NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F052119

Metagenome / Metatranscriptome Family F052119

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F052119
Family Type Metagenome / Metatranscriptome
Number of Sequences 143
Average Sequence Length 52 residues
Representative Sequence MHASIWKFAGDPDELLRRYDAMLDEIPRARMRLHVCLXAPDGIVLVDTCPT
Number of Associated Samples 123
Number of Associated Scaffolds 143

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 78.74 %
% of genes near scaffold ends (potentially truncated) 83.92 %
% of genes from short scaffolds (< 2000 bps) 87.41 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.68

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.315 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(18.881 % of family members)
Environment Ontology (ENVO) Unclassified
(35.664 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.846 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 18.99%    β-sheet: 25.32%    Coil/Unstructured: 55.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.68
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 143 Family Scaffolds
PF01425Amidase 11.19
PF00440TetR_N 4.90
PF07883Cupin_2 4.90
PF12840HTH_20 4.20
PF00155Aminotran_1_2 2.80
PF01575MaoC_dehydratas 2.80
PF13470PIN_3 2.10
PF01402RHH_1 1.40
PF08327AHSA1 1.40
PF11954DUF3471 0.70
PF02899Phage_int_SAM_1 0.70
PF06265YutD-like 0.70
PF00171Aldedh 0.70
PF04014MazE_antitoxin 0.70
PF00069Pkinase 0.70
PF00999Na_H_Exchanger 0.70
PF02566OsmC 0.70
PF09234DUF1963 0.70
PF00383dCMP_cyt_deam_1 0.70
PF05977MFS_3 0.70
PF01569PAP2 0.70
PF10400Vir_act_alpha_C 0.70
PF13561adh_short_C2 0.70
PF00196GerE 0.70

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 143 Family Scaffolds
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 11.19
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.80
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.70
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.70
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.70
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.70
COG4470Uncharacterized conserved protein YutD, DUF1027 familyFunction unknown [S] 0.70
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.70
COG3878Uncharacterized conserved protein YwqG, DUF1963 familyFunction unknown [S] 0.70
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.70
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.70
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.70
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.70
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.70
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.70
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.70
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.70


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.31 %
UnclassifiedrootN/A14.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_105380343All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300000956|JGI10216J12902_109484136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia531Open in IMG/M
3300002562|JGI25382J37095_10159158All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300002908|JGI25382J43887_10326432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium658Open in IMG/M
3300004092|Ga0062389_101819950Not Available788Open in IMG/M
3300004114|Ga0062593_101129582All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300004156|Ga0062589_102506307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300004479|Ga0062595_102501036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae515Open in IMG/M
3300005169|Ga0066810_10122573Not Available597Open in IMG/M
3300005177|Ga0066690_10146188All Organisms → cellular organisms → Bacteria1551Open in IMG/M
3300005181|Ga0066678_10589884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium739Open in IMG/M
3300005184|Ga0066671_10652518All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300005336|Ga0070680_100618139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales930Open in IMG/M
3300005337|Ga0070682_100699304All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales813Open in IMG/M
3300005338|Ga0068868_101864754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300005339|Ga0070660_100133050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1991Open in IMG/M
3300005354|Ga0070675_100723944All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300005437|Ga0070710_10070295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2016Open in IMG/M
3300005446|Ga0066686_10252209All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300005446|Ga0066686_11079613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Smaragdicoccus → Smaragdicoccus niigatensis517Open in IMG/M
3300005468|Ga0070707_101746660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300005535|Ga0070684_101544388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia626Open in IMG/M
3300005540|Ga0066697_10791084All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300005546|Ga0070696_100660852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia848Open in IMG/M
3300005554|Ga0066661_10201847All Organisms → cellular organisms → Bacteria1231Open in IMG/M
3300005558|Ga0066698_10908688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium563Open in IMG/M
3300005563|Ga0068855_100627505All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300005566|Ga0066693_10088071All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300005568|Ga0066703_10761304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300005569|Ga0066705_10507502All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300005569|Ga0066705_10757835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium581Open in IMG/M
3300005576|Ga0066708_10409417All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300005576|Ga0066708_10735848All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300005578|Ga0068854_101329286All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300005614|Ga0068856_100958350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium874Open in IMG/M
3300005844|Ga0068862_100721705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium967Open in IMG/M
3300005844|Ga0068862_101939772All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300006032|Ga0066696_10955362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300006034|Ga0066656_10097905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1777Open in IMG/M
3300006173|Ga0070716_101743042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300006581|Ga0074048_12317015All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300006755|Ga0079222_11644728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium612Open in IMG/M
3300006791|Ga0066653_10671894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300006794|Ga0066658_10079482All Organisms → cellular organisms → Bacteria1494Open in IMG/M
3300006844|Ga0075428_101145226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria821Open in IMG/M
3300009012|Ga0066710_103184769All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300009089|Ga0099828_11158043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium686Open in IMG/M
3300009093|Ga0105240_11461200All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300009137|Ga0066709_103351086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300009137|Ga0066709_103448334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300009137|Ga0066709_104275701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300009176|Ga0105242_10452162All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300010041|Ga0126312_10923239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium637Open in IMG/M
3300010229|Ga0136218_1022280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium715Open in IMG/M
3300010303|Ga0134082_10089695All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300010304|Ga0134088_10239741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium871Open in IMG/M
3300010326|Ga0134065_10094881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium983Open in IMG/M
3300010333|Ga0134080_10191605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium882Open in IMG/M
3300010336|Ga0134071_10291476All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300010364|Ga0134066_10110630All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300010400|Ga0134122_11532486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium687Open in IMG/M
3300010401|Ga0134121_11756306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium645Open in IMG/M
3300011269|Ga0137392_10267028All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300012198|Ga0137364_10642618All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300012198|Ga0137364_10738416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium743Open in IMG/M
3300012201|Ga0137365_10425937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria978Open in IMG/M
3300012205|Ga0137362_10543787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1003Open in IMG/M
3300012359|Ga0137385_10467330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1070Open in IMG/M
3300012361|Ga0137360_10965156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium735Open in IMG/M
3300012362|Ga0137361_11594008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300012582|Ga0137358_10748672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium653Open in IMG/M
3300012683|Ga0137398_10663716All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300012924|Ga0137413_11722053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300012960|Ga0164301_10725588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter751Open in IMG/M
3300012961|Ga0164302_10310960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter1034Open in IMG/M
3300012972|Ga0134077_10442112All Organisms → cellular organisms → Bacteria → Terrabacteria group568Open in IMG/M
3300012984|Ga0164309_10629677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia842Open in IMG/M
3300012984|Ga0164309_10662207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium823Open in IMG/M
3300012987|Ga0164307_11063740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium662Open in IMG/M
3300013102|Ga0157371_11027724All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300013307|Ga0157372_12526526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M
3300013308|Ga0157375_11458559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium807Open in IMG/M
3300013501|Ga0120154_1124297All Organisms → cellular organisms → Bacteria → Terrabacteria group587Open in IMG/M
3300014166|Ga0134079_10522844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300014255|Ga0075320_1075189Not Available639Open in IMG/M
3300014326|Ga0157380_11087914All Organisms → cellular organisms → Bacteria → Terrabacteria group838Open in IMG/M
3300014497|Ga0182008_10412221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium728Open in IMG/M
3300015242|Ga0137412_10206591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SRL281567Open in IMG/M
3300015264|Ga0137403_11236564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300015356|Ga0134073_10371533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300017654|Ga0134069_1093592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium976Open in IMG/M
3300018032|Ga0187788_10082197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1141Open in IMG/M
3300018433|Ga0066667_10512612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium990Open in IMG/M
3300018433|Ga0066667_10652247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium880Open in IMG/M
3300018468|Ga0066662_11535968All Organisms → cellular organisms → Bacteria → Terrabacteria group693Open in IMG/M
3300018468|Ga0066662_11943526All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300018468|Ga0066662_12052829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300018468|Ga0066662_12319820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300018468|Ga0066662_12429617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300018468|Ga0066662_12920083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300020081|Ga0206354_10094981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1021Open in IMG/M
3300024317|Ga0247660_1063686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300025878|Ga0209584_10137710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria916Open in IMG/M
3300025913|Ga0207695_10445420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1178Open in IMG/M
3300025934|Ga0207686_10531136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium917Open in IMG/M
3300026035|Ga0207703_10185289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1839Open in IMG/M
3300026116|Ga0207674_10696882All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300026343|Ga0209159_1286375All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300026529|Ga0209806_1221566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium645Open in IMG/M
3300026538|Ga0209056_10472357All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300026540|Ga0209376_1291799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium652Open in IMG/M
3300026550|Ga0209474_10298285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium952Open in IMG/M
3300026552|Ga0209577_10470362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium860Open in IMG/M
3300028379|Ga0268266_10202564Not Available1817Open in IMG/M
3300028563|Ga0265319_1011896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3540Open in IMG/M
3300028807|Ga0307305_10524082All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300028812|Ga0247825_11156840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300031713|Ga0318496_10816501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300031726|Ga0302321_103068366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → environmental samples → uncultured Pseudonocardia sp.545Open in IMG/M
3300031938|Ga0308175_102817885All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300031938|Ga0308175_103204870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300031996|Ga0308176_12137786All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300031996|Ga0308176_12445280Not Available557Open in IMG/M
3300032074|Ga0308173_11724049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. CPCC 204708590Open in IMG/M
3300032829|Ga0335070_11895424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300033500|Ga0326730_1068214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium670Open in IMG/M
3300033551|Ga0247830_10527960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium930Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil18.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.19%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil10.49%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.59%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.10%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.40%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.40%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.40%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.40%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.40%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.70%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.70%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.70%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.70%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.70%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.70%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.70%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.70%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.70%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.70%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.70%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.70%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.70%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.70%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.70%
SoilEngineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil0.70%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010229Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 1EngineeredOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013501Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25MEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014255Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024317Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028563Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaGHost-AssociatedOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033500Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fractionEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10538034313300000364SoilMHASIWRFAGDPDELVSRYDAMVAEIPRDNMRLQLCLRGPAGIVLVDTCPSF
JGI10216J12902_10948413623300000956SoilMHASISTFRGDPDDLLARYDAMVADVPEASMRLHLCLRTDDGIVA
JGI25382J37095_1015915813300002562Grasslands SoilMHASIWKFAGDPDELLRRYDAMLDEIPRARMRLHVCLRAPDGIVLVDTCPTKDVFESFARGDDFRALRERHGLP
JGI25382J43887_1032643223300002908Grasslands SoilMHASIWKFAGDPDELLRRYDAMLDEIPRARMRLHVCLXAPDGIVLVDTCPT
Ga0062389_10181995013300004092Bog Forest SoilMHASIWKFDGNPDDLTRRYDAMAAEMPTGEFIAHLCLRAPDGIVIVDTCPSRDA
Ga0062593_10112958223300004114SoilMHASIWRFTGDPDELLAGYDSMLVDVPLESMRLHLCLRAPDGIVI
Ga0062589_10250630713300004156SoilMHASIWRFRGDPDELMRSYEALVAEIPAENMKLHVCLRAEDGIVLVDTCP
Ga0062595_10250103613300004479SoilMHASISHLRGEPDDLLRRYDALLAEIRAESMILHLCLRTSDGIIVVDTCPTKEIFE
Ga0066810_1012257313300005169SoilVHASLWKFAGDPDDLLLRYDAMMGEIGAGNLRLHLCLRADDGILMLDA
Ga0066690_1014618833300005177SoilMHASIWKFAGDPDELLRRYDAMLDEIPRARMRLHVCLGAPDGIVLVDTCPTKDVFEAFR
Ga0066678_1058988423300005181SoilMHASMCKFAGNPVELLSHYDAMIEEIPRARMRLHLCLRADGIVLVDICPTKDVFESFARGDEPIRSSTASSNGPGTG
Ga0066671_1065251813300005184SoilVHASLWRFRGDPDELLRRYEALLTDIPAENMRLHLCLKADDGIIIVDTCPSRDAFEGF
Ga0070680_10061813913300005336Corn RhizosphereMYASIWRLEGEPDELARRYDAMTADVPRADMRLHLCLRADDGIVIVDTCPSREAEAC
Ga0070682_10069930413300005337Corn RhizosphereMHASIWRFRGDPDELLRGYDAMLAEIPAANMKLHLCLRAPDGIVLVDTCPTQEAFDAFSSNPAL
Ga0068868_10186475423300005338Miscanthus RhizosphereMHASISTFRGDPDDLLARYDAALAELGTASIDLQLCLRTDDGIVVVDTCPSR
Ga0070660_10013305053300005339Corn RhizosphereMHASIWKFSGDPDELLRGYDAMVTEIPSANMRLHLCLRARDGIVLVDTCPTKEVFDAFVAGDGFRMLREKH
Ga0070675_10072394433300005354Miscanthus RhizosphereVHASIWKFAGDPDDLLARYDAMVAEIPPGNLALHPCLRASDGIVLVDTCPSAEVFR
Ga0070710_1007029513300005437Corn, Switchgrass And Miscanthus RhizosphereMHASIWTFTGDPDALLCRYDAMLADVPAANMRLHLCLRAPDGIVVI
Ga0066686_1025220933300005446SoilMHASIWKFHGDADELLRRYDAMLEEIPRARMRLHVCLGAPDGIVLVDTCPTK
Ga0066686_1107961313300005446SoilVHGSIWRFGGDPDELLRRYDAMVAEIPPANLRLHLCLQADDGIVLVDTCPSREVF
Ga0070685_1002284613300005466Switchgrass RhizosphereMHASIWRFRGDPDALLLRYDAITVEIPAAAMQAHLCLRAPD
Ga0070707_10174666013300005468Corn, Switchgrass And Miscanthus RhizosphereMHASIWRFRGDPDDLLRRYDALVAEIPRENMRLHLCLRAPDGILMVDTCPSKEVF
Ga0070684_10154438813300005535Corn RhizosphereMHASIWRFRGDPDALLLRYDAITVEIPAAAMQAHLCLRAPDGIVIVDTCPTREAFESFSNGA
Ga0066697_1079108413300005540SoilMHASIWKFAGDPDELLRRYDAMLDEIPRAKMRLHVCLGAPDGIVLVDTCPTKDVFESFARGDDFRALR
Ga0070696_10066085223300005546Corn, Switchgrass And Miscanthus RhizosphereMHASIWRFRGDPDALLRRYDAITVEIPAAAMQAHLCLRAPDGIVIVDTCPTREAF
Ga0070696_10172444713300005546Corn, Switchgrass And Miscanthus RhizosphereLLMHASIWRFVGDPVDLLRRYDAMAAEIPRENLRLHLCLS
Ga0066661_1020184713300005554SoilMHASIWKFAGDPDELLRRYDAMLDEIPGARMRLHVCLRAPDGIVLV
Ga0066698_1090868813300005558SoilVHGSIWRFAGDPDELLRRHDAMVAEIPHANMRLHLCLRAADGIV
Ga0068855_10062750533300005563Corn RhizosphereMHASIWKFRGDPDQLVRSYDAMMAEIPQANMKLHLCLRAPDGIVLVDTCPTAEV
Ga0066693_1008807123300005566SoilMHASIWKFAGDPDELLRRYDAMLEEIPRARMRLHICLRVTDGIVFIDTCPTKEDFESFAH
Ga0066703_1076130423300005568SoilMHASLWRFSGDPDDLLRRYDALVAEIPAANMRLHLCMRAPEGIVLVDTCPSEEAFQA
Ga0066705_1008892333300005569SoilMHASIWRLHGDPKELLPRYDALVADIPRENMRLHL*
Ga0066705_1050750213300005569SoilMHASIWKFHGDADELLRRYDAMLEEIPRARMRLHVCLRAPDGIVLVDTCPTRDVFESFARGDDFRALRE
Ga0066705_1075783513300005569SoilMHASLWRFSGDPDDLLRRYDAMVAEIPAANMRLHLCM
Ga0066708_1040941713300005576SoilMHASIWRFAGDPDELLRRYDGMLEEIPRARMRLHICLRATDGIVFIDTCPTKEDFESFAYGDDFRA
Ga0066708_1073584823300005576SoilMHASIWRFAGDPDDLLRRYDAMRAEIPAANMRLQLCLRAPDGILLVDTCPTREIFEAFAGGDAF
Ga0068854_10132928633300005578Corn RhizosphereMHASIWRFRGDPDELLRGYDAMLAEIPAANMKLHLCLRAPDGIVLVD
Ga0068856_10095835013300005614Corn RhizosphereMHASITHFSGHPDDLEASYDALLAEVPSANIRLHLCLRAPDGL
Ga0068861_10095683113300005719Switchgrass RhizosphereMHASIWRFRGDPDDLLRRYDAVIAEIPPANMRLHLCLRA
Ga0068862_10072170513300005844Switchgrass RhizosphereMHASIWRFRGDPDDLLRRYDAVIAEIPPANMGLHLCLRAHDGIIVV
Ga0068862_10193977213300005844Switchgrass RhizosphereVHASIWKFAGDPDDLLARYDAMVAEIPPGNLALHLCLRASDGIV
Ga0066696_1095536213300006032SoilMHASIWRFSGDPDELLRRYDAMLAEVPAENMKLHLCLRAPDGIVVVDTCPS
Ga0066656_1009790513300006034SoilMHASIWKFHGDPDELLRRYDAMLEEIPRARMRLHVCLGAPDGIVLVDTCPTKDIFESFARGDDF
Ga0070716_10174304213300006173Corn, Switchgrass And Miscanthus RhizosphereMHASIWKFRGDPDDLLRRYDAVVAEIPAANMRLHLCLRADDGIIV
Ga0074048_1231701513300006581SoilVHASIWRFRGDPDELMESYEALLAEVPAESMRLHLCLRAEDGIVLVDTCPS
Ga0079222_1164472813300006755Agricultural SoilMHASITHFSGHPDDLEASYDALLAEVPSANMRLHLCLRAPDGLVVVDTCPSQEAFNVFH
Ga0066653_1067189423300006791SoilMHASIWKFAGDPDELLRRYDAMLDEIPRATMRLHVCLGAPDGIVLVDTC
Ga0066658_1007948233300006794SoilMHASVWRFRGDPDDLLRRYDAMVAEIPAASMRLHLCLRASDGMVLVDTCPSRAVF
Ga0075428_10114522623300006844Populus RhizosphereMHASIARFTGDPAGLLARYDAMLADEPLEDVRLHLCLRTDDGIVVVDTCPT
Ga0105251_1049185713300009011Switchgrass RhizosphereMHASIWRFRGDPDALLRRYDAITVEIPAAAMQAHLC
Ga0066710_10318476913300009012Grasslands SoilMHASIWKFAGDPDELLRRYDAILDEIPRAKMRLHVCLGAPDGIVLVDTCPTKDVFESFARGDDFRALRERHG
Ga0099828_1115804323300009089Vadose Zone SoilMHASIWKFAGDPDELLRRYDAMLDEIPRAKMRLHVCLGAPDGIVVSRTSR*
Ga0105240_1146120013300009093Corn RhizosphereMHASIWKFAGDPDELLRRYDAMLEEIPRARMRLHVCLGAPDGIVLVDTCPTKEVFESFAHGDDFRALRERH
Ga0066709_10335108613300009137Grasslands SoilMHASIWKFAGDPDELLRRYDAMLDEIPRARMRLHVCLGAPDGIVLVDTC
Ga0066709_10344833413300009137Grasslands SoilMHASIWKFDGDPDELLRRYDAMLEEIPRARMRLHICLHAADGI
Ga0066709_10427570123300009137Grasslands SoilMHASIWRFAGDPDELLAGYDALVAEVPAENMRLQLCLRAADGIVL
Ga0105242_1045216223300009176Miscanthus RhizosphereVHASIWRFRGDPDELLERYDAMVAELPIPSLHLCLRAPDGIVLVDTCPSRDAFERFAASEEFAALRVRHG
Ga0126312_1092323913300010041Serpentine SoilVHASIWKFAGDPDELLPRYDAMVTEIPSANMRLHLCLRADGGIVLVDTCPSKEVFEALSAGEEVRAMRERH
Ga0136218_102228043300010229SoilMHASIWRFRGDPDELLGSYDAMLAEIPAANMKLHLCLRAPDGIVLVDTCPTQEAFDAFS
Ga0134082_1008969533300010303Grasslands SoilMHASIWNFAGNPGELLRRYDAMLEEIPRARMRLHICLRATDGIVFIDTCPTKEDFESSAYGDDFRALRERHGLPTP
Ga0134088_1023974113300010304Grasslands SoilMHASIWKFAGDPDELLRRYDAMLDEITRAKMRLHICLRAPDGIVLVDTCPTRDVFESF
Ga0134065_1009488123300010326Grasslands SoilMHASIWKFGGDPDELLRRYDAMLEQIPRARMRLHVCLRAPGGIVLVDTCPTK
Ga0134080_1019160523300010333Grasslands SoilMHASIWKFAGDPDELLRRYDAMLDEIPRAKMRLHVCLGAPD
Ga0134071_1029147613300010336Grasslands SoilMHASIWKFHGDPDELLRRYDAMLEEIPRARMRLHVCLRAPGGIVLVDTCPTKDVFESFARGDDFRAL
Ga0134066_1011063013300010364Grasslands SoilMHASIWKFAGDPDELLRRYDAMLDEITRAKMRLHICLRAPDGIVLVDTCPTKDVFESFARGDDFRA
Ga0134122_1153248613300010400Terrestrial SoilMHASIWRFRGDPDALLRRYDAITVEIPAAAMQAHLCLRAPDGIVIVDTCPTR
Ga0134121_1175630613300010401Terrestrial SoilMHASIWKFRGDPDDLLRRYDAVVAEIPAANMRLHLC
Ga0137392_1026702813300011269Vadose Zone SoilMHASIWKFAGDPDELLRRYDAMLEEIPRARMRLHVCLGAPDGIVVSRTSR*
Ga0137364_1064261823300012198Vadose Zone SoilMHASIWKFAGDPDELLRRYDAMLDEIPRAKMRLHVCLGAPDGIVLVDTCPTKDVFESFARGDDF
Ga0137364_1073841623300012198Vadose Zone SoilMHASLWRFKGDPDELLERYEAMLAETPGEKMRLHLCMRAPDGIIWVDTCPSKEIF
Ga0137364_1086036023300012198Vadose Zone SoilVHASLWRFRGDPDELLRRYEAVLTDIPAESMRLHL
Ga0137365_1042593713300012201Vadose Zone SoilMHASIWRFAGDPDELLRRWDAVVAEIPRANMRLQLCLRAVDGIVL
Ga0137362_1054378713300012205Vadose Zone SoilMHASIWKFHGDPDELLRRYDAMLEEIPRARMRLHICVRAPDG
Ga0137381_1077784913300012207Vadose Zone SoilMHASIWRFVGDPDELVRRYDAMVAEIPRANMRLHLC
Ga0137385_1046733023300012359Vadose Zone SoilMHASIWKFGGDPDELLRRYDAMLDEIPRAKMRLHVCLGAPDGIVLVDTCPTK
Ga0137360_1096515613300012361Vadose Zone SoilMHASIWKFAVNPDELLRRYDAMLDEIPRARMRLHVCLGAPDGIVLVDTCPTKDV
Ga0137361_1159400823300012362Vadose Zone SoilMHASIWKFAGDPDELLRRYDAMLDEIPRARMRLHVCLRAPDGIVLVDTCPTKDV
Ga0137358_1074867223300012582Vadose Zone SoilMHASIWKFHGDPDELLRRYAAMLEEAPRARMRLHVGVAAPDGLVLVDTWPTKDVFEAFARVDDF
Ga0137398_1066371623300012683Vadose Zone SoilMHAWIWKFAGDPDELLRRYDAMLEEIPRARMRLHVCLRAPDGIVLVDTCPTKDLFESFARGDDFRA
Ga0137413_1172205313300012924Vadose Zone SoilMHASIWKLEGDPADLLDRYDSMLAEIPTASMHLHLCLRAEDGIVIIDTCPSREAFHQFTGSETF
Ga0164301_1072558823300012960SoilMVRGMHASISTFRGDPDDLLARYDAMAADVPEANLSLHMCLRAEDGIVVVDTCPSRAVA*
Ga0164302_1031096013300012961SoilMVRGMHASISTFRGDPDDLLARYDAMAADLPDANLSLHMCTRAEAGIVVVANCPRRAPA*
Ga0134077_1044211223300012972Grasslands SoilVHGSIWRFAGDPDELLRRYDAMVAEIPPANLRLHLCLR
Ga0164309_1018957033300012984SoilVHASIWRFRGDPDDLLRRYEAMVAEIPAANMELHLCLRA
Ga0164309_1062967723300012984SoilMVRGMHASISTFRGDPDDLLARYDAMAADIPEANLSLHMCLRAEDGIVVVDTCPSRAVA*
Ga0164309_1066220713300012984SoilMHASITHFPGDPDDLEARYDALLAEVSSANMRLHLCLRAPDGLVVVDTCPSEEAFQAFHKDE
Ga0164307_1106374023300012987SoilMHASIWRFRGDPDDLLRRYDAVVAEIPAANMRLHLCLRADDGIIVVDTCPD
Ga0164305_1069515933300012989SoilMHASIWRFRGDPDELLGSYDAMLAEIPAANMKLHLCLRAP
Ga0157371_1102772433300013102Corn RhizosphereMHASIWKFSGDPDELLRGYDAMVAEIPSANMRPHLCLRARDGIVLVDTCPTKEVF
Ga0157372_1252652613300013307Corn RhizosphereVHASIWRFRGDPDELLRGYDAMVAEIPSANMKLHLCLRASDGIVLVDT
Ga0157375_1145855923300013308Miscanthus RhizosphereMHASIWKFSGDADDLVRRYEAMLADVPAGNIGLQLCLRAP
Ga0120154_112429723300013501PermafrostMHASIWKFSGDPDDLLRRYDAMLAEIPTANMRLHLCLQAPDGIVMVDTCPSR
Ga0134079_1052284423300014166Grasslands SoilMHASIWKFHGDPDELLRRYDAMLDEIPRARMRLHVCLGAP
Ga0075320_107518923300014255Natural And Restored WetlandsLHASIWRFAGDPDELLASYESMVAEIPAENMRLHLCLRAEDGIVLVD
Ga0157380_1108791413300014326Switchgrass RhizosphereVHASIWKFAGDPDDLLARYDAMVAEIPPGNLALHLCLRASDGIVLV
Ga0182008_1041222113300014497RhizosphereMHASIWKFSGDPDDLVARYEAMLAEIPAANMELQLCLRAPDGILLVDTCPS
Ga0137412_1020659133300015242Vadose Zone SoilMHASIWKFAGDPDELLRRYDAMLEEIPRARMRLHVCLGAPDGIVLVDTCPTKDVVRLEEIVNPIVL*
Ga0137403_1123656423300015264Vadose Zone SoilMHASLWRFSGAPDDLLRRYDAMLAELGAENMRLHLCLRAPDGIVLVDTCPSKESFDQFVKGTFSERRKRH
Ga0134073_1037153323300015356Grasslands SoilMHASIWRFAGDPDDLLRRYDAMRAEIPAANMRLQLCLRAPDGILLV
Ga0134069_109359213300017654Grasslands SoilMHASIWKFAGDPDELLRRYDAMLDEIPRARMRLHVCLGAPDGIVLVDTCPTKD
Ga0187788_1008219743300018032Tropical PeatlandMHASIWKFTGDPGTLLAGYDAMLADIPPENMMLHLCLEAPDGIVLVDTCPS
Ga0187765_1008966253300018060Tropical PeatlandMHASIWRFTGDPDELARRYDAMLAGVPTENMRLHL
Ga0066667_1051261223300018433Grasslands SoilMHASLWRFSGDPDDLLRRYDAMVAEIPTASMRVHLCMRAREGIVVVDTCPSE
Ga0066667_1065224723300018433Grasslands SoilMHASIWRFSGDPDELLRRYDAMLAEVPAENMKLHLCLQAPDGIVVVDTCPSRDAF
Ga0066662_1153596833300018468Grasslands SoilMHGSIWKFAGDPNDLLRRYEAMLADIPTANMRLHLCLRAPDGIIMIDTCPSQDVYEAFASGPFL
Ga0066662_1194352623300018468Grasslands SoilMHASIWKFAGDPDELLRRYDAMLDEIPHAKMRLHVCLGAPDGIVLVDTCPTKEVFESFARGDDFRALRERHGLPDPSN
Ga0066662_1205282913300018468Grasslands SoilMHASIWKFSGDPDELAPRYDAMAADIPSANMRLHLCLRAPNGILMVDTCPSREVFEAFSS
Ga0066662_1231982023300018468Grasslands SoilMHASMCKFAGNPVELLRHYDAMIEEIPRARMRLHLCLRADGIVLVDICPTKDVFESFARG
Ga0066662_1242961723300018468Grasslands SoilMHASIWRFRGDPDELLDRYDAMVAEIPLENMRLHLCLRDEDGIVMVDICPTREAFVSFAGGEA
Ga0066662_1292008313300018468Grasslands SoilIWTFAGDPDELLRRYDAMLDEIPRAKMRLHVCLGAPDGIVLVDT
Ga0206354_1009498113300020081Corn, Switchgrass And Miscanthus RhizosphereMHASIWRFRGDPDDLLRRYDAVIAEIPPANMRLHLCLRAHDGIIV
Ga0247660_106368623300024317SoilVHASIWRFRGDPDELMRSYEALVAKIPTENMRLHVCLRAGNGIVPVDTCPSKEVFDG
Ga0209584_1013771033300025878Arctic Peat SoilVHAALWKFRGDPDELLARYDALLAEIGAGGLQLHACLRAADGIVM
Ga0207688_1002973143300025901Corn, Switchgrass And Miscanthus RhizosphereMHASIWRFRGDPDDLLRRYDAVIAEIPPANMRLHL
Ga0207695_1044542033300025913Corn RhizosphereMHASIWKFAGDPDELLRRYDAMLEEIPRARMRLHVCLGA
Ga0207686_1053113613300025934Miscanthus RhizosphereMHASISTFRGDPDDLVARYDAALAELGTASIDLQLCLRTDDGIVVVDTCP
Ga0207640_1046726543300025981Corn RhizosphereMHASIWRFRGDPDELLRGYDAMLAEIPAANMKLHLCPRSRRD
Ga0207703_1018528943300026035Switchgrass RhizosphereVHTSIWKFAGDPDDLLARYDAMVAEIPPGNLALHLCLRASDGIV
Ga0207639_1061011413300026041Corn RhizosphereVNLHASIWTFRGDPDQLLRSYDAMVAEVPRANFKLHL
Ga0207702_1132757113300026078Corn RhizosphereMHASIWRFRGDPDELLRGYDAMLAEIPAANMKLHLCLRAPD
Ga0207674_1069688223300026116Corn RhizosphereMHASIWKFAGDPDELLRRYDAMLEEIPRAGMRLHVCLRAPDGIVLVDTCPTKEVFESFAHGDD
Ga0207698_1036904523300026142Corn RhizosphereMHASIWRFRGDPDALLLRYDAITVEIPAAAMQAHLCLRAP
Ga0209027_121873823300026300Grasslands SoilMHASIWKFNGDPDTLLAGYEAMLAEIPAASLALQLCL
Ga0209159_128637523300026343SoilMHASIWTFAGDPDELLRRYDAMLEEIPRARMRLHVCLGAPDGIVLVDTCPTKDVFESFARGDDFRALRERH
Ga0209806_122156613300026529SoilMHASIWKFAGDPDELLRRYDAMLDEIPRARMRLHVCLRAPDG
Ga0209056_1047235723300026538SoilMHASIWKFAGDPDELLRRYDAMLDEIPRAKMRLHVCLGAPDGIVLVDTCPTKDVFESFA
Ga0209376_129179913300026540SoilMHASIWKFAGDPDELLRRYDAMLDEITRAKMRLHICLRAPDG
Ga0209474_1029828523300026550SoilMHASIWKFTGDPDELLQRYDTMVEEIPRARMRLHICLRAADGIVLVDTCPTKEIFESFAQGGDFRALRERHGF
Ga0209577_1047036213300026552SoilMHASIWKFAGDPDELLRRYDAMLDEIPRARMRLHVCLRAPDGIVLVDTCPTKDVFEAFAHGDAFRALRER
Ga0268266_1020256413300028379Switchgrass RhizosphereVHASIWKFSGDPDDLLARYDAMMAEAGAANLRLHVCL
Ga0265319_101189613300028563RhizosphereVHAALWKFGGDPDDLLARYDAMLAEIGAGGMQLHACLRAPDGI
Ga0307305_1052408213300028807SoilMHASIWRFAGDPDELVAAYDALVAEVPTENMRLQLCLRAADGIVLVDACP
Ga0247825_1115684023300028812SoilVHASIWKFAGDGEDLLARYDAMVAEIPPGNLALHLCLRAGDGIVLVDT
Ga0318496_1081650113300031713SoilVHASISHFPGDPDELVACYDALLADVTPAGLQVHLCLRAPDGIVVVDTCPSR
Ga0302321_10306836623300031726FenVHASIWKFSGDPDELLARYDAMMGEIGADNLRLHICLRADDGIVMLDAC
Ga0308175_10281788513300031938SoilMHASIWKFSGDPDALERGYDAMVAQVPAEQMRLHLCLRASDGILIVDTCPTR
Ga0308175_10320487013300031938SoilMHASIWRFEGDPDELLRRYDAVVAEIPAANMRLHLCLRADDGIIVVDTF
Ga0308176_1213778623300031996SoilMHASIWKFAGDPDELLRRYDAMLEEIPRARMRLHVCLRAPDGIVLVDTCPTKEVFESFAH
Ga0308176_1244528023300031996SoilVHASLWRFAGDPDELLARYDAMISEIGASGMRLHVCLRAADGILMLDTCPDR
Ga0308173_1172404913300032074SoilMHASICTFRGDPDELLARYDAMVAEIPPASMRLHLCLRGDDGIVVVDTC
Ga0335070_1189542423300032829SoilVHASIWKFTGGPDDLLRRYEAMVGELPAANMRLHLCLRAPDGIVLV
Ga0326730_106821433300033500Peat SoilMHASIWKFAGDPDELLARYDAMVAEIPQANLVLHMCLRADDGIVLIDTCPSAEVF
Ga0247830_1052796023300033551SoilMHASIWRFRGDPDALLRRYDAITVEIPAAAMQAHLCLRAPDGIVIVDTCPTRE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.