| Basic Information | |
|---|---|
| Family ID | F052091 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 143 |
| Average Sequence Length | 48 residues |
| Representative Sequence | VVREQRASADPALDTIHPGDRIALSWDEASPLLLGEAAPATTAGEQEES |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.90 % |
| % of genes from short scaffolds (< 2000 bps) | 88.11 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.301 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.580 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.678 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.357 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.19% β-sheet: 0.00% Coil/Unstructured: 94.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF13416 | SBP_bac_8 | 21.68 |
| PF00528 | BPD_transp_1 | 4.90 |
| PF01547 | SBP_bac_1 | 2.10 |
| PF00005 | ABC_tran | 1.40 |
| PF07282 | OrfB_Zn_ribbon | 0.70 |
| PF06224 | HTH_42 | 0.70 |
| PF00171 | Aldedh | 0.70 |
| PF12680 | SnoaL_2 | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.70 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.70 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.70 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.30 % |
| Unclassified | root | N/A | 0.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig08558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1673 | Open in IMG/M |
| 2209111022|2221209041 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300005332|Ga0066388_105389851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 648 | Open in IMG/M |
| 3300005332|Ga0066388_105422830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 646 | Open in IMG/M |
| 3300005335|Ga0070666_10084314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2175 | Open in IMG/M |
| 3300005434|Ga0070709_11376288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300005435|Ga0070714_100076599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2904 | Open in IMG/M |
| 3300005435|Ga0070714_100988966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 818 | Open in IMG/M |
| 3300005435|Ga0070714_101715358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 613 | Open in IMG/M |
| 3300005435|Ga0070714_101934264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 575 | Open in IMG/M |
| 3300005435|Ga0070714_102038502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 559 | Open in IMG/M |
| 3300005435|Ga0070714_102461089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300005436|Ga0070713_100369407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1334 | Open in IMG/M |
| 3300005436|Ga0070713_101970875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 566 | Open in IMG/M |
| 3300005436|Ga0070713_102335332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
| 3300005439|Ga0070711_101408628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
| 3300005445|Ga0070708_100097792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2683 | Open in IMG/M |
| 3300005445|Ga0070708_101689920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 588 | Open in IMG/M |
| 3300005468|Ga0070707_100843004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 881 | Open in IMG/M |
| 3300005526|Ga0073909_10268958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 764 | Open in IMG/M |
| 3300005586|Ga0066691_10541964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 694 | Open in IMG/M |
| 3300005602|Ga0070762_10681744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 688 | Open in IMG/M |
| 3300005617|Ga0068859_103182761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
| 3300005841|Ga0068863_101770528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 627 | Open in IMG/M |
| 3300006175|Ga0070712_100932610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 749 | Open in IMG/M |
| 3300006175|Ga0070712_102015159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 505 | Open in IMG/M |
| 3300006755|Ga0079222_10213154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1175 | Open in IMG/M |
| 3300006806|Ga0079220_10851330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
| 3300006871|Ga0075434_101916492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300006914|Ga0075436_100662495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 772 | Open in IMG/M |
| 3300006954|Ga0079219_11702953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 584 | Open in IMG/M |
| 3300007076|Ga0075435_101755889 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300009038|Ga0099829_10701331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 841 | Open in IMG/M |
| 3300009089|Ga0099828_11959663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300009093|Ga0105240_10334811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1721 | Open in IMG/M |
| 3300009137|Ga0066709_101223300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1105 | Open in IMG/M |
| 3300010043|Ga0126380_11255951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 642 | Open in IMG/M |
| 3300010048|Ga0126373_11655193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 704 | Open in IMG/M |
| 3300010360|Ga0126372_12555088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 562 | Open in IMG/M |
| 3300010361|Ga0126378_10665474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1154 | Open in IMG/M |
| 3300010361|Ga0126378_11376830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 798 | Open in IMG/M |
| 3300010361|Ga0126378_12210021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 628 | Open in IMG/M |
| 3300010362|Ga0126377_11481859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 752 | Open in IMG/M |
| 3300010366|Ga0126379_12581254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 606 | Open in IMG/M |
| 3300010366|Ga0126379_13354309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
| 3300010371|Ga0134125_12039143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300010376|Ga0126381_101912272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 856 | Open in IMG/M |
| 3300010376|Ga0126381_103683620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| 3300010396|Ga0134126_11864346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
| 3300010398|Ga0126383_12864016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 563 | Open in IMG/M |
| 3300010398|Ga0126383_13330723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300010403|Ga0134123_10032119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3830 | Open in IMG/M |
| 3300011106|Ga0151489_1217457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
| 3300011107|Ga0151490_1620813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1384 | Open in IMG/M |
| 3300011270|Ga0137391_10348544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1272 | Open in IMG/M |
| 3300011332|Ga0126317_10992114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1405 | Open in IMG/M |
| 3300012198|Ga0137364_10851524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 689 | Open in IMG/M |
| 3300012200|Ga0137382_10602284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 785 | Open in IMG/M |
| 3300012205|Ga0137362_11582936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300012210|Ga0137378_10024581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5309 | Open in IMG/M |
| 3300012211|Ga0137377_11092866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 728 | Open in IMG/M |
| 3300012356|Ga0137371_10451150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 995 | Open in IMG/M |
| 3300012361|Ga0137360_11297193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 629 | Open in IMG/M |
| 3300012683|Ga0137398_10273207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1131 | Open in IMG/M |
| 3300012683|Ga0137398_10935405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 603 | Open in IMG/M |
| 3300012685|Ga0137397_11188703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
| 3300012917|Ga0137395_10324646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1094 | Open in IMG/M |
| 3300012958|Ga0164299_10096463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1526 | Open in IMG/M |
| 3300012958|Ga0164299_10696934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 710 | Open in IMG/M |
| 3300012960|Ga0164301_10423265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 939 | Open in IMG/M |
| 3300012971|Ga0126369_12272804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 629 | Open in IMG/M |
| 3300012975|Ga0134110_10288073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 706 | Open in IMG/M |
| 3300012986|Ga0164304_11066807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 644 | Open in IMG/M |
| 3300013296|Ga0157374_11343421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 737 | Open in IMG/M |
| 3300014324|Ga0075352_1310077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300016387|Ga0182040_10438243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1033 | Open in IMG/M |
| 3300016387|Ga0182040_10443359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1027 | Open in IMG/M |
| 3300016422|Ga0182039_10777413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 849 | Open in IMG/M |
| 3300017947|Ga0187785_10315084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 724 | Open in IMG/M |
| 3300017947|Ga0187785_10757330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300020579|Ga0210407_10485571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 966 | Open in IMG/M |
| 3300020581|Ga0210399_10559415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 948 | Open in IMG/M |
| 3300020581|Ga0210399_10843488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 746 | Open in IMG/M |
| 3300021420|Ga0210394_10174078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1874 | Open in IMG/M |
| 3300021432|Ga0210384_10160408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2018 | Open in IMG/M |
| 3300021445|Ga0182009_10353716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 751 | Open in IMG/M |
| 3300021478|Ga0210402_10089319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2753 | Open in IMG/M |
| 3300021478|Ga0210402_11482978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
| 3300021559|Ga0210409_11555312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
| 3300024331|Ga0247668_1035384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1023 | Open in IMG/M |
| 3300024347|Ga0179591_1045589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2704 | Open in IMG/M |
| 3300025898|Ga0207692_10640159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 686 | Open in IMG/M |
| 3300025905|Ga0207685_10758107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
| 3300025906|Ga0207699_10665263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 761 | Open in IMG/M |
| 3300025915|Ga0207693_10516932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 932 | Open in IMG/M |
| 3300025915|Ga0207693_11162214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
| 3300025915|Ga0207693_11461933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300025916|Ga0207663_10139874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1685 | Open in IMG/M |
| 3300025928|Ga0207700_11008035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 745 | Open in IMG/M |
| 3300025928|Ga0207700_11243206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 664 | Open in IMG/M |
| 3300025929|Ga0207664_10226856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1622 | Open in IMG/M |
| 3300025929|Ga0207664_10404651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1214 | Open in IMG/M |
| 3300025944|Ga0207661_10100040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2433 | Open in IMG/M |
| 3300026301|Ga0209238_1245852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
| 3300026356|Ga0257150_1055180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300027765|Ga0209073_10307467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| 3300027875|Ga0209283_10723279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 620 | Open in IMG/M |
| 3300027915|Ga0209069_10208958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 999 | Open in IMG/M |
| 3300028065|Ga0247685_1025254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 710 | Open in IMG/M |
| 3300028782|Ga0307306_10014597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1720 | Open in IMG/M |
| 3300031199|Ga0307495_10252267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
| 3300031544|Ga0318534_10209704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1124 | Open in IMG/M |
| 3300031546|Ga0318538_10008031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4226 | Open in IMG/M |
| 3300031680|Ga0318574_10437847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 765 | Open in IMG/M |
| 3300031718|Ga0307474_10565301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 895 | Open in IMG/M |
| 3300031719|Ga0306917_10051632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2771 | Open in IMG/M |
| 3300031744|Ga0306918_11197123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
| 3300031768|Ga0318509_10205657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1096 | Open in IMG/M |
| 3300031770|Ga0318521_10779740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
| 3300031777|Ga0318543_10363051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 649 | Open in IMG/M |
| 3300031781|Ga0318547_10079465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1834 | Open in IMG/M |
| 3300031796|Ga0318576_10014182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3024 | Open in IMG/M |
| 3300031796|Ga0318576_10294747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 766 | Open in IMG/M |
| 3300031831|Ga0318564_10479480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
| 3300031910|Ga0306923_12359347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
| 3300031912|Ga0306921_11754415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
| 3300031939|Ga0308174_10350607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1177 | Open in IMG/M |
| 3300031941|Ga0310912_11144982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
| 3300031942|Ga0310916_10053368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3101 | Open in IMG/M |
| 3300031942|Ga0310916_10296399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1369 | Open in IMG/M |
| 3300031954|Ga0306926_10174760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2664 | Open in IMG/M |
| 3300031962|Ga0307479_12050882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300032043|Ga0318556_10025941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2677 | Open in IMG/M |
| 3300032055|Ga0318575_10072222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1630 | Open in IMG/M |
| 3300032059|Ga0318533_10345163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1084 | Open in IMG/M |
| 3300032091|Ga0318577_10425365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 634 | Open in IMG/M |
| 3300032261|Ga0306920_100363210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2153 | Open in IMG/M |
| 3300032261|Ga0306920_103473298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
| 3300032805|Ga0335078_11353785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 808 | Open in IMG/M |
| 3300033004|Ga0335084_10438713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1344 | Open in IMG/M |
| 3300033475|Ga0310811_10290262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1894 | Open in IMG/M |
| 3300034818|Ga0373950_0084997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 665 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 13.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 5.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.10% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.40% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.40% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.40% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.40% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.70% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.70% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.70% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.70% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.70% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.70% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028065 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0558.00000860 | 2166559005 | Simulated | VVREQRASADPALDTIHPGDRIALSWDEASPLLLGEAAPATTAGEQEES |
| 2222045597 | 2209111022 | Grass Soil | VVREQRASADPALDTIHPGDRIALSWDESSPLLLGEAAPATTGGEQEES |
| Ga0066388_1053898511 | 3300005332 | Tropical Forest Soil | GDSILVREQRASADPTLDTIHPDDRIALSWDEAAPLLLGDATPAAVGGQQEES* |
| Ga0066388_1054228302 | 3300005332 | Tropical Forest Soil | DVVVREQRASADPALDTIHPGDRIALSWDETSPLLLGEAAPATTAGEQEES* |
| Ga0070666_100843141 | 3300005335 | Switchgrass Rhizosphere | ADPALDSIHPGDRIALSWDESSPLLLGEAVPATTDGEQEES* |
| Ga0070709_113762881 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PGLADIVVREQRAVADPALDAVHPGDQIALSWDDAAPLLLGEAAPASPAGQQEES* |
| Ga0070714_1000765991 | 3300005435 | Agricultural Soil | VVVREQRASADPALDSIHPGDRIALSWDETSPLLLGEAAPALTDSEQEES* |
| Ga0070714_1009889662 | 3300005435 | Agricultural Soil | RLPGIGDVVVREQRASADPALDSIQPGDRIALSWDETSPLLLGEAVPAPTDGEQEES* |
| Ga0070714_1017153581 | 3300005435 | Agricultural Soil | VVVREQRASADPALDSIHPGDRIALSWDETSPLLLGEAAPAPTDGEQEES* |
| Ga0070714_1019342642 | 3300005435 | Agricultural Soil | VREQRASADPALDTIHPGDQITISWDESAPLLLGEADPAPAGGQEEES* |
| Ga0070714_1020385022 | 3300005435 | Agricultural Soil | VAELPGIGSIVVREQRASADPALDSIHPGDRIALSWDESSPLLLGETAPASTAGEQEEL* |
| Ga0070714_1024610892 | 3300005435 | Agricultural Soil | LASGDSVIVREQRASADPALDTIHPGDQITISWDESAPLLLGEADPAPADGSEEES* |
| Ga0070713_1003694072 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VAELPGIGSIVVREQRASADPALDSIHPGDRIALSWDEASPLLLGETAPASTAGEQEES* |
| Ga0070713_1019708751 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | QRVSADPALDSIHPGDRIALSWDESSPLLLGETRPASTAGKEES* |
| Ga0070713_1023353321 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LASGDSVIVREQRASADPALDTIHPGDQITISWDESAPLLLGEADPAPADGPEEES* |
| Ga0070711_1014086282 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GLADIVVREQRAVADPALDAVHPGDQIALSWDDAAPLLLGEAAPASPAGQQEEK* |
| Ga0070708_1000977924 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ARLPGIDDVVVREQRASADPALDTIHPGDRIALSWDESSPLLLGEAVPATTDGEQEES* |
| Ga0070708_1016899202 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VVVREQRASADPTLDTINPGDRIALSWDETAPLLLGDAVPAEAGGKREDP* |
| Ga0070707_1008430042 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ASADPALDTIHPGDRIAISWDESAPLLLGEAVPATAGGQKEET* |
| Ga0073909_102689581 | 3300005526 | Surface Soil | DDVVVREQRASADPALDSIHPGDRIALSWDETSPLLLGEAAPALTDSEQEES* |
| Ga0066691_105419642 | 3300005586 | Soil | SADPALDTIHPGDRIAISWDEAAPLLLGEAAPARAPSGEEEES* |
| Ga0070762_106817442 | 3300005602 | Soil | VAELPGIGSIVVREQRASADPALDSIHPGERIALSWDESSPLLLGETVPASTAPASTAGKQEES* |
| Ga0068859_1031827611 | 3300005617 | Switchgrass Rhizosphere | PALDTIHPGDRIALSWDETSPLLLGEAAPATKDGEQEES* |
| Ga0068863_1017705282 | 3300005841 | Switchgrass Rhizosphere | QRASADPALDTIHPGDQITISWDESAPLLLGEADPVPAGGSEEES* |
| Ga0070712_1009326102 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SIHPGDRIALSWDEASPLLLGETAPASTAGEQEES* |
| Ga0070712_1020151592 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GIGSIVVREQRASADPALDSIHPGDRIALSWDESSPLLLGETAPASTAGEQEENHEHR* |
| Ga0079222_102131542 | 3300006755 | Agricultural Soil | ADPTLDTIHPGDRIALSWDEAAPLLLGESITTAAGGQQEES* |
| Ga0079220_108513302 | 3300006806 | Agricultural Soil | AQLASGDSVIVREQRASADPALDTIHPGDQITISWDESAPLLLGEAEPAPAGGQEEES* |
| Ga0075434_1019164921 | 3300006871 | Populus Rhizosphere | IVREQRASADPALDTIHPGDQITISWDESAPLLLGEAEPAPAGGQEEES* |
| Ga0075436_1006624952 | 3300006914 | Populus Rhizosphere | EQRASADPALDSIHPGDRIALSWDEASPLLLGETTPASTAGEQEEP* |
| Ga0079219_117029532 | 3300006954 | Agricultural Soil | VREQRASADPALDSIHPGDRIALSWDESSPLLLGETAPASTAGEQEGNHEHR* |
| Ga0075435_1017558892 | 3300007076 | Populus Rhizosphere | DVVVREQRASADPALDTIHPGDRIALSWDESSPLLLGEAVPATTDGEQEES* |
| Ga0099829_107013311 | 3300009038 | Vadose Zone Soil | TDVIVREQRASADPALDTIHPGDQITINWDEAAPLLLGDPERASLDPEEREEA* |
| Ga0099828_119596632 | 3300009089 | Vadose Zone Soil | GGNVVVREQRASADPALDTIHPGDRIALRWDESAPLLLGEAVPATAGGQKEET* |
| Ga0105240_103348111 | 3300009093 | Corn Rhizosphere | RASADPALDTIHPGDQITISWDESAPLLLGEAEPAPAGGQEEES* |
| Ga0066709_1012233001 | 3300009137 | Grasslands Soil | RLRGIGDVVLREQRASPDPALDSIQSGDRTALSGDETPPLLLGQAVPAPTDGEQEES* |
| Ga0126380_112559512 | 3300010043 | Tropical Forest Soil | DPALDTIHPGDRIALSWDESSPLLLGETAPATTDGEQEEP* |
| Ga0126373_116551932 | 3300010048 | Tropical Forest Soil | VVVREQRASADPTLDTINPGDRIALSWDETAPLLLGDAALAEVGGKREDT* |
| Ga0126372_125550882 | 3300010360 | Tropical Forest Soil | VGGGDVVVREQRASADPTLDTINPGDRIALSWDETAPLLLGETALAEVGGNREDP* |
| Ga0126378_106654741 | 3300010361 | Tropical Forest Soil | GGGDVVVREQRASADPTLDTINPGDRIALSWDETAPLLLGDVAAPAEAGGKREDP* |
| Ga0126378_113768301 | 3300010361 | Tropical Forest Soil | GDVVVREQRASADPTLDTINPGDRIALSWDETAPLLLGETAPAEVGG* |
| Ga0126378_122100211 | 3300010361 | Tropical Forest Soil | RASADPALDTIHPGDRIALSWDESSPLLLGEAAPATKDGEQEES* |
| Ga0126377_114818592 | 3300010362 | Tropical Forest Soil | IVREQRASADPALDTIHPGDQITISWDESAPLLLGEAGPAPAGGQEEES* |
| Ga0126379_125812541 | 3300010366 | Tropical Forest Soil | RLPGISDVVVREQRASADPALDTIHPGDRIALSWDESSPLLLGEAAPATTDGEQEES* |
| Ga0126379_133543092 | 3300010366 | Tropical Forest Soil | GIGDVVVREQRASADPALDNIHPGDRIALSWDETSPLLLGEAAPAPTAGEQEES* |
| Ga0134125_120391431 | 3300010371 | Terrestrial Soil | GIGDIVVREQRTSADPALDAIHPGDQITLSWDEAAPLLLGDATQAPAASQQEES* |
| Ga0126381_1019122721 | 3300010376 | Tropical Forest Soil | QRASADPALDNIHPGDRIALSWDETSPLLLGEAAPAATAGEQEES* |
| Ga0126381_1036836201 | 3300010376 | Tropical Forest Soil | IQIVATVPGIGNVVVREQRAVADPALDAVHPGDQIALSWDEAAPLLLGDVAPAATAGQQEES* |
| Ga0134126_118643462 | 3300010396 | Terrestrial Soil | VVREQRASADPALDTIHPGDRIALSWDESSPLLLGEAVPATTDGEQEES* |
| Ga0126383_128640161 | 3300010398 | Tropical Forest Soil | LVREQRASADPTLDTIHPDDRIALSWDEAAPLLLGDATPAAAGGGQEES* |
| Ga0126383_133307231 | 3300010398 | Tropical Forest Soil | ATVPGIGNVLVREQRAVADPALDAVHPGDQIALSWDEAAPLLLGDVAPAATAGQQEES* |
| Ga0134123_100321191 | 3300010403 | Terrestrial Soil | GIDDVVVREQRASADPALDTIHPGDRIALSWDESSPLLLGEAVPATTDGEQEES* |
| Ga0151489_12174571 | 3300011106 | Soil | LDAVHPGDQIALSWDDAAPLLLGEAAPASTAAGKQEEF* |
| Ga0151490_16208132 | 3300011107 | Soil | SADPALDTINPGDRIALSWDEAAPLLLGDATPAAAGGGQEES* |
| Ga0137391_103485441 | 3300011270 | Vadose Zone Soil | SGGNVVVREQRVSADPALDTIHPGDRIALSWDEAAPLLLGEAVSAATGGKQEES* |
| Ga0126317_109921141 | 3300011332 | Soil | QIVARLAGVGDVVVREQRASADPALDAVQPGHHISLSWDEAAPLLLGQATPAALAGKQEES* |
| Ga0137364_108515241 | 3300012198 | Vadose Zone Soil | RLPGIGNVVVREQRASADPALDSIQSGDRIALSWDETSPLLLGEAVPAPTDGEQEES* |
| Ga0137382_106022841 | 3300012200 | Vadose Zone Soil | MQIVARLPGIGDIVVREQRASADPALDSIQSGDRIALSWDETSPLLLGEAVPAPTDGEQEES* |
| Ga0137362_115829361 | 3300012205 | Vadose Zone Soil | KLPGIGNVIVREQRASADPALDTIHPGDRIALSWDEASPLLLGEAAPAITAGEQEES* |
| Ga0137378_100245811 | 3300012210 | Vadose Zone Soil | HPGDRIAISWDEAAPLLLGEAAPARAPSGEEEES* |
| Ga0137377_110928662 | 3300012211 | Vadose Zone Soil | ADPALDTIHPGDLIALSWDESAPLLLGDVAAGGQKEES* |
| Ga0137371_104511501 | 3300012356 | Vadose Zone Soil | ELPGIGSIVVREQRASADPALDSIHPGDRIALSWDESSPLLLGETAPASTAGEQEES* |
| Ga0137360_112971932 | 3300012361 | Vadose Zone Soil | ALDSIHPGDRIALSWDEAAPLLLGEITPADAGQQEES* |
| Ga0137398_102732072 | 3300012683 | Vadose Zone Soil | RASADPALDTIHPGDRIALSWDEASPRLLGEAAPAITAGEQEES* |
| Ga0137398_109354051 | 3300012683 | Vadose Zone Soil | GSIVVREQRASADPALDSIHPGDRIALSWDESSPLLLGETAPASTAGEQEES* |
| Ga0137397_111887031 | 3300012685 | Vadose Zone Soil | LPGIGNVVVREQRASADPALDTIHPGDRIALSWDEASPLLLGEAAPATTAGEQEES* |
| Ga0137395_103246461 | 3300012917 | Vadose Zone Soil | GDNIVIREQRASADPALDTIHPADRIALSWDEAAPLLLGEAAQAATGGQQEES* |
| Ga0164299_100964631 | 3300012958 | Soil | TRLPGIGDVVVREQRASADPALDSIHPGDRIALSWDETSPLLLGEAAPALTDSEQEES* |
| Ga0164299_106969342 | 3300012958 | Soil | IHPGDRIALSWDETSPLLLGEAAPAPTDGEQEES* |
| Ga0164301_104232651 | 3300012960 | Soil | DVVVREQRASADPALDTVHPGDRIALSWDETSPLLLGEAAPAPTDGEQEES* |
| Ga0126369_122728042 | 3300012971 | Tropical Forest Soil | REQRASADPTLDNIHPGDRIAVSWDEAAPLLLGAAAPNDVGEQEENK* |
| Ga0134110_102880731 | 3300012975 | Grasslands Soil | RIAGGSSVIVREQRASADPALDTIHPGDQIAITWDEAAPLLLGDVGAATDASEREGGS* |
| Ga0164304_110668071 | 3300012986 | Soil | IHPGDRIALSWDETSPLLLGEAAPALTDSEQEES* |
| Ga0157374_113434211 | 3300013296 | Miscanthus Rhizosphere | RASADPALDSLHPGDRIALSWDESSPLLLGETAPASTAGEQEES* |
| Ga0075352_13100771 | 3300014324 | Natural And Restored Wetlands | NVVVREQRASADPALDTIHPGDRIAVSWDEDAPLLLGDVEPVSASIEGAT* |
| Ga0182034_114158972 | 3300016371 | Soil | VREQRASADPALDTIHPGDRIALSWDEASPLLLGEATPATTPG |
| Ga0182040_104382432 | 3300016387 | Soil | EQRASADPALDTIHPGDRIALGWDETSPLLLGEAATKDGEQEET |
| Ga0182040_104433592 | 3300016387 | Soil | ADPTLDTIHPDDRSALSWDEAAPLLLGEAISAATGDHQEES |
| Ga0182039_107774131 | 3300016422 | Soil | RASADPALDTIHPGDRIALSWDETSPLLLGEAATKDGEQEET |
| Ga0187785_103150842 | 3300017947 | Tropical Peatland | VARLASGDSILVREQRASADPTLDTIHPDDRIALSWDEAAPLLLGDATPAAVGGEQEES |
| Ga0187785_107573301 | 3300017947 | Tropical Peatland | PTLDTIHPDDRIALSWDEAAPLLLGDATPAAAGGGGQEES |
| Ga0210407_104855712 | 3300020579 | Soil | ADPALDTIHPGDRIALSWDEASPLLLGEAAPATMAGEQEES |
| Ga0210399_105594152 | 3300020581 | Soil | LDIINPGDSVVLGWDEAAPLLLGEASPDLVGGQEES |
| Ga0210399_108434882 | 3300020581 | Soil | PALDTIHPGDRITLSWDEAAPLLLGEAAPAAPGDRQEDS |
| Ga0210394_101740781 | 3300021420 | Soil | RASADPALDSIHPGDRIALRWDESSPLLLGETVPASTAGEQEQS |
| Ga0210384_101604081 | 3300021432 | Soil | RASADPALDSIHPGDRIALRWDESSPLLLGETVPASTAGQQEES |
| Ga0182009_103537161 | 3300021445 | Soil | LDTIHPGDRIALSWDESSPLLLGEAAPAITDGEQEES |
| Ga0210402_100893194 | 3300021478 | Soil | ILVREQRASADPTLDTIHPDDRIALSWDEAAPLLLGDATPAAAGGEQEES |
| Ga0210402_114829782 | 3300021478 | Soil | LDTIHPGDRIALSWDEASPLLLGEAAPATTAGEQEES |
| Ga0210409_115553121 | 3300021559 | Soil | TIHPGDRIALSWDEASPLLLGEAAPATTAGEQEES |
| Ga0247668_10353841 | 3300024331 | Soil | LDTIHPGDQITISWDESAPLLLGEADPVPAGGPEEES |
| Ga0179591_10455895 | 3300024347 | Vadose Zone Soil | ALDTIHPGDRIALSWDEASPLLLGEAALAITAGEQEES |
| Ga0207692_106401591 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LPGIGSIVVREQRASADPALDSIHPGDRIALSWDEASPLLLGETAPASTAGEQEES |
| Ga0207685_107581072 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | PALDTIHPGDRIALSWDETSPLLLGEATPATTDGEQEES |
| Ga0207699_106652632 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GIGSIVVREQRASADPALDSIHPGDRIALSWDEASPLLLGETAPASTAGEQEES |
| Ga0207693_105169321 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VAELPGIGSIVVREQRASADPALDSIHPGDRIALSWDEASPLLLGETAPASTAGEQEES |
| Ga0207693_111622142 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RASADPALDTIHPGDQITISWDESAPLLLGEADPVPAGGPEEES |
| Ga0207693_114619332 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VSADPALDSIHPGDRIALSWDESSPLLLGETAPASTAGEQEE |
| Ga0207663_101398743 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | IDDVVVREQRASADPALDSIHPGDRIALSWDETSPLLLGEAAPALTDSEQEES |
| Ga0207700_110080352 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VREQRASADPALDTIHPGDRITLSWDEAAPLLLGEAAPAAPGGRQEDS |
| Ga0207700_112432062 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | QRVSADPALDSIHPGDRIALSWDESSPLLLGETRPASTAGKEES |
| Ga0207664_102268561 | 3300025929 | Agricultural Soil | REQRASADPALDTIHPGDQITISWDESAPLLLGEADPAPAGGQEEES |
| Ga0207664_104046512 | 3300025929 | Agricultural Soil | QRASADPALDSIQPGDRIALSWDETSPLLLGEAVPAPTDGEQEES |
| Ga0207661_101000403 | 3300025944 | Corn Rhizosphere | QLASGDSVIVREQRASADPALDTIHPGDQITISWDESAPLLLGEAEPAPAGGQEEES |
| Ga0209238_12458522 | 3300026301 | Grasslands Soil | DPTLDTIHPGDRIALSWDEAAPLLLGESITTAAGGQQEES |
| Ga0257150_10551801 | 3300026356 | Soil | VVREQRASADPALDTIHPGDHIALSWDEAAPLFLGEAVPPAADGQQEES |
| Ga0209073_103074672 | 3300027765 | Agricultural Soil | REQRASADPTLDTIHPGDRIALSWDEAAPLLLGESITTAAGGQQEES |
| Ga0209283_107232791 | 3300027875 | Vadose Zone Soil | DPALDIIHPGDRIALSWDEASPLLLGEAAPAATAGEQEES |
| Ga0209069_102089581 | 3300027915 | Watersheds | TIHPGDRIALSWDESAPLLLGEVAPAAGGGQKEES |
| Ga0247685_10252542 | 3300028065 | Soil | RLPGIDDIVVREQRASADPALDTIHPGDRIALSWDESSPLLLGEAVPATTDGEQEES |
| Ga0307306_100145971 | 3300028782 | Soil | VVVREQRASADPALDSIHPGDRIALSWDETSPLLLGEAVPAPTDGEQEES |
| Ga0307495_102522671 | 3300031199 | Soil | SVIVREQRASADPALDTIHPGDQITISWDESAPLLLGEADPAPAGGLEEES |
| Ga0318534_102097042 | 3300031544 | Soil | PALDTIHPGDRIAVSWDEAAPLLLGAAAPKDAGESEENQ |
| Ga0318538_100080311 | 3300031546 | Soil | LDTIHPGDRIALSWDETSPLLLGEAATKDGEQEET |
| Ga0318574_104378471 | 3300031680 | Soil | LAGINDFVVREQRASADPALDTIHPGDRIAVSWDEAAPLLLGAAARNDAGESEEDQ |
| Ga0307474_105653012 | 3300031718 | Hardwood Forest Soil | GIADIVVREQRAVADPALDAVHPGDQIALSWDDAAPLLLGEAAPVSTAGQQEES |
| Ga0306917_100516321 | 3300031719 | Soil | IGDIVVREQRASADPALDTIHPGDRIALSWDETSPLLLGEAATKDGEQEET |
| Ga0306918_111971231 | 3300031744 | Soil | DPALDTIHPGDRIAVSWDEAAPLLLGAAARSDAGESEEDQ |
| Ga0318509_102056572 | 3300031768 | Soil | GDSILVREQRASADPTLDTIHPDDRIALSWDEAAPLLLGEAISAATGGHQEES |
| Ga0318521_107797401 | 3300031770 | Soil | ARLASGDSILVREQRASADPTLDTIHPDDRIALSWDEAAPLLLGDDTPAAVGGQQEES |
| Ga0318543_103630512 | 3300031777 | Soil | DVVVREQRASADPALDTIHPGDRIALSWDETSPLLLGEAATKDGEQEET |
| Ga0318547_100794651 | 3300031781 | Soil | GIGNAVVREQRASADPALDTIHPGDRIALSWDEASPLLLGEDTPATRTG |
| Ga0318576_100141825 | 3300031796 | Soil | VREQRASADPALDTIHPGDRIALSWDETSPLLLGEAATKDGEQEET |
| Ga0318576_102947471 | 3300031796 | Soil | LDTIHPGDRIALSWDETSPLLLGEAAPAPTAGEQEES |
| Ga0318564_104794802 | 3300031831 | Soil | AKLAGIAEFVVREQRASADPALDTIHPGDRIAVSWDEAAPLLLGAAAPKDAGESEENQ |
| Ga0306923_123593471 | 3300031910 | Soil | DTLHPGDRIVLCWDESSPLLLGEATPTTTVGRQEES |
| Ga0306921_117544151 | 3300031912 | Soil | RASADPALDTIHPGDRIAVSWDEAAPLLLGAAAPKDAGESEEDQ |
| Ga0308174_103506071 | 3300031939 | Soil | VVREQRAVADPALDAVHPGDQIALSWDDAAPLLLGEAAPASTAAGKQEES |
| Ga0310912_111449822 | 3300031941 | Soil | SDVVVREQRASADPALDTIHPGDRIALSWDETSPLLLGEAATKDGEQEET |
| Ga0310916_100533684 | 3300031942 | Soil | REQRASADPALDTIHPGDRIALSWDETSPLLLGEAATKDGEQEET |
| Ga0310916_102963991 | 3300031942 | Soil | PGIGDVVVREQRASADPALDTIHPGDRIALSWDETSPLLLGEAAPAPTAGEQEES |
| Ga0306926_101747604 | 3300031954 | Soil | DPALDTIHPGDRIALSWDETSPLLLGEAAPAPTAGEQEES |
| Ga0307479_120508821 | 3300031962 | Hardwood Forest Soil | GIGDVVVREQRASADPALDSIQPGDRIALSWDETSPLLLGEAVPAPTDGEQEES |
| Ga0318556_100259411 | 3300032043 | Soil | ASGDSILVREQRASADPTLDTIHPDDRIALSWDEAAPLLLGEAISAATGGHQEES |
| Ga0318575_100722223 | 3300032055 | Soil | LPGIGNAVVREQRASADPALDTIHPGDRIALSWDEASPLLLGEATPATTTG |
| Ga0318533_103451633 | 3300032059 | Soil | SADPALDTIHPGDRIALSWDEASPLLLGEDTPATRTG |
| Ga0318577_104253651 | 3300032091 | Soil | PALDTSHPGDRIALSWDETSPLLLGEAAPAPTAGEQEES |
| Ga0306920_1003632101 | 3300032261 | Soil | GDSILVREQRASADPTLDTIHPDDRIALSWDEAAPLLLGEAISAATGDHQEES |
| Ga0306920_1034732981 | 3300032261 | Soil | PALDTIHPGDRIAVSWDEAAPLLLGAAAPNDAGESEEDQ |
| Ga0335078_113537851 | 3300032805 | Soil | QRASADPTLDTIHPDDRIALSWDEAAPLLLGDAIPAAAGGHQEES |
| Ga0335084_104387131 | 3300033004 | Soil | GDVVVREQRASADPALDTIHPGDRIALSWDETSPLLLGEIAQTTTDGEQEES |
| Ga0310811_102902623 | 3300033475 | Soil | RASADPALDTIHPGDRIALSWDESSPLLLGEAAPATTDGEQEES |
| Ga0373950_0084997_2_151 | 3300034818 | Rhizosphere Soil | VVREQRASADPALDTIHPGDRIALSWDESSPLLLGEAVPATTDGEQEES |
| ⦗Top⦘ |