Basic Information | |
---|---|
Family ID | F052115 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 143 |
Average Sequence Length | 44 residues |
Representative Sequence | MKTPIHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLMLVRSAR |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 143 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 66.43 % |
% of genes near scaffold ends (potentially truncated) | 33.57 % |
% of genes from short scaffolds (< 2000 bps) | 69.93 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (78.322 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.476 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.762 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (30.769 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.32% β-sheet: 0.00% Coil/Unstructured: 50.68% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 143 Family Scaffolds |
---|---|---|
PF06723 | MreB_Mbl | 14.69 |
PF00656 | Peptidase_C14 | 8.39 |
PF07927 | HicA_toxin | 6.29 |
PF00596 | Aldolase_II | 2.80 |
PF02082 | Rrf2 | 2.80 |
PF07238 | PilZ | 2.10 |
PF02353 | CMAS | 2.10 |
PF00970 | FAD_binding_6 | 1.40 |
PF09285 | Elong-fact-P_C | 1.40 |
PF11154 | DUF2934 | 1.40 |
PF13646 | HEAT_2 | 1.40 |
PF00582 | Usp | 1.40 |
PF00891 | Methyltransf_2 | 1.40 |
PF07969 | Amidohydro_3 | 0.70 |
PF13506 | Glyco_transf_21 | 0.70 |
PF02915 | Rubrerythrin | 0.70 |
PF12849 | PBP_like_2 | 0.70 |
PF09723 | Zn-ribbon_8 | 0.70 |
PF13649 | Methyltransf_25 | 0.70 |
PF12838 | Fer4_7 | 0.70 |
PF01139 | RtcB | 0.70 |
PF04073 | tRNA_edit | 0.70 |
PF10263 | SprT-like | 0.70 |
PF04545 | Sigma70_r4 | 0.70 |
PF12867 | DinB_2 | 0.70 |
PF07366 | SnoaL | 0.70 |
PF13365 | Trypsin_2 | 0.70 |
PF03466 | LysR_substrate | 0.70 |
PF00589 | Phage_integrase | 0.70 |
PF03992 | ABM | 0.70 |
PF11373 | DUF3175 | 0.70 |
PF08207 | EFP_N | 0.70 |
PF00027 | cNMP_binding | 0.70 |
PF00118 | Cpn60_TCP1 | 0.70 |
PF13545 | HTH_Crp_2 | 0.70 |
PF13439 | Glyco_transf_4 | 0.70 |
PF04430 | DUF498 | 0.70 |
PF13276 | HTH_21 | 0.70 |
PF06202 | GDE_C | 0.70 |
PF00759 | Glyco_hydro_9 | 0.70 |
PF01979 | Amidohydro_1 | 0.70 |
PF05368 | NmrA | 0.70 |
PF10861 | DUF2784 | 0.70 |
PF00072 | Response_reg | 0.70 |
COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
---|---|---|---|
COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 14.69 |
COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 8.39 |
COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 6.29 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 2.80 |
COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 2.80 |
COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 2.80 |
COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 2.80 |
COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 2.80 |
COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 2.80 |
COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 2.80 |
COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 2.80 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 2.10 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 2.10 |
COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 2.10 |
COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 0.70 |
COG0231 | Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) | Translation, ribosomal structure and biogenesis [J] | 0.70 |
COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 0.70 |
COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 0.70 |
COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 0.70 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.70 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 78.32 % |
Unclassified | root | N/A | 21.68 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001356|JGI12269J14319_10175234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
3300002910|JGI25615J43890_1049559 | Not Available | 690 | Open in IMG/M |
3300002910|JGI25615J43890_1074809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Pseudarthrobacter → Pseudarthrobacter sulfonivorans | 587 | Open in IMG/M |
3300002914|JGI25617J43924_10053325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1473 | Open in IMG/M |
3300002917|JGI25616J43925_10073426 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1442 | Open in IMG/M |
3300004478|Ga0068972_1466954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Pseudarthrobacter → Pseudarthrobacter sulfonivorans | 644 | Open in IMG/M |
3300005445|Ga0070708_100187914 | All Organisms → cellular organisms → Bacteria | 1932 | Open in IMG/M |
3300005467|Ga0070706_100171882 | Not Available | 2023 | Open in IMG/M |
3300005467|Ga0070706_101989377 | Not Available | 526 | Open in IMG/M |
3300005468|Ga0070707_100222822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1836 | Open in IMG/M |
3300005468|Ga0070707_100853406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
3300005938|Ga0066795_10016246 | All Organisms → cellular organisms → Bacteria | 2081 | Open in IMG/M |
3300006028|Ga0070717_10220976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1665 | Open in IMG/M |
3300006050|Ga0075028_100081861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1616 | Open in IMG/M |
3300006052|Ga0075029_100326647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 984 | Open in IMG/M |
3300006055|Ga0097691_1038805 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
3300006059|Ga0075017_100224344 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
3300006174|Ga0075014_100343897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
3300006175|Ga0070712_101158417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300006893|Ga0073928_10133089 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
3300007258|Ga0099793_10610007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300007258|Ga0099793_10683587 | Not Available | 517 | Open in IMG/M |
3300009029|Ga0066793_10034528 | All Organisms → cellular organisms → Bacteria | 2823 | Open in IMG/M |
3300009029|Ga0066793_10128237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1478 | Open in IMG/M |
3300009038|Ga0099829_11746488 | Not Available | 510 | Open in IMG/M |
3300009088|Ga0099830_10931725 | Not Available | 719 | Open in IMG/M |
3300009090|Ga0099827_11614129 | Not Available | 565 | Open in IMG/M |
3300009698|Ga0116216_10103371 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
3300010339|Ga0074046_10000846 | All Organisms → cellular organisms → Bacteria | 28209 | Open in IMG/M |
3300010339|Ga0074046_10003471 | All Organisms → cellular organisms → Bacteria | 13172 | Open in IMG/M |
3300010339|Ga0074046_10014016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5811 | Open in IMG/M |
3300010339|Ga0074046_10020051 | All Organisms → cellular organisms → Bacteria | 4706 | Open in IMG/M |
3300010341|Ga0074045_10026223 | All Organisms → cellular organisms → Bacteria | 4470 | Open in IMG/M |
3300010379|Ga0136449_100438250 | All Organisms → cellular organisms → Bacteria | 2298 | Open in IMG/M |
3300010379|Ga0136449_101371150 | Not Available | 1095 | Open in IMG/M |
3300010379|Ga0136449_101565306 | Not Available | 1004 | Open in IMG/M |
3300011269|Ga0137392_10584635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
3300011269|Ga0137392_11625875 | Not Available | 504 | Open in IMG/M |
3300011270|Ga0137391_10002965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12787 | Open in IMG/M |
3300011270|Ga0137391_11108564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
3300011271|Ga0137393_10344083 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
3300011271|Ga0137393_10528996 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300012096|Ga0137389_10030823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3889 | Open in IMG/M |
3300012096|Ga0137389_10492240 | Not Available | 1051 | Open in IMG/M |
3300012189|Ga0137388_10008840 | All Organisms → cellular organisms → Bacteria | 6995 | Open in IMG/M |
3300012189|Ga0137388_10184060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1874 | Open in IMG/M |
3300012199|Ga0137383_10165866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1618 | Open in IMG/M |
3300012209|Ga0137379_10230589 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
3300012349|Ga0137387_10829243 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300012361|Ga0137360_10728273 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
3300012361|Ga0137360_11422745 | Not Available | 597 | Open in IMG/M |
3300012362|Ga0137361_10469997 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300012363|Ga0137390_10067545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3494 | Open in IMG/M |
3300012363|Ga0137390_10603101 | Not Available | 1066 | Open in IMG/M |
3300012363|Ga0137390_10822807 | Not Available | 886 | Open in IMG/M |
3300012532|Ga0137373_10153247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1942 | Open in IMG/M |
3300012582|Ga0137358_10532253 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300012683|Ga0137398_10189586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1352 | Open in IMG/M |
3300012917|Ga0137395_10486865 | Not Available | 888 | Open in IMG/M |
3300012923|Ga0137359_10005544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10408 | Open in IMG/M |
3300012923|Ga0137359_10244920 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
3300014165|Ga0181523_10825644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300016341|Ga0182035_10471093 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300016750|Ga0181505_10822109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
3300017822|Ga0187802_10032684 | All Organisms → cellular organisms → Bacteria | 1853 | Open in IMG/M |
3300017823|Ga0187818_10009239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4208 | Open in IMG/M |
3300017823|Ga0187818_10017771 | All Organisms → cellular organisms → Bacteria | 3041 | Open in IMG/M |
3300017823|Ga0187818_10017948 | All Organisms → cellular organisms → Bacteria | 3025 | Open in IMG/M |
3300017823|Ga0187818_10047360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1847 | Open in IMG/M |
3300017823|Ga0187818_10157580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 988 | Open in IMG/M |
3300017925|Ga0187856_1069843 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
3300017928|Ga0187806_1381540 | Not Available | 507 | Open in IMG/M |
3300017933|Ga0187801_10321774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
3300017934|Ga0187803_10002269 | All Organisms → cellular organisms → Bacteria | 7568 | Open in IMG/M |
3300017934|Ga0187803_10070379 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
3300017943|Ga0187819_10103692 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
3300017943|Ga0187819_10103968 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
3300017943|Ga0187819_10132441 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
3300017946|Ga0187879_10778278 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300017955|Ga0187817_10114731 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
3300017955|Ga0187817_10181754 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
3300017955|Ga0187817_10280346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1063 | Open in IMG/M |
3300017955|Ga0187817_10477575 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300017955|Ga0187817_10925105 | Not Available | 558 | Open in IMG/M |
3300017966|Ga0187776_10006022 | All Organisms → cellular organisms → Bacteria | 6379 | Open in IMG/M |
3300017995|Ga0187816_10011368 | All Organisms → cellular organisms → Bacteria | 3304 | Open in IMG/M |
3300018001|Ga0187815_10015410 | All Organisms → cellular organisms → Bacteria | 3320 | Open in IMG/M |
3300018001|Ga0187815_10159498 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300018007|Ga0187805_10006672 | All Organisms → cellular organisms → Bacteria | 4710 | Open in IMG/M |
3300018012|Ga0187810_10031545 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
3300018012|Ga0187810_10080470 | Not Available | 1261 | Open in IMG/M |
3300018013|Ga0187873_1050169 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
3300018085|Ga0187772_10060132 | All Organisms → cellular organisms → Bacteria | 2360 | Open in IMG/M |
3300018088|Ga0187771_10770490 | Not Available | 816 | Open in IMG/M |
3300018468|Ga0066662_10254477 | Not Available | 1438 | Open in IMG/M |
3300019264|Ga0187796_1560633 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300019888|Ga0193751_1032402 | Not Available | 2430 | Open in IMG/M |
3300020006|Ga0193735_1069985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
3300020062|Ga0193724_1111610 | Not Available | 546 | Open in IMG/M |
3300021046|Ga0215015_10621478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3538 | Open in IMG/M |
3300022557|Ga0212123_10019616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7851 | Open in IMG/M |
3300022557|Ga0212123_10030654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5534 | Open in IMG/M |
3300025432|Ga0208821_1041813 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300025439|Ga0208323_1016884 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
3300025581|Ga0208355_1092149 | Not Available | 653 | Open in IMG/M |
3300025910|Ga0207684_10274288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1455 | Open in IMG/M |
3300025910|Ga0207684_11355939 | Not Available | 584 | Open in IMG/M |
3300026223|Ga0209840_1022734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1438 | Open in IMG/M |
3300026304|Ga0209240_1086376 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300026361|Ga0257176_1031572 | Not Available | 800 | Open in IMG/M |
3300026494|Ga0257159_1089409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300027394|Ga0209904_1001029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2398 | Open in IMG/M |
3300027667|Ga0209009_1172556 | Not Available | 549 | Open in IMG/M |
3300027738|Ga0208989_10040438 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
3300027738|Ga0208989_10277513 | Not Available | 540 | Open in IMG/M |
3300027846|Ga0209180_10269640 | Not Available | 978 | Open in IMG/M |
3300027854|Ga0209517_10051468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3107 | Open in IMG/M |
3300027862|Ga0209701_10214891 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300027862|Ga0209701_10263975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1002 | Open in IMG/M |
3300027875|Ga0209283_10079721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2120 | Open in IMG/M |
3300027903|Ga0209488_10496902 | Not Available | 895 | Open in IMG/M |
3300027905|Ga0209415_10022541 | All Organisms → cellular organisms → Bacteria | 9612 | Open in IMG/M |
3300027911|Ga0209698_10024490 | All Organisms → cellular organisms → Bacteria | 5638 | Open in IMG/M |
3300031945|Ga0310913_10701767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
3300032160|Ga0311301_10012327 | All Organisms → cellular organisms → Bacteria | 26612 | Open in IMG/M |
3300032160|Ga0311301_11200790 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
3300032770|Ga0335085_10000938 | All Organisms → cellular organisms → Bacteria | 70250 | Open in IMG/M |
3300032770|Ga0335085_10019128 | All Organisms → cellular organisms → Bacteria | 9821 | Open in IMG/M |
3300032782|Ga0335082_10228168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 1752 | Open in IMG/M |
3300032783|Ga0335079_10004030 | All Organisms → cellular organisms → Bacteria | 16904 | Open in IMG/M |
3300032783|Ga0335079_10117138 | All Organisms → cellular organisms → Bacteria | 3008 | Open in IMG/M |
3300032805|Ga0335078_10602310 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
3300032805|Ga0335078_10817139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1134 | Open in IMG/M |
3300032829|Ga0335070_10027339 | All Organisms → cellular organisms → Bacteria | 6533 | Open in IMG/M |
3300032829|Ga0335070_10200364 | All Organisms → cellular organisms → Bacteria | 1988 | Open in IMG/M |
3300032829|Ga0335070_11549310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300032892|Ga0335081_10043854 | All Organisms → cellular organisms → Bacteria | 7077 | Open in IMG/M |
3300032893|Ga0335069_10089325 | All Organisms → cellular organisms → Bacteria | 3916 | Open in IMG/M |
3300033004|Ga0335084_10758170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 987 | Open in IMG/M |
3300033158|Ga0335077_10093970 | All Organisms → cellular organisms → Bacteria | 3532 | Open in IMG/M |
3300033158|Ga0335077_12160347 | Not Available | 513 | Open in IMG/M |
3300033486|Ga0316624_10392835 | Not Available | 1157 | Open in IMG/M |
3300033513|Ga0316628_100091006 | All Organisms → cellular organisms → Bacteria | 3379 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.48% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 16.78% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 11.89% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.29% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.99% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.20% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.50% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 3.50% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.10% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.10% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.10% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.40% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.40% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.40% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.40% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.70% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.70% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.70% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004478 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019264 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
3300027394 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_101752341 | 3300001356 | Peatlands Soil | MKSLIHLKRHGDSYFHLHPSHAVFPLIASFVLAVLIVLTLVSSAR* |
JGI25615J43890_10495592 | 3300002910 | Grasslands Soil | MKTQIHLKRRGDSYFHLNPFHAMFSLIASFVLAVLIVLMLVPSAR* |
JGI25615J43890_10748093 | 3300002910 | Grasslands Soil | PIHLKRRGDSYFHLNPLHAVFSLIASFVLAVLMVLMLVPSAR* |
JGI25617J43924_100533253 | 3300002914 | Grasslands Soil | GAFMRTPIHLKRHGDSYFHLHPSHAVFSLIASFVLALIVLTLVLSAR* |
JGI25616J43925_100734262 | 3300002917 | Grasslands Soil | MKTQIHLKRRGDSYFHLNPLHAMFSLIASFVLAVLIVLMLVPSAR* |
Ga0068972_14669541 | 3300004478 | Peatlands Soil | GIRRPGRGTSMKTLIHLKRHGGVYFHLHPLHAMFSLIATFVLAVLVVLMLVSSAR* |
Ga0070708_1001879143 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTSIHLKRRGDSYFHLNPLHALFSLIASFVLAVLIVLMLVPSAR* |
Ga0070706_1001718821 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTPIHLKRHGDSYFHLHLLHAVFSLIASFVLAVLIVLTLVPSAR* |
Ga0070706_1019893771 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTAIHLKRRGESYFHLNPLHAVFSLIASFVLAVLIVFMLVPSAR* |
Ga0070707_1002228222 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VGDGAFMRTPIHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVLSAR* |
Ga0070707_1008534062 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTPIHLKRRGDSYFHLNPLHAMFSLIASFVLAVLIVLMLVPSAR* |
Ga0066795_100162461 | 3300005938 | Soil | MNTLIHLKRHGEVHFHLHPLLETFSLIASFLLAMLVVLMLVSSAR* |
Ga0070717_102209763 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTLIHLKRHGEVYFKLHPLLETFSLVASFLFAVLVVLMFVSSAR* |
Ga0075028_1000818612 | 3300006050 | Watersheds | MKTLIHLKRHGDDHFHTHPLHTMFALVASLVLAGLVVLALVSSTR* |
Ga0075029_1003266472 | 3300006052 | Watersheds | MKTLIHLKRHGDSYFHVHPQHAIFSLVAGFVLAVLVVLVLASSAR* |
Ga0097691_10388052 | 3300006055 | Arctic Peat Soil | MRTPMHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVPSAR* |
Ga0075017_1002243443 | 3300006059 | Watersheds | MRTPIHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLMLVRSAR* |
Ga0075014_1003438971 | 3300006174 | Watersheds | MKTLIHLKRHGDGYFHLGHPHAVFLLVAGFVLAALVVLVLVPAAR* |
Ga0070712_1011584171 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | HLKRHGEVYFKLHPLLETFSLVASFLFAVLVVLMFVSSAR* |
Ga0073928_101330892 | 3300006893 | Iron-Sulfur Acid Spring | MRTPIHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVPSAR* |
Ga0099793_106100071 | 3300007258 | Vadose Zone Soil | MNTLIHLKRHGEVYSKLHPLLDTFSLIASFLLAVLVVLMLVSSAR* |
Ga0099793_106835872 | 3300007258 | Vadose Zone Soil | MRTPIHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVLSAR* |
Ga0066793_100345282 | 3300009029 | Prmafrost Soil | MHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVPSAR* |
Ga0066793_101282371 | 3300009029 | Prmafrost Soil | LTASAAIGEAPMNTLIHLKRHGEVHFHLHPLLETFSLIASFLLAMLVVLMLVSSAR* |
Ga0099829_117464881 | 3300009038 | Vadose Zone Soil | GDSYFHLHPLHAVFSLIASFVLAVLIVSTLVPSAR* |
Ga0099830_109317252 | 3300009088 | Vadose Zone Soil | MRTPIHLKRHGDSYFHLHPSHAVFSLIASFVLAVLIVLTLVLSAR* |
Ga0099827_116141291 | 3300009090 | Vadose Zone Soil | MKTPIHLKRRGDSYFHLNPLHAVFSLIASFVLAVLIVLMLVPSAR* |
Ga0116216_101033711 | 3300009698 | Peatlands Soil | MKTLIHLKRHGGVYFHLHPLHAMFSLIATFVLAVLVVLMLVSSAR* |
Ga0074046_1000084617 | 3300010339 | Bog Forest Soil | MNTLIHLKRHGEVHFHLHPLLETFSLIASFLLAVLVVSMLVSSAR* |
Ga0074046_100034717 | 3300010339 | Bog Forest Soil | MKTSIHFKRHGNGYFHLHPLHAVFSFIASFVLAALIVLMLVHSAR* |
Ga0074046_100140164 | 3300010339 | Bog Forest Soil | MRTPIHLKRHGDSYFHLHPLHAAFSLIASFVLAVVIVLMLVPSAR* |
Ga0074046_100200512 | 3300010339 | Bog Forest Soil | MKTPIHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLMLVRSAR* |
Ga0074045_100262234 | 3300010341 | Bog Forest Soil | MNTLMHLKRHGEIHFHLHPLLETFSLIASFLLAVLVVLMLVSSAR* |
Ga0136449_1004382503 | 3300010379 | Peatlands Soil | MKTPIHLKRHGDSYFHLHPLHAVFSLIASFVLTVLIVLMLVRSAR* |
Ga0136449_1013711502 | 3300010379 | Peatlands Soil | MKTLIHFKRHGDGYFQLHPQHAIFSLLSGFVLAVLVVLVLASSAR* |
Ga0136449_1015653061 | 3300010379 | Peatlands Soil | MNTLIHLERHSEGYFRLHPLHAVFSLIASFVLAVLVVLMLVSSVR* |
Ga0137392_105846351 | 3300011269 | Vadose Zone Soil | IHLKRHGDSYFHLHPLHAVFSLIASFVLAGLNVLTLVLSAR* |
Ga0137392_116258751 | 3300011269 | Vadose Zone Soil | MRTPIHLKRHGDSYFDLHPLHAVFSLIASFVLAVLIVLTL |
Ga0137391_1000296524 | 3300011270 | Vadose Zone Soil | MKTAIPLKRRGESYFHLNPLHAVFSLIASFVLAVLIVLMLVPSAR* |
Ga0137391_111085641 | 3300011270 | Vadose Zone Soil | KRHGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVLSAR* |
Ga0137393_103440832 | 3300011271 | Vadose Zone Soil | MKTPIHLKRRGDSDFHLNPLHAMFSLIASFVLAVLIVLMLVPSAR* |
Ga0137393_105289961 | 3300011271 | Vadose Zone Soil | LKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVLSAR* |
Ga0137389_100308233 | 3300012096 | Vadose Zone Soil | MRTPIHLKRHGDSCFHLHPLHAVFSLIASFVLAVIVLTLVLSAR* |
Ga0137389_104922401 | 3300012096 | Vadose Zone Soil | KGSAAVGEGAFMRTPIHLKRHGDSYFHLHPLHAVFLLIASFVLAVLIVLTLVPSAR* |
Ga0137388_100088409 | 3300012189 | Vadose Zone Soil | MKTAIHLKRRGDSYFHLNPLHAVFSLIASFVLAVLIVLMLVPSAR* |
Ga0137388_101840602 | 3300012189 | Vadose Zone Soil | MKTPIHLKRRGDSYFHLNPLHAMFSLIASFVLAMLIALMLVPSAR* |
Ga0137383_101658662 | 3300012199 | Vadose Zone Soil | LKGSAAPVGEEAFMKTPIHLKRHRDSYFHLHPLHAVFSLIASFLLAVLIVLALVPSAR* |
Ga0137379_102305892 | 3300012209 | Vadose Zone Soil | MNTLIHLKRHGEVYFKLHPLLETFSLIASFLLAVLVVLMLVSSAR* |
Ga0137387_108292431 | 3300012349 | Vadose Zone Soil | HGDSYFHLHPLHAVFSLIASFLLAVLIVLALVPSAR* |
Ga0137360_107282731 | 3300012361 | Vadose Zone Soil | MRTPIHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVL |
Ga0137360_114227451 | 3300012361 | Vadose Zone Soil | MKTAIPLKRRGESYFHLNPLHAVFSLIASFVLAVLIV |
Ga0137361_104699972 | 3300012362 | Vadose Zone Soil | FMKTPIHLKRRGDSYFHLNPLHAVFSLIASFVLAVLIVLMLVPSAR* |
Ga0137390_100675451 | 3300012363 | Vadose Zone Soil | RHGEVYSKLHPLLDTFSLIASFLLAVLVVLMLVSSAR* |
Ga0137390_106031011 | 3300012363 | Vadose Zone Soil | GDSYFHLHPLHAVFSLIASFVLAVLIVLTLVLSAR* |
Ga0137390_108228071 | 3300012363 | Vadose Zone Soil | MNTLIHLKRHGEVYSKLHPLLDTFSLIASFLLAVLVVLMLVSSA |
Ga0137373_101532473 | 3300012532 | Vadose Zone Soil | LIHLKRHGEVYSELHPLLDTFSLLAIFLLAVLVVLMLVSSAR* |
Ga0137358_105322532 | 3300012582 | Vadose Zone Soil | AFMRTPIHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVPSAR* |
Ga0137398_101895861 | 3300012683 | Vadose Zone Soil | MNTLIHLKRHGEVYSKLHPLLDTFSLIASFLLAVLVV |
Ga0137395_104868652 | 3300012917 | Vadose Zone Soil | MNTLIHLKRHGEVYSKLHPLLDTFSLIASFLLAVLVILMLVSSAK* |
Ga0137359_1000554418 | 3300012923 | Vadose Zone Soil | HGDSYFHLHPSHAVFSLIASFVLAVLIVLTLVLSAR* |
Ga0137359_102449201 | 3300012923 | Vadose Zone Soil | MRSPIHLKRHGDSYFHLHPSHAVFSLIASFVLAVLIVLTLVL |
Ga0181523_108256441 | 3300014165 | Bog | KGSAAMARPSMNMLIHLKRHGEVYLHLHPLHAMFSVIASFGLAVLVVLMLVSSAR* |
Ga0182035_104710933 | 3300016341 | Soil | MKTLIHLKGHGNSSFHLHPQHAIFSLIAGLMLAVLV |
Ga0181505_108221091 | 3300016750 | Peatland | MNMLIHLKRHGEVYLHLHPLHAMFSVIASFGLAVLVVLMLVSSAR |
Ga0187802_100326842 | 3300017822 | Freshwater Sediment | MKTPIHLNRHGDNYFHLHPWHAVFSFIASFVLAVLIVLTLVPSAR |
Ga0187818_100092395 | 3300017823 | Freshwater Sediment | MKAPIHHKRHGGSYFHLHPSHAVFSLIASFALAVLIVLMLVRSAR |
Ga0187818_100177713 | 3300017823 | Freshwater Sediment | MKTLTHLKRHGDSYFHLHPQHAIFSLVASFVLAVLVVLILASSVR |
Ga0187818_100179485 | 3300017823 | Freshwater Sediment | MRTPIHLKRHGDSYFHLHPLHGVFSLIASFVLAVLIVLMLVPSAR |
Ga0187818_100473602 | 3300017823 | Freshwater Sediment | MRTLIHLRRHGDGYFHLHPWHGVFSLITSFVLAVLIVLTLVSSVR |
Ga0187818_101575802 | 3300017823 | Freshwater Sediment | MKTPIHLKRHGDNYFHLHPSHAMFSLVASFVLAVLIVLVLVSSAR |
Ga0187856_10698431 | 3300017925 | Peatland | RHGVVYFHLHPLHAMFSLTTGFVLAVLVVLMLASSAR |
Ga0187806_13815401 | 3300017928 | Freshwater Sediment | MKMLIHLKGHGNSYFHLHPQHAVFSLVASFVLAVLVVLMMVSSAR |
Ga0187801_103217741 | 3300017933 | Freshwater Sediment | MKMLIHLKGHGNSYFHLHPQHAVFSLVASFVLAALVVFILVSSAR |
Ga0187803_100022699 | 3300017934 | Freshwater Sediment | MKTLIHLKRNGEVYFHLRTLHVMSSLIASFVLSVLVVLMLASSAR |
Ga0187803_100703791 | 3300017934 | Freshwater Sediment | MKTPIHLKRNSDSYFHLQPWHAVFSLIASFVLAVLIVLTLVSSAR |
Ga0187819_101036921 | 3300017943 | Freshwater Sediment | HLNRHGDNYFHLHPWHAVFSFIASFVLAVLIVLTLVPSAR |
Ga0187819_101039682 | 3300017943 | Freshwater Sediment | VSARAFMRTLIHLRRHGDGYFHLHPWHGVFSLITSFVLAVLIVLTLVSSVR |
Ga0187819_101324413 | 3300017943 | Freshwater Sediment | MKTLIHLKRNGGVYFHLHPLHAMFSLIAAFVLAVLVVLMLVSSAR |
Ga0187879_107782781 | 3300017946 | Peatland | MKTRTHLKRHGVVYFHLHPLHAMFSLTTGFVLAVLVV |
Ga0187817_101147312 | 3300017955 | Freshwater Sediment | MKTLIHLRRRGDSYFHPQHAIFSLVASFVLAALVVLILVSSAR |
Ga0187817_101817543 | 3300017955 | Freshwater Sediment | MKTPIHLNRHGDNYFHLHPWHAVFSFIASFVLAVLIVLTLV |
Ga0187817_102803461 | 3300017955 | Freshwater Sediment | HLKRHGDSYFHLHPQHAIFSLVASFVLAVLVVLILASSAR |
Ga0187817_104775752 | 3300017955 | Freshwater Sediment | MKTLIHLRRHGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVTSVR |
Ga0187817_109251051 | 3300017955 | Freshwater Sediment | MGEEALMKTLTHLKRHGDNYFHLHPQHAIFSLVASFVLAVLVVLILVSSAR |
Ga0187776_100060227 | 3300017966 | Tropical Peatland | MRTPIHLKRYGDSYFHLHPQHAVFSLVASLVLAVLVVLILVSSAR |
Ga0187816_100113682 | 3300017995 | Freshwater Sediment | MKTLIHLKRHGGVYFHLHPLHAMFSLIATFVLAVLVVLMLVSSAK |
Ga0187815_100154102 | 3300018001 | Freshwater Sediment | MKTLIHLKRHGDSYFHLHPQHAVFSLVAGFVLAVLVVLVLVSSAR |
Ga0187815_101594982 | 3300018001 | Freshwater Sediment | MKTPIHLKRNGDSYFHLQPWHAVFSLIASFVLAVLIVLTLVPS |
Ga0187805_100066723 | 3300018007 | Freshwater Sediment | MGTLIHLKRHGDGYLYLHLHQLHAIFSIVAGFVLAVLVVLVLASSAR |
Ga0187810_100315453 | 3300018012 | Freshwater Sediment | MRTPIHLNRHGDSYFHLHPLHGVFSLIASFVLAVLIVLMLVPSAR |
Ga0187810_100804703 | 3300018012 | Freshwater Sediment | MKTLIHFRRHGGSYFHLHPLHGAFSLIASFVLAVLIVLTLVSSVR |
Ga0187873_10501691 | 3300018013 | Peatland | MKTRTHLKRHGAVYFHLHPLHAMFSLTTGFVLAVLVVLMLASSAR |
Ga0187772_100601322 | 3300018085 | Tropical Peatland | MRTLIHLRRHGDGYFHLHPWHAVFSLLTSFVLAALIVLTLVSSVR |
Ga0187771_107704901 | 3300018088 | Tropical Peatland | MKTLIHRKRVGESYFHLHPLHAVFSLIASFILAVLIVLVLVPSAR |
Ga0066662_102544773 | 3300018468 | Grasslands Soil | MRTPIHLKRHGDSYFYLHPLHAVFSLIASFVLAVLIVLTLVLSAR |
Ga0187796_15606331 | 3300019264 | Peatland | RSLKRNPPVSARAFMRTLIHLRRHGDGYFHLHPWHGVFSLITSFVLAVLIVLTLVSSVR |
Ga0193751_10324021 | 3300019888 | Soil | TPIHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVLSAR |
Ga0193735_10699851 | 3300020006 | Soil | MKTPIHLKRRGDSYFHLNPLHAVFSLIASFVLAVLIVLMLVPSAR |
Ga0193724_11116101 | 3300020062 | Soil | MNTLIHLKRHGEVYSKLHPLLDTFSLIASFLLAVLVVLMLVSSAR |
Ga0215015_106214782 | 3300021046 | Soil | MKTPIHLNRHGDSYFHLHPLHAVFSLIANFVLAVLIVLALVPSAR |
Ga0212123_100196163 | 3300022557 | Iron-Sulfur Acid Spring | MRTPIHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVPSAR |
Ga0212123_1003065412 | 3300022557 | Iron-Sulfur Acid Spring | MRTPIHLKRHGDSYFHLHPLHAVFALIASFVLAVLIVLTLVPSAR |
Ga0208821_10418133 | 3300025432 | Peatland | LKRHGAVYFHLHPLHAMFSLTTGFVLAVLVVLMLASSAR |
Ga0208323_10168841 | 3300025439 | Peatland | MKTRTHLKRHGVVYFHLHPLHAMFSLTTGFVLAVLVVLMLASSAR |
Ga0208355_10921491 | 3300025581 | Arctic Peat Soil | MRTPMHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVPSAR |
Ga0207684_102742883 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LNTLIHLKRHGEVYSKLHPLLDTFSLIASFLLAVLVVLM |
Ga0207684_113559391 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTAIHLKRRGESYFHLNPLHAVFSLIASFVLAMLIVFMLVPSAR |
Ga0209840_10227344 | 3300026223 | Soil | MNTLIHLKRHGEVHFHLHPLLETFSLIASFLLAMLVVLMLVSSAR |
Ga0209240_10863762 | 3300026304 | Grasslands Soil | PIHLKRRGDSYFHLNPLHAVFSLIASFVLAVLMVLMLVPSAR |
Ga0257176_10315721 | 3300026361 | Soil | VGEGAFMRTPIHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVPSAR |
Ga0257159_10894091 | 3300026494 | Soil | MRTPIHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVLSAR |
Ga0209904_10010291 | 3300027394 | Thawing Permafrost | FMKTPIHLKRHGDSYFHLHPLHAVFSLMASFVLAVLIMLMLVPSAR |
Ga0209009_11725561 | 3300027667 | Forest Soil | AAVGEGACMRTPIHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVPSAR |
Ga0208989_100404383 | 3300027738 | Forest Soil | MKTPIHLKRSGDSYFHLNPLHAMFSLIASFMLAVLIVLML |
Ga0208989_102775131 | 3300027738 | Forest Soil | VGEGAFMKTPIHLKRRGDSYFHLNPLHAMFLLIASFVLAVLIVLMLVPSAR |
Ga0209180_102696401 | 3300027846 | Vadose Zone Soil | AAVGDGAFMRTPIHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVLSAR |
Ga0209517_100514684 | 3300027854 | Peatlands Soil | MKTPIHLKRHGDSYFHLHPLHAVFSLIASFVLTVLIVLMLVRSVR |
Ga0209701_102148911 | 3300027862 | Vadose Zone Soil | HGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVPSAR |
Ga0209701_102639753 | 3300027862 | Vadose Zone Soil | HGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVLSAR |
Ga0209283_100797214 | 3300027875 | Vadose Zone Soil | MRTPIHLKRHGDSYFHLHPSHSVFSLIASFVLAVLIVLTLVLSA |
Ga0209488_104969022 | 3300027903 | Vadose Zone Soil | AAVCDGAFMRTPIHLKRHGDSYFHLHPLHAVFSLIASFVLAVLIVLTLVLSAR |
Ga0209415_1002254113 | 3300027905 | Peatlands Soil | MKSLIHLKRHGDSYFHLHPSHAVFPLIASFVLAVLIVLTLVSSAR |
Ga0209698_100244906 | 3300027911 | Watersheds | MKTLIHLKRHGDSYFHVHPQHAIFSLVAGFVLAVLVVLVLASSAR |
Ga0310913_107017672 | 3300031945 | Soil | MKTLIHLKGHGNSYSHLHPQHAIFSLVAGLMLAVLVVFILVSSAR |
Ga0311301_100123277 | 3300032160 | Peatlands Soil | MKTLIHLKRHGGVYFHLHPLHAMFSLIATFVLAVLVVLMLVSSAR |
Ga0311301_112007902 | 3300032160 | Peatlands Soil | RHGAVYFHLHPLHAMFSLTTGFVLAVLVVLMLASSAR |
Ga0335085_1000093874 | 3300032770 | Soil | MKTLLHFKGHGDSYFHLHPQHVIFSVVATLMLTVLVVLILVSSAR |
Ga0335085_1001912815 | 3300032770 | Soil | MKTLIHFKGHGDGYFQLHPQYVVFSLVASFVLAVLVVLVLVSSAR |
Ga0335082_102281682 | 3300032782 | Soil | MRAVVHLKRHGDSYFHFHHLHATFSLLASFVLAVLVVLILVSSAR |
Ga0335079_100040303 | 3300032783 | Soil | MMNTFLKPHGNTHFHAHPWHTTFSLIASFLLAGLVVLALASSAR |
Ga0335079_101171382 | 3300032783 | Soil | MKTLIHLKRHGNTYFHLHPLHATFSLFAAFLLALLVVLFVASPAR |
Ga0335078_106023104 | 3300032805 | Soil | MKTLIHLKRHGNTYFHLHPLHATVSLFAAFLLALLVV |
Ga0335078_108171393 | 3300032805 | Soil | LIHVKGHGNSYFHLHPQHAVFSLVASFVLAALVVFILVSSAR |
Ga0335070_100273395 | 3300032829 | Soil | MNTLIHFKGHGNGYFHLHPQHAVFSLVASFVLAVLVVLVLISSAR |
Ga0335070_102003641 | 3300032829 | Soil | MKTLLHFKGHGDSYFHLHPQHAIFSVVATLMLAVLVVLILVSSAR |
Ga0335070_115493101 | 3300032829 | Soil | MKMLIHLKGHGNSYFHLHAQHAVFSLVASFVLAVLVVLVLISSAR |
Ga0335081_100438548 | 3300032892 | Soil | MKTLIHLKRHGNTYFHLHPLHATVSLFAAFLLALLVVLFVASPAR |
Ga0335069_100893252 | 3300032893 | Soil | MKALIHFKGHGNSYFHLHPQHAIFSLVASLMLAVLVVLILVSSAR |
Ga0335084_107581701 | 3300033004 | Soil | MKTLIYLKGHGNSYFHLHPQHAIFSLVASLMFVVLVVLILVLSAR |
Ga0335077_100939704 | 3300033158 | Soil | MKTLIYLKGHGNSYFHLHPQHAIFSLVASLMLAVLVVLILVASAR |
Ga0335077_121603471 | 3300033158 | Soil | LKDISPRGEEAFMNTLIHVKGHGNSNFHLHPQHALFSLVASIVLAVLTVLILVSSAR |
Ga0316624_103928351 | 3300033486 | Soil | LTASAVIGEAPMNTLIHLKRHGEVHFHLHPLLETFSLIASFLLAMLVVLMLVSSAR |
Ga0316628_1000910063 | 3300033513 | Soil | MKMLIHFKGHGNGYFHLHPQHAVFSLVAGFVLAVLVVLVLVSSAR |
⦗Top⦘ |