NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F052122

Metagenome / Metatranscriptome Family F052122

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F052122
Family Type Metagenome / Metatranscriptome
Number of Sequences 143
Average Sequence Length 51 residues
Representative Sequence MSKTVAVFSSALLCLLFVSTASLRAQGTPPPDFTGVYSPIDPFGQAGR
Number of Associated Samples 130
Number of Associated Scaffolds 143

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 95.80 %
% of genes near scaffold ends (potentially truncated) 97.90 %
% of genes from short scaffolds (< 2000 bps) 95.80 %
Associated GOLD sequencing projects 124
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.601 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(14.685 % of family members)
Environment Ontology (ENVO) Unclassified
(28.671 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.259 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 35.53%    β-sheet: 0.00%    Coil/Unstructured: 64.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 143 Family Scaffolds
PF03404Mo-co_dimer 2.10
PF04307YdjM 1.40
PF13360PQQ_2 1.40
PF00950ABC-3 1.40
PF00561Abhydrolase_1 1.40
PF12704MacB_PCD 0.70
PF11720Inhibitor_I78 0.70
PF02922CBM_48 0.70
PF00034Cytochrom_C 0.70
PF00884Sulfatase 0.70
PF13442Cytochrome_CBB3 0.70
PF02776TPP_enzyme_N 0.70
PF07690MFS_1 0.70
PF13406SLT_2 0.70
PF07995GSDH 0.70
PF05000RNA_pol_Rpb1_4 0.70
PF01297ZnuA 0.70
PF02687FtsX 0.70

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 143 Family Scaffolds
COG0609ABC-type Fe3+-siderophore transport system, permease componentInorganic ion transport and metabolism [P] 1.40
COG1108ABC-type Mn2+/Zn2+ transport system, permease componentInorganic ion transport and metabolism [P] 1.40
COG1988Membrane-bound metal-dependent hydrolase YbcI, DUF457 familyGeneral function prediction only [R] 1.40
COG4606ABC-type enterochelin transport system, permease componentInorganic ion transport and metabolism [P] 1.40
COG0086DNA-directed RNA polymerase, beta' subunit/160 kD subunitTranscription [K] 0.70
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.70

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.60 %
UnclassifiedrootN/A1.40 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000953|JGI11615J12901_10401370All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300000956|JGI10216J12902_109442041All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300004463|Ga0063356_105560829All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300004643|Ga0062591_102404751All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005093|Ga0062594_102063302All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300005093|Ga0062594_102068432All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300005290|Ga0065712_10329589All Organisms → cellular organisms → Bacteria → Proteobacteria791Open in IMG/M
3300005290|Ga0065712_10546413All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300005294|Ga0065705_10606352All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300005295|Ga0065707_10097521All Organisms → cellular organisms → Bacteria3167Open in IMG/M
3300005328|Ga0070676_11565275All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300005340|Ga0070689_101412932All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300005345|Ga0070692_11171891All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300005347|Ga0070668_100664420All Organisms → cellular organisms → Bacteria → Proteobacteria917Open in IMG/M
3300005367|Ga0070667_102291768All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300005440|Ga0070705_101866520All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300005441|Ga0070700_101876227All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300005444|Ga0070694_100401171All Organisms → cellular organisms → Bacteria → Proteobacteria1073Open in IMG/M
3300005444|Ga0070694_101686768All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300005445|Ga0070708_102091375All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300005459|Ga0068867_100571860All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300005518|Ga0070699_101014830All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300005543|Ga0070672_100060461All Organisms → cellular organisms → Bacteria → Acidobacteria2983Open in IMG/M
3300005544|Ga0070686_101640617All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300005549|Ga0070704_101994469All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300005577|Ga0068857_101177532All Organisms → cellular organisms → Bacteria → Proteobacteria742Open in IMG/M
3300005618|Ga0068864_100673124All Organisms → cellular organisms → Bacteria → Proteobacteria1009Open in IMG/M
3300005718|Ga0068866_11190740All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300005829|Ga0074479_10515669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium1239Open in IMG/M
3300006173|Ga0070716_101383349All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300006237|Ga0097621_100190755All Organisms → cellular organisms → Bacteria1775Open in IMG/M
3300006755|Ga0079222_10530635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis873Open in IMG/M
3300006844|Ga0075428_100035088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium5529Open in IMG/M
3300006845|Ga0075421_102319162All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300006852|Ga0075433_10974210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria739Open in IMG/M
3300006853|Ga0075420_100246706All Organisms → cellular organisms → Bacteria → Proteobacteria1552Open in IMG/M
3300006876|Ga0079217_10725322All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300006880|Ga0075429_100442629All Organisms → cellular organisms → Bacteria → Proteobacteria1139Open in IMG/M
3300006880|Ga0075429_101748294All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300006918|Ga0079216_11719412All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300006969|Ga0075419_10958519All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300007004|Ga0079218_10335874All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300007004|Ga0079218_10708885All Organisms → cellular organisms → Bacteria → Proteobacteria946Open in IMG/M
3300007004|Ga0079218_12833338All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300007076|Ga0075435_101232045All Organisms → cellular organisms → Bacteria → Proteobacteria655Open in IMG/M
3300009012|Ga0066710_100680375All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1567Open in IMG/M
3300009078|Ga0105106_11075233All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300009094|Ga0111539_10479998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1448Open in IMG/M
3300009100|Ga0075418_10330438All Organisms → cellular organisms → Bacteria1627Open in IMG/M
3300009101|Ga0105247_11307493All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300009156|Ga0111538_13116889All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300009176|Ga0105242_12304101All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300010045|Ga0126311_11894064All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300010047|Ga0126382_10057580All Organisms → cellular organisms → Bacteria2314Open in IMG/M
3300010047|Ga0126382_11069856All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300010359|Ga0126376_11409840All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300010361|Ga0126378_11339577All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300010366|Ga0126379_12984188All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300010400|Ga0134122_10917894All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300011119|Ga0105246_12150411All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300011395|Ga0137315_1029576All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300011423|Ga0137436_1057399All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium999Open in IMG/M
3300011430|Ga0137423_1206079All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300011439|Ga0137432_1076855All Organisms → cellular organisms → Bacteria → Proteobacteria1026Open in IMG/M
3300012039|Ga0137421_1192902All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300012129|Ga0137345_1056788All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300012157|Ga0137353_1071437All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300012163|Ga0137355_1066571All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300012212|Ga0150985_106196250All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300012225|Ga0137434_1072743All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300012228|Ga0137459_1236405All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300012517|Ga0157354_1001831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1534Open in IMG/M
3300012672|Ga0137317_1024622All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300012891|Ga0157305_10039361All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300012897|Ga0157285_10324939All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300012906|Ga0157295_10134564All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300012913|Ga0157298_10244345All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300012948|Ga0126375_11402249All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300012955|Ga0164298_11290242All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300012971|Ga0126369_11809143All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300012989|Ga0164305_10850185All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300013297|Ga0157378_10745203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1002Open in IMG/M
3300013306|Ga0163162_11487542All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300013308|Ga0157375_12746371All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300014166|Ga0134079_10676583All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300014488|Ga0182001_10459245All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300014745|Ga0157377_10073912All Organisms → cellular organisms → Bacteria → Acidobacteria1976Open in IMG/M
3300014969|Ga0157376_10575441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1118Open in IMG/M
3300014969|Ga0157376_10600067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1096Open in IMG/M
3300015077|Ga0173483_10141227All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300015249|Ga0180071_1037983All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300015373|Ga0132257_103964275All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300018432|Ga0190275_12325755All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300019356|Ga0173481_10417799All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300019356|Ga0173481_10481057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium628Open in IMG/M
3300021081|Ga0210379_10321949All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300022880|Ga0247792_1145090All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300022886|Ga0247746_1113322All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300023261|Ga0247796_1130712All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300025315|Ga0207697_10439634All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300025318|Ga0209519_10553148All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300025930|Ga0207701_11029109All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300025936|Ga0207670_11714357All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300025939|Ga0207665_10591110All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300025957|Ga0210089_1021556All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300026041|Ga0207639_10781361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia889Open in IMG/M
3300026116|Ga0207674_11562690All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300026121|Ga0207683_10913412All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300027364|Ga0209967_1064957All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300027880|Ga0209481_10198986All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300027886|Ga0209486_11045639All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300027886|Ga0209486_11200021All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300027907|Ga0207428_10086872All Organisms → cellular organisms → Bacteria → Proteobacteria2434Open in IMG/M
3300028608|Ga0247819_10339112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria852Open in IMG/M
3300028792|Ga0307504_10149837All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300028889|Ga0247827_10914863All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300030619|Ga0268386_11019097All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300031538|Ga0310888_10151471All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1237Open in IMG/M
3300031547|Ga0310887_10488215All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300031562|Ga0310886_10271022All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300031716|Ga0310813_11609900All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300031720|Ga0307469_12409357All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300031740|Ga0307468_100206447All Organisms → cellular organisms → Bacteria → Proteobacteria1335Open in IMG/M
3300031847|Ga0310907_10774108All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300031908|Ga0310900_11667600All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300031940|Ga0310901_10051444All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300031944|Ga0310884_11051965All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300032000|Ga0310903_10534501All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300032017|Ga0310899_10662548All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300032035|Ga0310911_10383038All Organisms → cellular organisms → Bacteria → Proteobacteria813Open in IMG/M
3300032075|Ga0310890_11754984All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300032122|Ga0310895_10741833All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300032144|Ga0315910_10382291All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300032211|Ga0310896_10877824All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300032421|Ga0310812_10272764All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300034115|Ga0364945_0208441All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300034661|Ga0314782_002743Not Available2192Open in IMG/M
3300034661|Ga0314782_127626All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300034662|Ga0314783_095694All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300034662|Ga0314783_139002All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300034664|Ga0314786_084261All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300034664|Ga0314786_160768All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300034675|Ga0314800_079772Not Available509Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil14.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.49%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.09%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil8.39%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.10%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.10%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.40%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.40%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.40%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.40%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.40%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.70%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.70%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.70%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.70%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.70%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.70%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.70%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.70%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.70%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.70%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.70%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.70%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.70%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011395Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT200_2EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300012039Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2EnvironmentalOpen in IMG/M
3300012129Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT530_2EnvironmentalOpen in IMG/M
3300012157Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2EnvironmentalOpen in IMG/M
3300012163Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT800_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012225Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2EnvironmentalOpen in IMG/M
3300012228Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2EnvironmentalOpen in IMG/M
3300012517Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610EnvironmentalOpen in IMG/M
3300012672Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015249Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293A_16_10DEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300023261Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025957Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027364Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034662Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034664Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034675Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11615J12901_1040137013300000953SoilMSKTVAAFSSALLCVLFMSTASLRAQGTSPPDFTGVYSPIDPFGQAR
JGI10216J12902_10944204123300000956SoilMSKTIALLSAAIVCLLFMSTVSPRAQGTSRPDFTGVYSPVDPFGQARRGPAAVP
Ga0063356_10556082913300004463Arabidopsis Thaliana RhizosphereMSKTVAAFSSALLCLLIASTALLHAQRTPPPDFTGVYSPIDPFGQARGGRAATPPP
Ga0062591_10240475113300004643SoilMSKNVTVFSSALLCLLFVSTSSLRAQGTSTPDFTGVYSPIDPF
Ga0062594_10206330223300005093SoilMSKNVTVFSSALLCLLFVSTSSLRAQGTSTPDFTGVYSPIDPFGQARARAAANPPATVVPSPS
Ga0062594_10206843223300005093SoilMSKTGVVFSSVLLCLLFVTTSELRAQGTPTPDFTGVYLPID
Ga0065712_1032958933300005290Miscanthus RhizosphereMSKTVAVFSSALLCLLFVSMALLRAQTTPPPDFTGVYAPIDPFGQARTGGGGRSAVPPP
Ga0065712_1054641323300005290Miscanthus RhizosphereMSKNVTVFSSALLCLLFVSTSSLRAQGTSTPDFTGVYSPIDPFGQARARAAANPPATVVPSPSAGT
Ga0065705_1060635213300005294Switchgrass RhizosphereMKEIIMSKTVAVFSSALLCLLFVSTASLRAQGTSPPDFTGV
Ga0065707_1009752113300005295Switchgrass RhizosphereMSKTIAVFSSALLCLLFVSTASLRAQGTPPPDFTGVYSPIDPFGQARGGR
Ga0070676_1156527513300005328Miscanthus RhizosphereMSKTVAVFSSALLCLLFVSQASLRAQGTPPPDFTGVYAPIDPFGQARGGRAA
Ga0070689_10141293213300005340Switchgrass RhizosphereMSKTVAVFASALLCLLFVSTASLRAQATSPPDFTGVYSPIDPFGQ
Ga0070692_1117189123300005345Corn, Switchgrass And Miscanthus RhizosphereMSKTVTVFSSAFLCLLFVSTASLRAQGTAAPDFTGVYSPIDPFGQA
Ga0070668_10066442033300005347Switchgrass RhizosphereMSKTVAVFSSVLLCLLFVSMALLRAQTTPPPDFTGVYAPI
Ga0070667_10229176813300005367Switchgrass RhizosphereMSKTVAVFSSALLCLLFVSTELLRAQATAPPDFTGVYSPIDPFGQARG
Ga0070705_10186652023300005440Corn, Switchgrass And Miscanthus RhizosphereMSKTVTVFSSALLCLLFVSTASLRAQGTPPPDFTGVYSPIDPFGQ
Ga0070700_10187622713300005441Corn, Switchgrass And Miscanthus RhizosphereMSKTVAVFSLTFLCLLFVSTQSLHAQGTPPPDFTGVYSPIDPFGQARGGRAATPPPAPQP
Ga0070694_10040117113300005444Corn, Switchgrass And Miscanthus RhizosphereMSKAIVVFSSAFLCLLFVTTSSLRAQGPPPPDFTGVYMPVDPFGQFRRPAAPSPAVTSDGALPPP
Ga0070694_10168676823300005444Corn, Switchgrass And Miscanthus RhizosphereMSKNVTVFSSALLCLLFVSTSSLRAQGTSTPDFTGVYSPIDPFGQARARAAANPPAT
Ga0070708_10209137513300005445Corn, Switchgrass And Miscanthus RhizosphereMSKTVAVFSSALLCLLFVSTASLRAQATPPPDFTGVYSPIDPFGQARGGQ
Ga0068867_10057186033300005459Miscanthus RhizosphereMSKTVVVFSSALLCLLFVSAASLRAQATPPPDFTGVYAPIN
Ga0070699_10101483013300005518Corn, Switchgrass And Miscanthus RhizosphereMSKTVAVFSSALLCLLFASMALLRAQATPPPDFTGVYSPIDPFGQARGGR
Ga0070672_10006046143300005543Miscanthus RhizosphereMSKTLAVFSSALLCLLFASTASLRAQGTPPPDFTGVYSPIDPFG
Ga0070686_10164061723300005544Switchgrass RhizosphereMSKAIVVLFSAFLCLLFVTTSSLRAQGPPPPDFTGVYMPVDPFGQFRRP
Ga0070704_10199446913300005549Corn, Switchgrass And Miscanthus RhizosphereMSKTVAVFSSALLCLLFVSTASLRAQATPPPDFTGVYSPIDPFGQARGGQARGGQAAVPP
Ga0068857_10117753233300005577Corn RhizosphereMKDNVMSKTVAVFSSVLLCLLFVSMALLRAQTTPP
Ga0068864_10067312413300005618Switchgrass RhizosphereMSKNVTVFSSALLCLLFVSTSSLRAQGTSTPDFTGVYSPIDPFGQARARAAANPPATVVPSPSAGTGAG
Ga0068866_1119074013300005718Miscanthus RhizosphereMSKTVAVFSSALLCLLFVSTELLRAQATAPPDFTGVYSPIDPFGQARGGRAATPPTAAVPPP
Ga0074479_1051566933300005829Sediment (Intertidal)MSKTVAVCSPALLCLLFVSTAPLRAQGTPPPDFTGVYSPIDPFGQA
Ga0070716_10138334923300006173Corn, Switchgrass And Miscanthus RhizosphereMAKTVALLCLLTVSTVSLRAQVKPTPDFTGVYSPIDPFGQ
Ga0097621_10019075553300006237Miscanthus RhizosphereMAKTVALLCLLFASTVSLRAQGKPTPDFTGVYSPIDPFGQAR
Ga0079222_1053063533300006755Agricultural SoilMSKTVAMFSSALLCVLFVSTASLRAQGTPTPDFTGVY
Ga0075428_10003508873300006844Populus RhizosphereMSKTVAAFSSALLCLLFASTASLRAQGTPPPDFTGVYSPIDPFGQARGGRAATPPPA
Ga0075421_10231916223300006845Populus RhizosphereMSKTVAVFSSALLCLLFALTASLRAQGTSTPDFTGVYSPIDPFGQARARAAAAQPAA
Ga0075433_1097421013300006852Populus RhizosphereMSKTIAVFSSALLGLLFVTTSALRAQETPPPDFTGVYMPVDPFGQFRRPAAAPPASDGVPAPR
Ga0075420_10024670613300006853Populus RhizosphereMSKAIAVFSSAFLCLLFVTTSSLRAQGPPPPDFTGVYMPVDPFGQFRRPAAPSPAVTSDG
Ga0079217_1072532213300006876Agricultural SoilMSKTVAVFSSALLCLLFVSTASLRAQGTPPPDFTGVYSPIDPFGQAGRGRAGAPPPAA
Ga0075429_10044262933300006880Populus RhizosphereMSKNVTVFSSALLCLLFVSTSSLRAQGTSTPDFTGVYSPIDPFGQARARAAA
Ga0075429_10174829413300006880Populus RhizosphereMSKTVAVFSSAVVCLLFVSTVSPRTQGTQPPDFTGVYA
Ga0079216_1171941213300006918Agricultural SoilMSKTIAVLSSLLCLLFVSTALLRAQGTPPPDFTGVYSPIDPFGQAGRGRAAGPPPAV
Ga0075419_1095851913300006969Populus RhizosphereMSKTVAVFSSALLCLLFVSTELLRAQATPPPDFTSVYSPIDPFGQARGG
Ga0079218_1033587413300007004Agricultural SoilMSKTVAVFSSALLCLLFVSTALLRTQGTPPPDFTGVYSPIDPFGQAGRGRA
Ga0079218_1070888513300007004Agricultural SoilVSKAIVVFSSVLLCLLFVTTASLRAQGTPPPDFTGVYLPVDPFGQF
Ga0079218_1283333813300007004Agricultural SoilMSKTVAVFSSALLCLLFVSTASLRAQGTPPPDFTGVYSPIDPFGQAGRGRAAGAQPAAVPPTA
Ga0075435_10123204513300007076Populus RhizosphereMSKAIVVCSSAFLCLLFVTTSSLRAQGPPPPDFTGVY
Ga0066710_10068037533300009012Grasslands SoilMAKIVALLCLLFVSTASLRAQGKPTPDFTGVYSPIDPFGQARARAAAFAPPATVPP
Ga0105106_1107523313300009078Freshwater SedimentMRENIMSKTVAVFSSALLCLLFVSTASLRAQGTPPPDFTGVYSPIDP
Ga0111539_1047999813300009094Populus RhizosphereMSKAIVVFSSAFLCLLFVTTSSLRAQGPPPPDFTGVYMPVD
Ga0075418_1033043813300009100Populus RhizosphereMRNNIMSKTVTVFSSALLCLLFVSTASLRAQGTPRPDFTGVYSPVDPFGQAGRGR
Ga0105247_1130749323300009101Switchgrass RhizosphereMSKTVAVFSSALLCLLFASTASLRAQGTPLPDFTGVYSPI
Ga0111538_1311688923300009156Populus RhizosphereMSKTVAVFSSALLCLLFASTASLRAQGTPPPDFTGVYSPI
Ga0105242_1230410123300009176Miscanthus RhizosphereMSKTVAVFSSALLCLLFVSTALPRGQGTAPPDFTGVYSPIDPFGQ
Ga0126311_1189406423300010045Serpentine SoilVITVRKNIMSKTVAVFSSALLCLLFVATTSLRAQGPPPPD
Ga0126382_1005758043300010047Tropical Forest SoilMSKTVAVFSSALLCLLFVSTASLHAQGTPPPDFTGVYSPIDPFGQARGGR
Ga0126382_1106985613300010047Tropical Forest SoilMSKAMVVFSSVLLCLPLVTPSSLHAQATPPPDFTGVYMPIDPF
Ga0126376_1140984023300010359Tropical Forest SoilMAKIAAFLCLLFVPFLSMASLRAQGTSKPDFTGVYAPIDPFGQARARAAAAAPAATVPPPAAG
Ga0126378_1133957733300010361Tropical Forest SoilMAKIAALLCLLFVPFVSTASLRAQGTSKPSFTGVYAPIDPFGQARARAAAAAPATVPPPAAGTNSG
Ga0126379_1298418823300010366Tropical Forest SoilMREHIMSKAVAFPSLLFVLFVSMASPLLAQGTSKPDFTGVYAPIDPFGQARARAAAAAPPATVPP
Ga0134122_1091789433300010400Terrestrial SoilMSKAMVVFSSVLLCFLLLVTTSSLRAQGTPPPDFTGVYMPIDPFRQFRRPAAPPPAT
Ga0105246_1215041123300011119Miscanthus RhizosphereMMESIMSKTVAAFSSALLCLLIASTALLHAQRTPPPDFTGVYSPI
Ga0137315_102957613300011395SoilMRENIMSKTVTVFSSALLCLLFVSTASLRAQGTLPPDFTGVYSPIDPFGQARSRAAVPP
Ga0137436_105739933300011423SoilMRDNIMSKTVAVFSSALLCLLFVSTASLRAQATPPPDFTGVYSPIDPFGQ
Ga0137423_120607923300011430SoilMRKNIMSKTVAVFSSALLCLLFVSTALLRAQGTPPPDFTGVYSPIDPFGQARGGRAAAPP
Ga0137432_107685513300011439SoilMSKAIVVFASALLCLFVTASPLRAQETPPPDFTGVYFPIDPFGQ
Ga0137421_119290223300012039SoilMRENIMSKTVALISSALLCLLFVSMASLRAQGTPPDFTGVYSPIDPFGQARGGR
Ga0137345_105678823300012129SoilMRENIMSKTVAVFSSALLCLLFVSTALLRAQGTPPPDFTGVYSPIDPFGQVRGGRAAAPPPAAGTRG
Ga0137353_107143723300012157SoilMRDTIMSKTVVVLSSALVCLLSVSTASPRAQGMPPPDFTGVYTP
Ga0137355_106657123300012163SoilMSKTVAVFSSALLCLLFVSTASLRAQGTPPPDFTGVYSPIDPFGQAGRGRAAVPPP
Ga0150985_10619625023300012212Avena Fatua RhizosphereMSKAIVVFSSVLLCLPLVTPSSLHAQATSPPDFTGVYMPIDPFGQFR
Ga0137434_107274323300012225SoilMSKTVALLSSALVCLLAVSTASLRAQGPPPPDFTG
Ga0137459_123640513300012228SoilMSKTVAVFSSALLCLLFVSTASLRAQATSPPDFTG
Ga0157354_100183143300012517Unplanted SoilMKDNVMSKTVAVFSSALLCLLFVSMALLRAQTTPPPDLTGVYAP
Ga0137317_102462223300012672SoilMSKTVAVFSSALLCLLFVSTALLRAQGTPPPDFTGVYSPIDPFGQARGGRAAVPP
Ga0157305_1003936113300012891SoilMKENVMSKTVVVFSSALLCLLFVSAASLRAQATPPPDFTGVYAPINPFGQARGGRAAT
Ga0157285_1032493923300012897SoilVITARKNIMSKTATVFSSVLLCLLFVSTASLRAQGTSPPDFTGVYSPIDP
Ga0157295_1013456423300012906SoilMSKAIVVFSSAFLCLLFVTTSSLRAQGPPPPDFTGVYMPVDPFGQFRRP
Ga0157298_1024434523300012913SoilMSKTVAVFSSALLCLQFASTASLRAQGTPPPDFTGVYSPI
Ga0126375_1140224913300012948Tropical Forest SoilMSKRVAVLSSAFLCLLFVSTPWLRAQGTPPPDFTGVYQPIDPFAQSRGGRAAAPPQ
Ga0164298_1129024223300012955SoilMSKTVAIFSSALLCLLFVSTQSLHAQGTPPDFTGVYSPIDPFGQAR
Ga0126369_1180914323300012971Tropical Forest SoilMTMAKNLLLFSWAPLCLLLVATASLHAQGTSKPDFTGVYAPIDPFGQARARAAAAAPPAT
Ga0164305_1085018513300012989SoilMAKIAALLCLLFVSTVSLRAQVKPTPDFTGVYSPIDPFGQARARAAASAQP
Ga0157378_1074520313300013297Miscanthus RhizosphereMRENIMAKTVGLLCLLFVATGLLHAQSKPTPDFTGVYTPIDPFAQARARAAASAP
Ga0163162_1148754213300013306Switchgrass RhizosphereMSKNVTVFSSALLCLLFVSTSSLRAQGTSTPDFTGVYSPIDPFGQARARAAAN
Ga0157375_1274637123300013308Miscanthus RhizosphereMREKIMSKTVAGFSSALLCLLFVSTASLRAQGTSPDFTGVYSPIDPFGQA
Ga0134079_1067658313300014166Grasslands SoilMAKIVALLCLLFVSTASLRAQGKPTPDFTGVYSPIDPFGQARARAAASAP
Ga0182001_1045924513300014488SoilMSKTVAVCSSALLCLLFVSTASLRAQGTSPPDFTGVYSPIDPFGQ
Ga0157377_1007391233300014745Miscanthus RhizosphereMSKTLAVFSSALLCLLFASTASLRAQGTPPPDFTGVYSPIDPFGQAGRGRAAV
Ga0157376_1057544113300014969Miscanthus RhizosphereMKDNVMSKTVAVFSSALLCLLFVSMALLRAQTTPPPDFTGVYAPIDPFGQARTG
Ga0157376_1060006733300014969Miscanthus RhizosphereLREIIMAKIAALLCLLFVSTVSLRAQVKPTPDFTGVYSPIDPFGQARARAAASA
Ga0173483_1014122713300015077SoilMMESIMSKTVAVFSWALLCLLFVSTASLRAQGTAAPDFTGVYSPIDPFGQ
Ga0180071_103798313300015249SoilMSRIVAVFSSALLCLLFVATASLRAQGTPPPDFTGVYSPIDPFGQARGGRA
Ga0132257_10396427523300015373Arabidopsis RhizosphereVRNNIMSKNVTVFSSALLCLLFVSTSSLRAQGTSTPDFTGVYSPIDPFGQARARAAANPPATVVPS
Ga0190275_1232575513300018432SoilMSKAIVVFSSVLLCLLLVATSSLRAQGTPLPDFTGVYSPVDPFGQFRRATAPAP
Ga0173481_1041779933300019356SoilMSKTVAVFSSALLCLLFVSMALLRAQTTPPPDFTGVYAPTDPFGQART
Ga0173481_1048105723300019356SoilMSKTSVVLSSVLLCLLFVTTSDLRAQGTPAPDFTGRTKR
Ga0210379_1032194913300021081Groundwater SedimentMSKTVAVFSSALLCLLFVSTASLRAQGTPPPDFTGVYSPIDPFGQARGGRAAAPP
Ga0247792_114509013300022880SoilMSKTVAVFSSALLCLLFVSQASLRAQGTPPPDFTGVYAPIDPFGQARGG
Ga0247746_111332213300022886SoilMSKTVAVFSSALLCLLFASTASLRAQGTPLPDFTGVYSPIDPFGRAG
Ga0247796_113071223300023261SoilMSKTVAVFSSALLCLLFASTASLRAQGTPPPDFTGVYSP
Ga0207697_1043963413300025315Corn, Switchgrass And Miscanthus RhizosphereMSKNVTVFSSALLCLLFVSTASLRAQGTSPDFTGVYSPIDPFGQA
Ga0209519_1055314813300025318SoilMSKTVAVFSSALLCLLFVSMASLRAQGTPPPDFTGVYSPIDPFGQAGRGRAAVPPPPAG
Ga0207701_1102910923300025930Corn, Switchgrass And Miscanthus RhizosphereMSKTVAIFSSALLCLFFVSTQSLHAQGTPPDFTGVYSPIDPFGQA
Ga0207670_1171435713300025936Switchgrass RhizosphereMSKTVAVFASALLCLLFVSTASLRAQATSPPDFTGVYSPIDPFGQARGR
Ga0207665_1059111013300025939Corn, Switchgrass And Miscanthus RhizosphereMAKTVALLCLLTVSTVSLRAQVKPTPDFTGVYSPIDPFGQARARAAASAPPAAVPPPAAGTNSGGVPPPR
Ga0210089_102155623300025957Natural And Restored WetlandsMSKTVAVFSSALLCLLFVSTASLRAQGTPPPDFTGVYSPIDPFGQAGRGRAAAPPPA
Ga0207639_1078136113300026041Corn RhizosphereMSKTVAVFSSALLCLLFVSTALPRGQGTAPPDFTGVYSPIDPFGQARGGRAA
Ga0207674_1156269023300026116Corn RhizosphereMSKTVVVFSSALLCLLFVSAASLRAQATPPPDFTGVYAPINPFGQARGGRAATPPPAAGTRGDA
Ga0207683_1091341233300026121Miscanthus RhizosphereMSKTVAVFSSALLCLLFVSQASLRAQGTPPPDFTG
Ga0209967_106495713300027364Arabidopsis Thaliana RhizosphereMSKAIVVFASLLLCLLFVTTSSLRAQGTPPPDFTGVYMPVDPFGQ
Ga0209481_1019898613300027880Populus RhizosphereMSKTVAVFSSALLCLLFVSTASLRAQGTPPPDFTGVYSPIDPFGQARGGRAAAPPPAAAP
Ga0209486_1104563913300027886Agricultural SoilMSKTVAVFSSALLCLLFVSTASLRAQGTPPPDFTGVYSPIDPFGQAGR
Ga0209486_1120002113300027886Agricultural SoilMSKTVVVFSSALLYLLFVSTESFRAQGTAPPDFTGVYSPIDPFGQAGRGRAT
Ga0207428_1008687213300027907Populus RhizosphereMSKAIAVFSSAFLCLLFVTTSSLRAQGPPPPDFTGVYMPVDPFGQFRRPAAPSPAVTSDGLPPP
Ga0247819_1033911213300028608SoilMSKTVAVFSSVLLCLLFVSMALLRAQTTPPPDFTGVYAPIDPFGQARAGGGGRSAVPPPAPGPRG
Ga0307504_1014983723300028792SoilMAKTVALLCLLFVSTVSLRAQVKPTPDFTGVYSPIDPFGQARARAAASAPRATVPPP
Ga0247827_1091486323300028889SoilMKDNVMSKTVAVFSSALLCLLFVSTALLRTQGTPPPDF
Ga0268386_1101909723300030619SoilMSKAVAVFSSALLCLLFVSTASLRAQGTPPPDFTGVYSPINPFGQA
Ga0310888_1015147123300031538SoilMSKTVAVFASALLCLLFVSTASLRAQATSPPDFTGVYS
Ga0310887_1048821523300031547SoilMSKTIAVFSSALLGLLFVTTSALRAQETPPPDFTGVYMPVDPFGQFRRPAAAPPASDGVPAP
Ga0310886_1027102233300031562SoilMSKTVAVFSSALLCLLFVSTAWLRAQATPPPDFTGV
Ga0310813_1160990013300031716SoilMAKTVALLCLLTVSTVSLRAQVKPTPDFTGVYSPIDPFGQARARAAAAAPPAAVPPPAAGTN
Ga0307469_1240935723300031720Hardwood Forest SoilMAKIVALLCLLFASTVSLRAQGKPTPDFTGVYSPIDPFGQARARAAAAAPAAT
Ga0307468_10020644713300031740Hardwood Forest SoilMSKTVAVFSSALLCLLFVSMALLRAQGTPPPDFTGVYSPIDPFGQARGGR
Ga0310907_1077410813300031847SoilMSKTVAVFSSALLCLLFVSQASLRAQGTPPPDFTGVYAPIDPFGQARGGRAATPPPAPGTRG
Ga0310900_1166760013300031908SoilMSKTIGIFSSALLCLLFVSTASLRAQGTPPDFTGVY
Ga0310901_1005144413300031940SoilMSKTVAVFSSALLCLLFVSTAWLRAQATPPPDFTGVYSPIDPFGQARGGRAAAPPTAA
Ga0310884_1105196523300031944SoilMSKTVAVFSSALLCLLIVSTASLRAQAAPPPDFTGVYSPIDPFGQARGGRAAVP
Ga0310903_1053450113300032000SoilMSKTVAVFSSALLCLLFASTASLRAQGTPLPDFTGVYSPIDPFGQAGRGRAAVPPP
Ga0310899_1066254823300032017SoilMSKTIAVFSSALLCLLFVSTASLRAQGTPPPDFTGVYSPIDPFGQARGGRAATP
Ga0310911_1038303813300032035SoilMRENIMAKIVALLCLLFVSTTSLPAQVAPRPDFTGVYAPIDPFGQARARAAAAAPPAT
Ga0310890_1175498413300032075SoilMSKTVAVFSSALLCLLFASTASLRAQGTPPPDFTGV
Ga0310895_1074183313300032122SoilMSKTVAVFSSALLCLLFVSTAWLRAQATPPPDFTGVYSP
Ga0315910_1038229143300032144SoilMSKVIVVVSSVLVCLLFLATASLRAQETLPPDFTGVYSPIDPFGQFRRPAAPAP
Ga0310896_1087782423300032211SoilMSKAIVVFSSAFLCLLFVTTSSLRAQGPPPPDFTGVYMPVDPFGQFRRPA
Ga0310812_1027276433300032421SoilMSKTVAVFSSALLCLLFVSMALLRAQTTPPPDFTGVYAPIDPFGQARAG
Ga0364945_0208441_421_5973300034115SedimentMSKTVAVFSSALLCLLFVSTASLRAQGTPPPDFTGVYSPIDPFGQARGGRAATPPPAPQ
Ga0314782_002743_1912_21273300034661SoilMKDNVMSKTVAVFSSVLLCLLFVSMALLRAQTTPPPDFTGVYAPIDPFGQARTGGGGRSAAPPPSPAPRAR
Ga0314782_127626_2_1873300034661SoilMSKTVAVFSSALLCLLFASTASLRAQGTPPPDFTGVYSPIDPFGQARGGRAATPPPAPQPAA
Ga0314783_095694_452_6253300034662SoilMRDTIMSKTVALFSSALLCLLFVATAWLRAQATPPPDFTGVYSPIDPFGQARGGQARG
Ga0314783_139002_440_5503300034662SoilMSKTIGIFSSALLCVLFVSTASLRAQGTPPDFTGVYS
Ga0314786_084261_545_6583300034664SoilMSKNVTVFSSALLCLLFVSTSSLRAQGTSTPDFTGVYS
Ga0314786_160768_1_1473300034664SoilMKDNVMSKTVAVFSSVLLCLLFVSMALLRAQTTPPPDFTGVYAPIDPFG
Ga0314800_079772_73_2763300034675SoilMKDNVMSKTVAVFSSVLLCLLFVSMALLRAQTTPPPDFTGVYAPIDPFGQARAGGGGRSKGKYNNTN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.