |
| Ga0209839_100164051 | 3300026294 | Soil | MADESNAGILGHLPPLPRPALNNSVIGMEQAYRQRKGLTLL |
| Ga0209239_12448881 | 3300026310 | Grasslands Soil | MADQSSKSVVNGVLGHLPPWPRQALNNSVIGMEQAYRQRKGLPPLTDED |
| Ga0209377_13478552 | 3300026334 | Soil | MADQSSKSVVNGVLGHLPPWPRQALNNSVIGMEQAYR |
| Ga0209807_12212182 | 3300026530 | Soil | LVVALRGVKEPMADESKTGILGHLPPLPRPALNNSVIGMEQ |
| Ga0209376_10770051 | 3300026540 | Soil | MPDESKGILGHLPPLPRAALNNSVIGMEQAYRKRKGLPLLTDADIE |
| Ga0179587_104781261 | 3300026557 | Vadose Zone Soil | MADESAKAGGVLGHLPPWPRNALNNSVIGMEQAYRQRK |
| Ga0209010_10951702 | 3300027370 | Forest Soil | MADESAKGILGHLPPLPRPALNNSVIGMEQAYRKRKGLQL |
| Ga0208199_10979561 | 3300027497 | Peatlands Soil | MADESAKAGVLGHLPPWPRKALNNSVIGMEQAYRQRKGLP |
| Ga0208043_11696542 | 3300027570 | Peatlands Soil | MADGSANAGGILGHLPPWPRKALNNSVIAMEQAYRQRK |
| Ga0208324_10105644 | 3300027604 | Peatlands Soil | MADGSANAGGILGHLPPWPRKALNNSVIAMEQAYRQRKG |
| Ga0209772_101479072 | 3300027768 | Bog Forest Soil | MADESAKAGGILGHLPPWPRSALNNSVIGMEQAYRQRKGLPLLSDADIE |
| Ga0209773_100217941 | 3300027829 | Bog Forest Soil | MADESANAGVLGHLPPWPRNALNNSVIAMEQAYRQRKGLPLLSDA |
| Ga0209180_104009291 | 3300027846 | Vadose Zone Soil | MADQSSKSVVNGVLGHLPPWPRQALNNSVIGMEQA |
| Ga0209517_101341434 | 3300027854 | Peatlands Soil | MADDSPKSVGNGVLGHLPPLPRRALSNSFLAMEQASRQREGLPLL |
| Ga0209701_106807691 | 3300027862 | Vadose Zone Soil | MADDPSKTAAKGFLGRLPPLPRNALNNSVIAMEQA |
| Ga0209167_107612651 | 3300027867 | Surface Soil | MTDESAKAGVLGHLPPWPRKALNNSVIAMEQAYRQ |
| Ga0209169_100134036 | 3300027879 | Soil | MADESAKAGGILGRLPPWPRNALNNSVIAMEQAYRQRKALPLLTDS |
| Ga0209169_100779423 | 3300027879 | Soil | MADESANGGVLGHLPPWPRNALNNSVIAMEQAYRQRKGLPLL |
| Ga0209415_100996181 | 3300027905 | Peatlands Soil | MADESAKSGVLGHLPPWPRKALNNSVIGMEQAYRQR |
| Ga0209006_104338322 | 3300027908 | Forest Soil | MADESAKAGGVLGHLPPWPRQALNNSVIGMEQAYRQRK |
| Ga0307504_102082052 | 3300028792 | Soil | MADDSPKSVVNGFLGHLPPWPRKALNNWVIGMEQAY |
| Ga0308309_102981461 | 3300028906 | Soil | MADESAKAGGVLGHLPPWPRQALNNSVIGMEQAYRQRKGLPLLSDGDIEALKA |
| Ga0308309_111573432 | 3300028906 | Soil | MADESAKAGGILGHLPPWPRAALNNSVIAMEQAYRQRKGLPSLSD |
| Ga0316363_100282821 | 3300030659 | Peatlands Soil | MADDSPKSVGNGVLGHLPPLPRRALSNSFLAMEQASRQREGLPLLTDADIEAL |
| Ga0316363_101402292 | 3300030659 | Peatlands Soil | MADESAKGVLGHLPPWPRKALNNSVIGMEQAYRQRKG |
| Ga0316363_103488221 | 3300030659 | Peatlands Soil | MADDSPKSVGNGVLGHLPPWPRKQLSNSLIAMEQACRKR |
| Ga0308198_11007781 | 3300030904 | Soil | MADESKTGILGRLPPLPRPALNNSVIGMEQAYRQRKGLTL |
| Ga0170824_1284827041 | 3300031231 | Forest Soil | MADESAKAGGILGHLPPWPRQALNNSVIAMEQAYRQRKGLP |
| Ga0310686_1081171492 | 3300031708 | Soil | MADESAKGVLGHLPPWPRQALNNSVIGMEQAYRQRKGLPALTDADIEALKA |
| Ga0307478_111942291 | 3300031823 | Hardwood Forest Soil | MADESAKGILGHLPPLPRPALNNSVIGMEQAYRQRKGLPMLSDAD |
| Ga0306926_110483461 | 3300031954 | Soil | MADESAEGVQNGILGHLPPWPRQALNNSVIAMEQAYRQR |
| Ga0307470_117082632 | 3300032174 | Hardwood Forest Soil | MADESKTGILGHLPPLPRPALNNSVIGMEQAYRQRKGLTLLTDADIE |
| Ga0307471_1000481801 | 3300032180 | Hardwood Forest Soil | MADESPKSVANGVLGHLPPWPRPALNNSVIGMEQAYRQ |
| Ga0307471_1042758112 | 3300032180 | Hardwood Forest Soil | MADESKTGILGHLPPLPRAALNNSVIAMEQAYRQRKG |
| Ga0335080_123945291 | 3300032828 | Soil | MADESAKGFLGHLPPLPRKELNNSVIAMEQAYRQR |
| Ga0335081_111288412 | 3300032892 | Soil | MADDSVKGILGHLPPWPRAALNNSVIAMEQAYRQRKSLPLLSD |
| Ga0335077_115814402 | 3300033158 | Soil | MADGSSGIRGHLPPLPRKALNNSVIAAEQAYRKRSNLPLLSEEEITA |
| Ga0326727_110448872 | 3300033405 | Peat Soil | MADDSPKSLGNGLLGHLPPWPRKALSNSIIAMEQACRQREGLPLL |
| Ga0310811_107303002 | 3300033475 | Soil | MADEQSKAGGILGHLPPLPRKPLNNSVIGMEQAYRQRKG |
| ⦗Top⦘ |