NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F051951

Metagenome / Metatranscriptome Family F051951

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051951
Family Type Metagenome / Metatranscriptome
Number of Sequences 143
Average Sequence Length 116 residues
Representative Sequence MFKVALLLASASAIRLTSDPICNSAGCTQYKHPDSKEAKYDMDYFVPHFGMDRDIQGSLENLHVAEGIVKHHWVGIDKDKYANPAKKVDYNFAPKLDGDIIDSQANLAATEKRLDHTYEL
Number of Associated Samples 89
Number of Associated Scaffolds 143

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.71 %
% of genes near scaffold ends (potentially truncated) 69.23 %
% of genes from short scaffolds (< 2000 bps) 98.60 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (90.210 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(30.769 % of family members)
Environment Ontology (ENVO) Unclassified
(55.944 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(81.119 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 39.19%    β-sheet: 0.00%    Coil/Unstructured: 60.81%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.91 %
UnclassifiedrootN/A9.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006384|Ga0075516_1319615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300006397|Ga0075488_1614113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1163Open in IMG/M
3300007236|Ga0075463_10266427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300007513|Ga0105019_1136428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1290Open in IMG/M
3300007513|Ga0105019_1205307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium966Open in IMG/M
3300007513|Ga0105019_1224065All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium899Open in IMG/M
3300009436|Ga0115008_10457017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium909Open in IMG/M
3300009436|Ga0115008_10776989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300009441|Ga0115007_10359152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium950Open in IMG/M
3300009593|Ga0115011_11373709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300009593|Ga0115011_11716128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300009599|Ga0115103_1569896Not Available565Open in IMG/M
3300009606|Ga0115102_10210873Not Available573Open in IMG/M
3300009606|Ga0115102_10815369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300009677|Ga0115104_10030749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300010981|Ga0138316_11241080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300010981|Ga0138316_11510809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium563Open in IMG/M
3300010985|Ga0138326_10843207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300010987|Ga0138324_10631772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300010987|Ga0138324_10656080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300012952|Ga0163180_10870033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium711Open in IMG/M
3300012952|Ga0163180_11622166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300012953|Ga0163179_10906381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium763Open in IMG/M
3300018628|Ga0193355_1015747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300018628|Ga0193355_1028076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300018779|Ga0193149_1052574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium580Open in IMG/M
3300018796|Ga0193117_1070142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300018871|Ga0192978_1015845All Organisms → Viruses → Predicted Viral1342Open in IMG/M
3300018871|Ga0192978_1070997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300018928|Ga0193260_10085274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium684Open in IMG/M
3300018974|Ga0192873_10360516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300018974|Ga0192873_10444100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300018980|Ga0192961_10167713Not Available666Open in IMG/M
3300018982|Ga0192947_10189953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium678Open in IMG/M
3300018982|Ga0192947_10274050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300018988|Ga0193275_10298375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300018989|Ga0193030_10196770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum663Open in IMG/M
3300018989|Ga0193030_10211648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum638Open in IMG/M
3300018989|Ga0193030_10228895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300018989|Ga0193030_10281466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300018989|Ga0193030_10287609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300018989|Ga0193030_10288990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300018989|Ga0193030_10293901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300018989|Ga0193030_10302683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300019027|Ga0192909_10188827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium606Open in IMG/M
3300019027|Ga0192909_10263723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300019027|Ga0192909_10267345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300019031|Ga0193516_10262399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300019031|Ga0193516_10269752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300019032|Ga0192869_10415501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300019032|Ga0192869_10496481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300019033|Ga0193037_10300650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300019045|Ga0193336_10445124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300019048|Ga0192981_10173022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium850Open in IMG/M
3300019048|Ga0192981_10197776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium785Open in IMG/M
3300019048|Ga0192981_10241879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300019123|Ga0192980_1070127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300019123|Ga0192980_1081660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300019133|Ga0193089_1115147Not Available621Open in IMG/M
3300019149|Ga0188870_10036204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1168Open in IMG/M
3300019149|Ga0188870_10125012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300019149|Ga0188870_10160123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300021345|Ga0206688_10412317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum643Open in IMG/M
3300021348|Ga0206695_1414079Not Available596Open in IMG/M
3300021348|Ga0206695_1746584Not Available612Open in IMG/M
3300021355|Ga0206690_10067139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300021355|Ga0206690_10155158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum953Open in IMG/M
3300021866|Ga0063109_101776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300021866|Ga0063109_109193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum603Open in IMG/M
3300021872|Ga0063132_106125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300021872|Ga0063132_110978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium568Open in IMG/M
3300021885|Ga0063125_1011178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300021902|Ga0063086_1001534Not Available623Open in IMG/M
3300021924|Ga0063085_1006799Not Available632Open in IMG/M
3300021928|Ga0063134_1046751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300021957|Ga0222717_10579477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300023674|Ga0228697_131100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300023701|Ga0228685_1051148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300026420|Ga0247581_1070977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300026437|Ga0247577_1121950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300026447|Ga0247607_1074915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300026447|Ga0247607_1087324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300026458|Ga0247578_1099252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium572Open in IMG/M
3300026466|Ga0247598_1130023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300026495|Ga0247571_1107207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300026495|Ga0247571_1149220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300026500|Ga0247592_1118035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300026500|Ga0247592_1132867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium595Open in IMG/M
3300026503|Ga0247605_1145102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300026504|Ga0247587_1140414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300027810|Ga0209302_10202401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium950Open in IMG/M
3300027833|Ga0209092_10503196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300028106|Ga0247596_1109444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum626Open in IMG/M
3300028109|Ga0247582_1169676Not Available557Open in IMG/M
3300028110|Ga0247584_1132529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300028134|Ga0256411_1088594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1058Open in IMG/M
3300028134|Ga0256411_1208364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300028134|Ga0256411_1277817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300028137|Ga0256412_1290562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium602Open in IMG/M
3300028137|Ga0256412_1351077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300028137|Ga0256412_1364836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300028137|Ga0256412_1402399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300028233|Ga0256417_1115245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium723Open in IMG/M
3300028282|Ga0256413_1078263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1183Open in IMG/M
3300028282|Ga0256413_1232751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium657Open in IMG/M
3300028282|Ga0256413_1279432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300028282|Ga0256413_1291038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300028282|Ga0256413_1293050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300028282|Ga0256413_1295740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300028282|Ga0256413_1370207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300028290|Ga0247572_1181920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300028290|Ga0247572_1195525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300028290|Ga0247572_1198860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300028575|Ga0304731_11342395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium563Open in IMG/M
3300030670|Ga0307401_10369054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300030699|Ga0307398_10688726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum567Open in IMG/M
3300030722|Ga0308137_1081844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300030780|Ga0073988_12000100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300030857|Ga0073981_11641813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300031037|Ga0073979_12008490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300031038|Ga0073986_12006327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300031579|Ga0308134_1145090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300031580|Ga0308132_1106843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300031710|Ga0307386_10126212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1160Open in IMG/M
3300031710|Ga0307386_10624785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium572Open in IMG/M
3300031729|Ga0307391_10799179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300031734|Ga0307397_10524423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300031738|Ga0307384_10150964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum997Open in IMG/M
3300031738|Ga0307384_10622925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300031738|Ga0307384_10626298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300031738|Ga0307384_10626619Not Available517Open in IMG/M
3300031739|Ga0307383_10629059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300031739|Ga0307383_10657618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300031742|Ga0307395_10367567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300031750|Ga0307389_11114599Not Available526Open in IMG/M
3300031752|Ga0307404_10345418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300032540|Ga0314682_10617737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300032724|Ga0314695_1320396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum592Open in IMG/M
3300032751|Ga0314694_10516388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300032752|Ga0314700_10746323All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300033572|Ga0307390_10776311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine30.77%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine27.97%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater24.48%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater6.99%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.80%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.10%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.10%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.10%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.70%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021866Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021885Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-19 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300023674Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 90R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023701Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 47R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026437Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 34R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030722Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0075516_131961513300006384AqueousVALIATASAIRITSDPICNSAGCTQYKHPDSKEAKYDMNYFVPSFGMDRDIQGSLENLHVAEGIVKHHWVGIDKDKYANPAKKVDYNFAPKLDGDIIDSQNNLQATEKRLEHTYELS*
Ga0075488_161411313300006397AqueousLESDPICNSAGCTQYKHPDSKEAKYDMDYPVPHFGMDRDIMGSLENLKVAEGVTGHHWAGIDKDKYSNPAKKVDYNFDPRLDGDIIDSHANLASTEKRLEHTYSLA*
Ga0075463_1026642713300007236AqueousDSENTEGSDVMLYSDPICNSAGCTQYKHPDSKEAKYDMDYPVPHFGMDRDIMGSLENLKVAEGVTGHHWAGIDKDKYSNPAKKVDYNFDPRLDGDIIDSHANLASTEKRLEHTYSLA*
Ga0105019_113642813300007513MarineLQVASDPICSSAGCGQYKHPDSTTATWPMDYGVPSFGMDRDIMGSLDNLKVAEGVVGHKWAGIDKEKYSNPAKKTMYNFAPGLDGDIKDS*
Ga0105019_120530713300007513MarineMFKLTLLVASASAIKIRSDPICSSAGCDQYKHPDSTTATWPMDYGVPSFGMDRDISNGLENLAVAEGIVKHHWVGIDKEKYKNPAKKVMYNFAPKLDGDIIDSKANLAATEKVLDHEYALS*
Ga0105019_122406513300007513MarineMLKLVLLIASAQSIKISSDPICSSAGCTQYKHPDSKEASYPMDYGVANFGMDRDIQGNFENLHVAEKIVGHHWVGIDKDKYANPAKKVLYNFNPKLDGDIIDAEKNLKDTEKKLEHTYELS*
Ga0115008_1045701713300009436MarineMFKLVLLAASASAIKISSDPICNSAGCTQYKHPESKESNYPMDYGVPSFGMDRDIQGSLENLHIAEGIVKHHWEGIDKSKYANPAKKVLYNFDMPLDG*
Ga0115008_1077698913300009436MarineMFKLVLLVASASAIKISSDPICNSAGCTQYKHPASTEASYPMDYGVPHFGMDRDIQGSLENLKVAEGIVKHTWVSIDKAKYSNPAKSVMYNFAAPLDGDIIDSQKNLAATEKALEHTYELS*
Ga0115007_1035915213300009441MarineMLKLVLLVASAQAIKIKSDPICNSAGCTQYLHPESKEVSYPMDYGVANFGMDRDIQGNFENLGIAEAIVGHHWVGIDKDKYANPAKKVLYNFEPKLDGDIIDA*
Ga0115011_1137370913300009593MarineASEDGKGSFSFVQTGAEIKLESDPICSSAGCDQYKHPERKDDWDRNYFVPHFGMDRVMQDNFEDLAMAEKIVGHHWVGIDKDKYSNPARDVDYNFAPKLDSDIIDAQKNQVLAEKQLDHVYELD*
Ga0115011_1171612823300009593MarineDRIYLQMESDPICNSAGCTQYLHPESKDTLKDDQLNYKVPHFGMDRDIQGSLENLHVAEGIVKHHWVGIDKDKYANPAKKVDYNFAPKLDGDIIDSQANLAATEKRLDHEYELS*
Ga0115103_156989613300009599MarineSASAIKITSDPIGSSIGNTQYKHPESKEAKYPMDYGVPHFGMDRDIQGSLENLSVAQNIVGHKWASIDGAKYANPAKAVDYQFAPKLDEDIVTSHANLAATEKRLDHTYQLS*
Ga0115102_1021087313300009606MarinePIGSSIGNTQYKHPESKEAKYPMDYGVPHFGMDRDIQGSLENLSVAQNIVGHKWASIDGAKYANPAKAVDYQFAPKLDEDIVTSHANLAATEKRLDHTYQLS*
Ga0115102_1081536913300009606MarineYNNNQQNIMFKVIALAASASAIRITSDPICNSAGCTQYKHPDSKEAKYDMDYPVPHFGMDRDVMGSLENLKVAEGVVGHHWAGIDKDKYSNPAKKVDYNFAPHLDGDIIDSQANLGATEKKLEHVYSLA*
Ga0115104_1003074913300009677MarineNKITMFIKLLLVASASAIRLSSDPICNSAGCTQYKHPDSKEAKYDMDYPVPHFGMDRDIQGSLENLAVAQKVVGHNWVGIDKDKYANPAKKVDYNFAPKLDGDIVDSQSHLAATEKKLDHTYQLS*
Ga0138316_1124108013300010981MarineSASAIKITSDPICSSAGCDQYKHPDSKEASYPMDYGVPNFGMDRDIQGNFENLGVAEKIVGHHWVGIDKDKYSNPAKKVMYNFAPKLDGDIIDSQKNLKDTEKKLEHTYELA*
Ga0138316_1151080913300010981MarineVALLLASASAIRLTSDPICNSAGCTQYKHPDSKEAKYDMDYFVPHFGMDRDIQGSLENLHVAEGIVKHHWAGIPKDKYANPARKVMYNFAPKLDGDIVDSQAHLASTEQKLDHTYQLS*
Ga0138326_1084320713300010985MarineFKLVALAASASAIRLTSDPICSSSGCDQYKHPDSKEAKYDMDYPVASFGMDRDVQGSLENLKVAEGVVGHHWAGIDKDKYANPARKVNYNFAPELDGDIKDSKKNLADTEKVLDHTYELS
Ga0138324_1063177213300010987MarineFALLLVSASAIKITSDPICSSAGCDQYKHPDSKEASYPMDYGVPNFGMDRDIQGNFENLGVAEKIVGHHWVGIDKDKYSNPAKKVMYNFAPKLDGDIIDSQKNLKDTEKKLEHTYELA*
Ga0138324_1065608013300010987MarineLTSDPICNSAGCTQYKHPDSKEAKYDMDYFVPHFGMDRDIQGSLENLHVAEGIVKHHWAGIPKDKYANPARKVMYNFAPKLDGDIVDSQAHLASTEQKLDHTYQLS*
Ga0163180_1087003313300012952SeawaterMYKLVILAASASALRLTSDPICNSAGCTQYKHPDSKEAKYDMDYGVPSFGMDRDVMGSLENLKVAEGVVGHHWVGIDKDKYSNPAKKVDYNFAPKLDGDIIDSHANLAATEKKLDHAYELS*
Ga0163180_1162216613300012952SeawaterASAIRLYSDPICNSAGCTQYKHPDSKEAKYDMDYFVPHFGMDRDIQGSLENLHVAEGIVKHHWVGIDKDKYANPAKKVDYNFAPKLDGDIIDSQANLAATEKRLDHTYELS*
Ga0163179_1090638113300012953SeawaterLDSDPICDSSGCNQYKHPESKEAKYPMDYDVASFGMDRDVMGSLENLKVAEGVVNHQWKGIDKDKYSNPAKKVDYNFAPRLDGDIIDSQNHLSSTEKRLDHTY*
Ga0193355_101574713300018628MarineMFKIALIASVSAIKITSDPICSSAGCGQYKHPDSKAATWPMDYGVPNFGMDRDIQGSLENLGVAEGIVKHHWAGIDKDKYANPAKKVMYNFAPHLDGDIVDSQANLGATEQKLDHTYQLS
Ga0193355_102807613300018628MarineSSGCTQYLHPDSKEISYPMDYGVPNFGMDRDIQNGLVNLQAAEGIVGHHWVGIDKEKWANPAKKVMYNFAPKLDGDIIDSKANLAATEKVLDHTYELS
Ga0193149_105257413300018779MarineSVSAIKITSDPICSSAGCGQYKHPDSTAATWPMDYGVPSFGMDRDIQGSLENLNVAEGIVKHHWAGIPKDKYANPARKVMYNFAPKLDGDIVDSQAHLASTEQKLDHTYQLS
Ga0193117_107014213300018796MarineSASAIKITSDPICSSAGCDQYKHPDSKEASYPMDYGVPNFGMDRDIQGNFENLGVAEKIVGHHWVGIDKDKYSNPAKKVMYNFAPKLDGDIIDSQKNLKDTEKKLEHTYELA
Ga0192978_101584523300018871MarineVLNFFLLAVADAAAAHLFFDSGLVLLIASATAIKVTSDPICNSAGCTQYKHPASKDSSYPMDYGVPDFGMDRNIQDNFENLKIAEGIVGHHWVGIDKEKWANAAKKTLYNYDMKLDGDIIDSQKNLAATEKKLGMTYTLAXNLS
Ga0192978_107099713300018871MarineMFKILLIASAAAIKIMDDPICSSAGCGQYKHPDSKVAVHPMDYGVPSFGMDRDIMGSLENLKVAEGIVKHSWKGIDAAKYANPAKKVMYNFAPALDGDIIASHANLAATEKKLDHEYALSXAVXPSYAVNLKPXMIK
Ga0193260_1008527413300018928MarineMFKIALIASVSAIKITSDPICSSAGCGQYKHPDSKAATWPMDYGVPSFGMDRDIQGSLENLGVAEGIVKHHWAGIDKDKYANPAKKVMYNFAPHLDGDIVDSQANLGATEQKLDHTYQLS
Ga0192873_1036051613300018974MarineMGNYQSQTYNKMFKALLVASAAAIKITSDPICSSAGCGQYKHPKSAVADWPKDYGVPSFGMDRDIMGSLQNLNVAEGIVKHQWKGIDKEKYHNPAKKVMYNFAPNLDGDIIDSKANLAATEKVLDHTYQLS
Ga0192873_1044410013300018974MarineDPICSSAGCDQYKHPDSKEVSYPQDYGVPHFGMDRDIMGSLDNLATAEGVVGHHWVGIDKEKWANPAKKVMYNFAPKLDGDIVDSHANLSATEKKLDHAYQLS
Ga0192961_1016771313300018980MarineGELELIKYNNLNNIMFKVALLVASASAIKITSDPIGSSIGNTQYKHPESKEAKYPMDYGVPHFGMDRDIQGSLENLSVAQNIVGHKWASIDGAKYANPAKAVDYQFAPKLDEDIVTSHANLAATEKRLDHTYQLS
Ga0192947_1018995313300018982MarineMFIKLLLVASASAIRLSSDPICSSSGCTQYKHPDSKEAKYDMDYAVPSFGMDRDVTGSLENLKVAEGVVGHHWVGIDKAKYANPAKAVDYNFAPKLDGDIIDSHANLAATEKKLDHTYEL
Ga0192947_1027405013300018982MarineMFKVALLVASASAIRLTSDPICNSAGCTQYKHPDSKEAKYDMDYFVPHFGMDRDIQGSLENLRVAEGIVKHHWVGIDKDKYANPAKKVDYNFAPKLDGDIIDSQKNLVDTEKRLSHEYEL
Ga0193275_1029837513300018988MarineHGDNYQSQTNKIMFKALLVASVAAIKITSDPICNSSGCTQYKHPESTAASWPKDYGVPNFGMDRDIMGSLQNLKVAEGVVKHQWKGIDKEKYSNPAKKVMYNFAPNLDGDIIDSKNNLAATEKVLDHTINSHEQFYLLSE
Ga0193030_1019677013300018989MarineAKLGHQYQLLQMQSDPICASSGCDQYKHPDSKAATWPMDYGVPSFGMDRDVSNSLGNLAVAEKIVGNHWTWEGAKYKNPAKKVNYNFAMKLDGDIIDSQKNLAATEASMSHTYTI
Ga0193030_1021164813300018989MarineMFKLLLVASASAIKITSDPICSSAGCTQYKHPDSKEASYPMDYGVAHFGMDRDIQGNFEDLDVAEKIVGHHWVGIDKKKYANPAKKVMYNFAPALDGDIVDSQKNLLDTEKKLDHTYELS
Ga0193030_1022889513300018989MarineMFKIALIASVSAIKITSDPICSSAGCGQYKHPDSTTATWPMDYGVPSFGMDRDIQGSLENLNVAEGIVKHHWAGINKDKYANPARKVMYNFAPKLDGDIVDSQAHLASTEQKLDHTYQLS
Ga0193030_1028146613300018989MarineHGEYFKIMFKLLLVAQVAAIKITSDPICSSAGCDQYKHPDSKVADWDRDYPVPHFGMDREIMGSLDNMKVAEGIVGHTWKGIDKDEHANPAKKVDYNFAPHLDGDIIDSHNNLSATEKKLSHTYQLS
Ga0193030_1028760913300018989MarineMGNNQQNIMFKLVLLAASSQAIRITSDPICSSSGCSQYKHPDSKEAKYDMDYAVPHFGMDRDVMGSLENLKVAEGVVGHHWAGIDKDKYSNPAKKVDYNFAPKLDGDIIDSHANLAATEKKLDHTYSLA
Ga0193030_1028899013300018989MarineHGNNQQNIMFKIVLLAATASAIRLVSDPICSSSGCDQYKHPDSKEAKYPMDYGVPSFGMDRDVQGSLENLKVAEGVTGHHWAGIDKDKYSNPAKKVDYNFAPALDGDIITPKANLSATEKKLDHEYQLS
Ga0193030_1029390113300018989MarineNLADTETKMKHKYELLQLESDPICSSAGCTQYKHPDSKVATWPMDYGVPHFGMDRDIQGSFENLKVAEGIVNHHWAGIDKDKYANPAKKTMYNFAPKLDGDIIDSQGNLAATEKKLEHTYELS
Ga0193030_1030268313300018989MarineMFKVALLVASASAIRLTSDPICNSAGCTQYKHPDSKEAKYDMNYFVPSFGMDRDIQGSLENLRVAEGIVKHVWKGIDKDKYANPARKVDYNFAPKLDGDIVDSQKNLADTEKRLDHTYEL
Ga0192909_1018882713300019027MarineMGNLLINNTMYKILLLVASVSAIKIKSDPICNSSRCTQYLHPDSKEISYPMDYGVPNFGMDRDIQNGLVNLQAAEGIVGHHWVGIDKEKWANPAKKVMYNFAPKLDGDIIDSKANLAATEKVLDHTYELS
Ga0192909_1026372313300019027MarineMFKVALLLASATAIKITSDPICNSAGCTQYKHPDSKEAKYDMDYFVPHFGMDRDIQGSLENLHVAEGIVKHHWVGIDKEKYANPARKVDYNFDPKLDGDIIDSQKNLKDTEKRLEHTYEL
Ga0192909_1026734513300019027MarineHGYKINVQVCSSSCISLCYQISFRPXXXXNSAGCTQYLHPDSKEAKYDMDYFVPHFGMDRDIQGSLENLHVAEGIVKHHWVGIDKDKYANPAKKVDYNFAPKLDGDIIDSQSNLAATEKRLDHTYELS
Ga0193516_1026239913300019031MarineMFKYALLLISAQAIKIKSDPICSSAGCNQYKHPDSKEAAYPMDYGVPNFGMDRDIQGSFEDLAVAEKIVGHRWKGIDKDKWKNPAKKVLYNFEPKLDGDIIDSQKNLADTEKKLDHVYELAXKP
Ga0193516_1026975213300019031MarineRMKSDPICSSAGCNQYKHPDSKEASYPMDYGVPNFGMDRDIQGNFENLDVAEKIVGHHWVGIDKDKYANPAKKVMYNFAPKLDGDIIDAQKNLADTEKKLEHTYELAXKTHHPN
Ga0192869_1041550113300019032MarineMFKTLILAASASAIRITSDPICSSSGCSQYKHPDSKEAKYPMDYGVPHFGMDRDIMGSLENLKVAEGVTGHHWAGIDKAKYSNPAKKVDYNFAPNLDGDIIDSQAHLAATEKKLDHEYKL
Ga0192869_1049648113300019032MarineMFKVALLLASASAIRLTSDPICNSAGCTQYKHPDSKEAKYDMDYFVPHFGMDRDIQGSLENLHVAEGIVKHHWVGIDKDKYANPAKKVDYNFAPKLDGDIIDSQANLAATEKRLDHTYEL
Ga0193037_1030065013300019033MarineAAAIRLTSDPICSSAGCSQYKHPASTTADHPKDYGVPHFGMDRDIMGSLDNLAVAEGIVKHTWKGIDKAKYSNPAKKVMYNFAPKLDGDIIDSKANLAATEKVLDH
Ga0193336_1044512413300019045MarineSDPICSSAGCDQYKHPDSKEEDWKMNYPVPHFGMDRDIQAGFENLKVAEGIVGQKFSYDFSGDKYKNPAKKVDYNFAPELDQNIRDSQANLAATEKKLDHTYTLXNKQHKHXMINNK
Ga0192981_1017302223300019048MarineMVTSLSNLSNVEKDKGVWDIAAVQLSSDPICSSAGCGQYKHPDSKVATYPMDYGVPNFGMDREVQGTFEDLAVAEGIVKHHWAGIDKDKYSNPAKKVMYNFAPKLDGDIVDSQANLGATEKKLDHTYALA
Ga0192981_1019777613300019048MarineMFKILLIASAAAIKIRDDPICSSAGCGQYKHPDSKVAVHPMDYGVPSFGMDRDIMGSLENLKVAEGIVKHSWKGIDAAKYANPAKKVMYNFAPALDGDIIASHANLAATEKKLDHEYALS
Ga0192981_1024187923300019048MarineMFKLVLLIASATAIKVTSDPICNSAGCTQYKHPASKDSSYPMDYGVPDFGMDRNIQDNFENLKIAEGIVGHHWVGIDKEKWANAAKKTLYNYDMKLDGDIIDSQKNLAATEKKLGMTYSLAXNLS
Ga0192980_107012713300019123MarineMYKLVLLLASATAIKVTSDPICNSAGCTQYKHPASKDSSYPMDYGVPDFGMDRNIQDNFENLKIAEGIVGHHWVGIDKEKWANAAKKTLYNYDMKLDGDIIDSQKNLAATEKKLGMTYSL
Ga0192980_108166013300019123MarineDDPICSSAGCGQYKHPDSKVAVHPMDYGVPSFGMDRDIMGSLENLKVAEGIVKHSWKGIDAAKYANPAKKVMYNFAPALDGDIIASHANLAATEKKLDHEYALS
Ga0193089_111514713300019133MarineMGLIKYNNLNNIMFKVALLVASASAIKITSDPIGSSIGNTQYKHPESKEAKYPMDYGVPHFGMDRDIQGSLENLSVAQNIVGHKWASIDGAKYANPAKAVDYQFAPKLDEDIVTSHANLAATEKRLDHTYQLS
Ga0188870_1003620413300019149Freshwater LakeLESDPICNSAGCTQYKHPDSKEAKYDMDYAVPHFGMDRDIMGSLENLKVAEGVTGHHWAGIDKDKYSNPAKKVDYNFDPRLDGDIVDSHANLAATEKRLEHTYSLA
Ga0188870_1012501213300019149Freshwater LakeNIMFKVIALAASASAIRITSDPICNSAGCTQYKHPDSKEAKYDMDYYVPHFGMDRDVQGSLENLKVAEGVVGHHWAGIDKDKYANPAKKVDYNFAPRLDGDIIDSQANLGATEKRLEHTYSLA
Ga0188870_1016012313300019149Freshwater LakeLESDPICNSAGCTQYKHPDSKEAKYDMDYPVPHFGMDRDVQGSLENLKVAEGVVGHHWAGIDKDRYSNPAKKVDYNFAPRLDGDIIDSQAHLSATEAKLEHTYNLA
Ga0206688_1022459623300021345SeawaterSDPICASSGCDQYKHPDSKKEDWDMDYPVPHFGMDRDIQGGLINMGAAEKIVGHTWKGIDKDKYSNPAKKVDYNFAPALDAQIVDS
Ga0206688_1041231713300021345SeawaterMQLNSDPICSSAGCDQYKHPDSKDETWDMNYPVPHFGMDRDIQGGLINLGEAEKIVKHHWAGIDKDKYANPAKKVDYNFAPPLDGDIIDSQSNLGATEKKMDHTYQL
Ga0206695_141407913300021348SeawaterSSAGCDQYKHPDSKHEEWDMNYPVPHFGMDRGIQDGLINLSVAEGIVGHHWAGIDKDKYSNPTTKVDYKFAPALDGDIIDSKANLAATEKLLEHTYSL
Ga0206695_174658413300021348SeawaterYNNLNNIMFKVALLVASASAIKITSDPIGSSIGNTQYKHPESKEAKYPMDYGVPHFGMDRDIQGSLENLSVAQNIVGHKWASIDAAKFAKPTVAIEDQFAPKLDEDIVTSHANLAATEKRLDHTYELS
Ga0206690_1006713913300021355SeawaterFKIALLVASASAIKISSDPICSSAGCGQYKHPDSKVATWPMDYGVPNFGMDRDIQGSLENLAVAEGITNHHWAGIDKDKYANPAKKVMYNFAPHLDGDIVDSQAHLKATETKLDHTYALS
Ga0206690_1015515823300021355SeawaterLSDTETTLKHKYQLLQLAAESDPICSSAGCGQYKHPDSKVATWPMDYGVPSFGMDRDIQGSLENLAVAEGITNHHWGGIDKDKYSNPAKKVMYNFAPRLDGDIVDSQAHLKATETKLDHTYKLS
Ga0206689_1017091413300021359SeawaterLDHKYELLQLNSDPICASSGCDQYKHPDSKEESWDMNYPVPHYGMDRDIQGGLQNLAAAEAIVKHHWAGIDKDKYSNPAKKVDYNFAPALDS
Ga0063109_10177613300021866MarineFALLLVSASAIKITSDPICSSAGCDQYKHPDSKEASYPMDYGVPNFGMDRDIQGNFENLGVAEKIVGHHWVGIDKDKYSNPAKKVMYNFAPKLDGDIIDSQKNLKDTEKKLEHTYELA
Ga0063109_10919313300021866MarineLGNLAAVEKAKGELNLVQIQSDPICDSSGCNQYKHPDSKEATWPMDYGVPSFGMDRDVQGSFENLKVAEGIVGHHWAGIDKDKYSNPAKKVMYNFAPILDGDIRDSQKNLGDTEKRLKKTYELS
Ga0063132_10612513300021872MarineNMYKIATLLVAAQAIKISSDPICSSAGCDQYKHPDSKEVSYPQDYGVPHFGMDRDIMGSLDNLATAEGVVGHHWVGIDKEKWANPAKKVMYNFAPKLDGDIVDSHANLSATEKKLDHAYQLS
Ga0063132_11097813300021872MarineFKVILIATASAIKITSDPICSSAGCDQYKHPDSKEISYPMDYGVPNFGMDRDIQNGLVNLQAAEGIVGHHWVGIDKEKWANPAKKVMYNFAPKLDGDIIDSKANLAATEKVLDHTYELA
Ga0063125_101117813300021885MarineQNIMFKVALLVASASAIRIASDPICSSSGCSQYKHPDSKEAKYPMDYGVPNFGMDRDVQGSLENLKVAEGVVGHSWAGIDKAKYSNPAKKVDYNFAPKLDGDIIDSHANLAATEKRLDHT
Ga0063086_100153413300021902MarineLNNIMFKVALLVASASAIKITSDPIGSSIGNTQYKHPESKEAKYPMDYGVPHFGMDRDIQGSLENLSVAQNIVGHKWASIDGAKYANPAKAVNYQFAPKLDEDIVTSHANLAATEKRLDHTYQLS
Ga0063085_100679913300021924MarineMFKVALLVASASAIKITSDPIGSSIGNTQYKHPESKEAKYPMDYGVPHFGMDRDIQGSLENLSVAQNIVGHKWASIDGAKYANPAKAVNYQFAPKLDEDIVTSHANLAATEKRLDHTYQL
Ga0063134_104675113300021928MarineIMFKFALLLVSASAIKITSDPICSSAGCDQYKHPDSKEASYPMDYGVPNFGMDRDIQGNFENLGVAEKIVGHHWVGIDKDKYSNPAKKVMYNFAPKLDGDIIDSQKNLKDTEKKLEHTYELA
Ga0222717_1057947713300021957Estuarine WaterMFKVALIATASAIRITSDPICNSAGCTQYKHPDSKEAKYDMDYPVPHFGMDRDVQGSLENLKVAEGVVGHHWAGIDKDKYSNPAKKVDYNFAPRLDGDIIDSQAHLSATEAKLEHTYNLA
Ga0228697_13110013300023674SeawaterLVASASAIRISSDPICNSAGCTQYKHPDSKEAKYPMDYGVASFGMDRDVMGSLENLKVAEGVVGHHWAGIDKAKYANPAKKVDYNFAPRLDGDIIDSQAHLAATEKKLDHEYALA
Ga0228685_105114813300023701SeawaterFVKLLLVASASAIRISSDPICNSAGCTQYKHPDSKEAKYPMDYGVASFGMDRDVMGSLENLKVAEGVVGHHWAGIDKAKYANPAKKVDYNFAPRLDGDIIDSQAHLAATEKKLDHEYALA
Ga0247581_107097713300026420SeawaterLIATASAIRITSDPICSSAGCDQYKHPDSKEISYPMDYGVPNFGMDRDIQNGLVNLQAAEGIVGHHWVGIDKEKWANPAKKVMYNFAPKLDGDIIDSKANLAATEKVLDHTYELS
Ga0247577_112195013300026437SeawaterLAAYTSAIRLASDPICSSSGCDQYKHPESKEAKYDMDYPVPHFGMDRDVQGSLENLKVAEGVVGHHWVGIDKDKYANPAKKVDYNFAPRLDGDIIDAQAHLAATEKRLEHTYQLS
Ga0247607_107491513300026447SeawaterGNQQNKMFKLVLLAASASAIRITSDPICSSAGCSQYKHPESKEAKYDMDYGVPHFGMDRDVMGSLENLKVAEGVVGHHWVGIDKDKYSNPAKKVDYNFAPRLDGDIIDSHNNLAATEKRLDHTYSLA
Ga0247607_108732413300026447SeawaterIATASAIRITSDPICSSAGCDQYKHPDSKEISYPMDYGVPNFGMDRDIQNGLVNLQAAEGIVGHHWVGIDKEKWANPAKKVMYNFAPKLDGDIIDSKANLAATEKVLDHTYELS
Ga0247578_109925213300026458SeawaterLVLLAASASAIRITSDPICSSAGCSQYKHPESKEAKYDMDYGVPHFGMDRDVMGSLENLKVAEGVVGHHWVGIDKDKYSNPAKKVDYNFAPRLDGDIIDSHNNLAATEKRLDHTYSLA
Ga0247598_113002313300026466SeawaterKVALVVASASAIKIYSDPICNSAGCTQYKHPDSKEAKYPMDYGVASFGMDRDVMGSLENLKVAEGVVGHHWAGIDKAKYANPAKKVDYNFAPRLDGDIIDSQAHLAATEKKLDHEYALA
Ga0247571_110720713300026495SeawaterSSDPVCNSAGFTQYTHPDSKEAKYLLDYGVASFGMDRDVMGSLENLKVAEGVVGHHWAGIDKAKYANPAKKVDYNFAPRLDGDIIDSQAHLAATEKKLDHEYALA
Ga0247571_114922013300026495SeawaterGKPDQQLIQLEIESDPICNSAGCTQYKHPDSKEAVYPMDFPVPHFGMDRDIQGSLENLSVAEGVVGHHWAGIDKKKYANPARAVDYNFAAGLVGDIIDS
Ga0247592_111803513300026500SeawaterIATASAIRISSDPICSSSGCSQYKHPESKEAKYDMDYAVPHFGMDRDIQGSLENLAVAQNIVKHQWVGIDKDKYSNPAKKVNYNFAPKLDGDIIDSQAHLASTEKRLDHTYELA
Ga0247592_113286713300026500SeawaterFKVALVVASASAIKIYSDPICNSAGCTQYKHPDSKEAKYDMDYFVPHFGMDRDIQGSLENLHVAEGIVKHHWVGIDKDKYANPAKKVDYNFAPRLDGDIIDSQAHLAATEKKLDHEYALA
Ga0247605_114510213300026503SeawaterKALLIATASAIRISSDPICSSSGCSQYKHPESKEAKYDMDYAVPHFGMDRDIQGSLENLAVAQNIVKHQWVGIDKDKYSNPAKKVNYNFAPKLDGDIIDSQAHLASTEKRLDHTYELA
Ga0247587_114041413300026504SeawaterNPLNIMFVKLLLVASASAIRISSDPICNSAGCTQYKHPDSKEAKYPMDYGVASFGMDRDVMGSLENLKVAEGVVGHHWAGIDKAKYANPAKKVDYNFAPRLDGDIIDSQAHLAATEKKLDHEYALA
Ga0209302_1020240113300027810MarineMLKLVLLVASAQAIKIKSDPICNSAGCTQYLHPESKEVSYPMDYGVANFGMDRDIQGNFENLGIAEAIVGHHWVGIDKDKYANPAKKVLYNFEPKLDGDIIDA
Ga0209092_1050319613300027833MarineFIFIKINNYIIIINNMFKLVLLVASASAIKISSDPICNSAGCTQYKHPASTEASYPMDYGVPHFGMDRDIQGSLENLKVAEGIVKHTWVSIDKAKYSNPAKSVMYNFAAPLDGDIIDSQKNLAATEKALEHTYELS
Ga0247596_110944413300028106SeawaterASAIRISSDPICNSAGCTQYKHPDSKEAKYPMDYGVASFGMDRDVMGSLENLKVAEGVVGHHWAGIDKAKYANPAKKVDYNFAPRLDGDIIDSQAHLAATEKKLDHEYALA
Ga0247582_116967613300028109SeawaterCSQYKHPESKEAKYDMDYAVPHFGMDRDIQGSLENLAVAQNIVKHQWVGIDKDKYSNPAKKVNYNFAPKLDGDIIDSQAHLASTEKRLDHTYELA
Ga0247584_113252913300028110SeawaterKLLLVASASAIRISSDPICNSAGCTQYKHPDSKEAKYPMDYGVASFGMDRDVMGSLENLKVAEGVVGHHWAGIDKAKYANPAKKVDYNFAPRLDGDIIDSQAHLAATEKKLDHEYALA
Ga0256411_108859423300028134SeawaterLESDPICNSAGCTQYKHPDSKEAKYDMDYAVPHFGMDRDIMGSLENLKVAEGVVGHSWAGIDKKKYANPAKKVDYNFAPRLDADIVDS
Ga0256411_120836413300028134SeawaterVKLLLVASASAIRISSDPICNSAGCTEYKHPDSKEAKYPMDYGVASFGMDRDVMGSLENLKVAEGVVGHHWAGIDKAKYANPAKKVDYNFAPRLDGDIIDSQAHLAATEKKLDHEYALA
Ga0256411_127781713300028134SeawaterMFKVALVVASASAIKIYSDPICNSAGCTQYKHPDSKEAKYDMDYFVPHFGMDRDIQGSLENLHVAEGIVKHHWVGIDKDKYANPAKKVDYNFDPKLDGDIIDSQKNLVDTEKRLEHTYEL
Ga0256412_129056213300028137SeawaterLLVASASAIKIKSDPICNSSGCTQYLHPDSKEISYPMDYGVPNFGMDRDIQNGLVNLQAAEGIVGHHWVGIDKEKWANPAKKVMYNFAPKLDGDIIDSKANLAATEKVLDHTYELS
Ga0256412_135107713300028137SeawaterVASASAIRLASDPICSSSGCTQYKHPDSKEAKYDMDYPVPHFGMDRDIQGSLENLHVAEGIVKHHWVGIDKDKYANPAKKVDYNFAPRLDGDIVDSQAHLAATEKKLDHEYHLA
Ga0256412_136483613300028137SeawaterLLVASASAIRLASDPICSSSGCTQYKHPDSKEAKYDMDYAVPHFGMDRDIMGSLENLKVAEGVVGHSWAGIDKKKYANPAKKVDYNFAPRLDADIVDS
Ga0256412_140239913300028137SeawaterFTVALLLAAVSGIKIHSDPICNSAGCTQYKHPESTEAKYDMDYPVPNFGMDRDIQGSLENLNVAEGIVKHVWKGIDKKKYANPAKKVTYNFAPKLDGDIVDSQKNLADTEKKLDHEYELS
Ga0256417_111524513300028233SeawaterVKLLLVASASAIRISSDPICNSAGCTQYKHPDSKEAKYPMDYGVASFGMDRDVMGSLENLKVAEGVVGHHWAGIDKAKYANPAKKVDYNFAPRLDGDIIDSQAHLAATEKKLDHEYALA
Ga0256413_107826323300028282SeawaterLSSDPICSSSGCSQYKHPESKEAKYDMDYAVPSFGMDRDIQGSLENLSVAQNIVKHQWVGIDKDKYSNPAKKVNYNFAPKLDGDIIDSQAHLASTEKRLDHTYELA
Ga0256413_123275113300028282SeawaterKMFVKALLIATASAIRISSDPICSSSGCSQYKHPESKEAKYDMDYAVPHFGMDRDIQGSLENLAVAQNIVKHQWVGIDKDKYSNPAKKVNYNFAPKLDGDIIDSQAHLASTEKRLDHTYELA
Ga0256413_127943213300028282SeawaterNIMFKIVALAASASAIRLASDPICSSSGCDQYKHPESKEAKYDMDYPVPHFGMDRDVMGSLENLKVAEGVVGHHWAGIDKDKYANPARKVDYNFAPRLDGDIIDSHANLAATEKRLEHTY
Ga0256413_129103813300028282SeawaterVKLLLVASASAIRISSDPICNSAGCTQYKHPDSKEAKYPMDYGVASFGMDRDVMGSLENLKDAEGVVGHHWAGIDKAKYANPAKKVDYNFAPRLDGDIIDSQAHLAATEKKLDHEYALA
Ga0256413_129305013300028282SeawaterFVLLAASASAIKITSDPICNSAGCTQYKHPESKEAVYPMDFAVPHFGMDRDGQGSLENLKVAEGVVGHHWAGIDKAKYANPARKVDYNFAPRLDGDIIDSQAHLAATEKVLSHEYSLA
Ga0256413_129574013300028282SeawaterYKILLLVASASAIKIKSDPICNSSGCTQYLHPDSKEISYPMDYGVPNFGMDRDIQNGLVNLQAAEGIVGHHWVGIDKEKWANPAKKVMYNFAPKLDGDIIDSKANLAATEKVLDHTYELS
Ga0256413_137020713300028282SeawaterSDPICSSAGCSQYKHPESKEAKYDMDYGVPHFGMDRDVMGSLENLKVAEGVVGHHWVGIDKDKYSNPAKKVDYNFAPRLDGDIIDSHNNLAATEKRLDHTYSLA
Ga0247572_118192013300028290SeawaterDPICNSAGCTQYKHPDSKEAKYDMDYPVHNFGMDRDVMGSLENLKVAEGVVGHHWAGIDKAKYANPAKKVDYNFAPRLDGDIIDSQAHLAATEKKLDHEYALA
Ga0247572_119552513300028290SeawaterALVVASASAIKIYSDPICNSAGCTQYKHPDSKEAKYDMDYFVPHFGMDRDIQGSLENLHVAEGIVKHHWVGIDKDKYANPAKKVDYNFDPKLDGDIIDSQKNLVDTEKRLEHTYELS
Ga0247572_119886013300028290SeawaterKIKSDPICNSSGCTQHLHPDSKEISYPMDYGVPNFGMDRDIQNGLVNLQAAEGIVGHHWVGIDKEKWANPAKKVMYNFAPKLDGDIIDSKANLAATEKVLDHTYELS
Ga0304731_1134239513300028575MarineVALLLASASAIRLTSDPICNSAGCTQYKHPDSKEAKYDMDYFVPHFGMDRDIQGSLENLHVAEGIVKHHWAGIPKDKYANPARKVMYNFAPKLDGDIVDSQAHLASTEQKLDHTYQLS
Ga0307401_1036905413300030670MarineLIIITMFKILLIASAAAIKIMDDPICSSAGCGQYKHPDSKVAVHPMDYGVPSFGMDRDIMGSLENLKVAEGIVKHSWKGIDAAKYANPAKKVMYNFAPALDGDIIASHANLAATEKKLDHEYALS
Ga0307398_1068872613300030699MarineELLQLESDPICSSAGCSQYKHPDSKTAGHPMDYGVPSFGMDRDIMGSFEDLKVAEGIVKHHWAGIDKDKYANPAKKTMYNFAPKLDGDIIDSQSNLAATEKVLDHPYNLA
Ga0308137_108184413300030722MarineFKALLIVSAAAVKITSDPICSSAGCDQYKHPKSTIADYPMNYGVPHFGMDRDIQGSLENLNVSEGIVGHHWVGIDKDKWANPAKKVMYNFAPKLDGDIVDSQSNLGATEKKLDHEY
Ga0073988_1200010013300030780MarineSDPICSSSGCSQYKHPDSKEAKYPMDYGVPHFGMDRDIMGSLENLKVAEGVTGHHWAGIDKAKYSNPAKKVDYNFAPKLDGDIIDSQAHLAATEKKLDHEYSLA
Ga0073981_1164181313300030857MarineYYCFVHACTVRVATSAALRAKGRASAAAIKIKSDPICNSAGCTQYLHPDSTEATWPMNYGVPHFGMDRDIQGSLEDLKVAEGIVGHHWAGIDKDKYANPAKKVMYNFAPKLDGDIIDSKKNLADTEKRLDHTYELS
Ga0073979_1200849013300031037MarineDYQGLWRVGKDEASVQLEADIEIFSDPICSSSGCDQYKHPDSKVADWPRDYDVPHFGMDRDIQGSLENLKVAEGIVKHQWKGIDKDKYANPAKKVDYNFAPKLDGDIIDSKANLAATEKALDHTYELS
Ga0073986_1200632713300031038MarineFKLVALAASASAIRLTSDPICSSSGCDQYKHPESKEAKYDMDYPVPHFGMDRDVQGSLENLKVAEGVVGHHWAGIDKDKYANPAKKVDYNFIPKLDGDIIDSQAHLAATEKRLEHTYQLS
Ga0308134_114509013300031579MarineLVASATAIKIKSDPICSSAGCDQYKHPDSKEASYPMDYGVPTFGMDRDIANGIDNLAVAEGIVKHHWVGIDAKKYANPAKKVMYNFAPKLDGDIIDSKANLAATEKKLENTYELA
Ga0308132_110684313300031580MarineKIKSDPICNSAGCTQYLHPDSKESDYPMNYGVPHFGMDRDIQANFENLAIAEGIVGHHWVGIDKDKWKNPAKKVLYNFDMKLDGDIIDAQKNLEDTEKKLEHTYELSXAL
Ga0307386_1012621213300031710MarineLEIESDPICNSAGCTQYKHPESKEAKYDMDYPVPHFGMDRDIQGSLENLSVAEGVVGHHWVGIDKKKYANPARKVDYNFLAKLDGDIIDS
Ga0307386_1062478513300031710MarineFKFALLAASATAIKITSDPICNSAGCTQYKHPESKEAKYDMDYAVPHFGMDRDVQGSLENLKVAEGVVGHHWAGIDKKKYANPAKKVDYNFAPRLDGDIIDSQAHLASTEKRMDHEYSLA
Ga0307391_1079917913300031729MarineMFKIALLFVSAQAIRITSDPICSSAGCGQYKHPDSKEVSYPQDYGVPHFGMDRDIMGSLDNLAVAEGVVGHKWAGIDAAKYSNPAKKVMYNFAPRLDGDIIDSHANLAATEKVLDHAYTL
Ga0307397_1052442313300031734MarineIALVASATAIKIKSDPICSSAGCDQYKHPDSKVAGYPMNYGVPDFGMDRDVSGSFENLAVAEGIVGHHWVGIDKDKYSNPAKKVMYNFAPKLDGAIVDSIKNLADTEKKLDHTYELA
Ga0307384_1015096413300031738MarineLELESDPICNSAGCTQYKHPDSKEAKYDMDYFVPHFGMDRDIQGSLENLHVAEGIVKHHWVGIDKKKWANPAKKVDYNFDPKLDGDMIDSQKNLADTEKRLEHTYELS
Ga0307384_1062292513300031738MarineQNTMFKLVALAASASGIKIASDPICSSSGCGQYKHPDSKEAKYPMDYPVFSFGMDRDVQGSLENLKVAEGVVGHHWAGIDKDKYSNPAKKVDY
Ga0307384_1062629813300031738MarineMFKFALLAASATAIKITSDPICNSAGCTQYKHPESKEAKYDMDYAVPHFGMDRDVQGSLENLKVAEGVVGHHWAGIDKKKYANPAKKVDYNFAPRLDGDIIDSQAHLASTEKRMDHEYSL
Ga0307384_1062661913300031738MarineLNNIMFKVALLVASASAIKITSDPIGSSIGNTQYKHPASKEATYPMDYGVPHFGMDRDIQGSLENLSVAQNIVGHKWASIDGAKYANPAKAVDYQFAPKLDEDIVTSHANLAATEKRLDHTYTLS
Ga0307383_1062905913300031739MarineIYQVMYKIALLFASAQAIKITSDPICSSAGCSQYKHPASTEISYPMDYGVPSFGMDRDLMGSLDNMKVAEKIVKHHWVGIDAAKYANPAKKVMYNFAPNLDGDIIDSKANLAATEKKLDHAYALS
Ga0307383_1065761813300031739MarineATAIKITSDPICNSAGCTQYKHPESKEAKYDMDYAVPHFGMDRDVQGSLENLKVAEGVVGHHWAGIDKKKYANPAKKVDYNFAPRLDGDIIDSQAHLASTEKRMDHEYSLA
Ga0307395_1036756713300031742MarineLKHKYELVQLDASSDPICSSAGCGQYKHPDSKVATYPMDYGVPNFGMDREVQGTFEDLAVAEGIVKHHWAGIDKDKYSNPAKKVMYNFAPKLDGDIVDSQANLGATEKKLDHTYALA
Ga0307389_1111459913300031750MarineAIKITSDPIGSSIGNTQYKHPASKEATYPMDYGVPHFGMDRDIQGSLENLSVAQNIVGHKWASIDGAKYANPAKAVDYQFAPKLDEDIVTSHANLAATEKRLDHTYTLS
Ga0307404_1034541823300031752MarineMFKIALLFVSAQAIRITSDPICSSAGCGQYKHPDSKEVSYPQDYGVPHFGMDRDIMGSLDNLAVAEGVVGHKWAGIDAAKYSNPAKKVMYNFAPRLDGDIIDSHANLAATEKVLDHAYSL
Ga0314682_1061773713300032540SeawaterQNIMFKVIALAASASAIRITSDPICNSAGCTQYKHPDSKEAKYDMDYYVPHFGMDRDVQGSLENLKVAEGVVGHHWAGIDKDKYANPAKKVDYNFAPRLDGDIIDSQANLGATEKRLEHTYSLA
Ga0314695_132039623300032724SeawaterLESDPICNSAGCTQYKHPDSKEAKYDMDYYVPHFGMDRDVQGSLENLKVAEGVVGHHWAGIDKDKYANPAKKVDYNFAPRLDGDIIDSQANLGATEKRLEHTYSLA
Ga0314694_1051638813300032751SeawaterQQNIMFKVIALAASASAIRITSDPICNSAGCTQYKHPDSKEAKYDMDYYVPHFGMDRDVQGSLENLKVAEGVVGHHWAGIDKDKYANPAKKVDYNFAPRLDGDIIDSQANLGATEKRLEHTYSLA
Ga0314700_1074632313300032752SeawaterMFKVALIATASAIRLTSDPICNSAGCTQYKHPDSKEAKYDMNYYVPSFGMDRDIQGSLENLHVAEGIVKHHWVGIDKDKYANPAKKVDYNFAPRLDGDIIDSQNNLVATEKRLEHTYELS
Ga0307390_1077631113300033572MarineNNMFKIALLFVSAQAIRITSDPICSSAGCGQYKHPDSKEVSYPQDYGVPHFGMDRDIMGSLDNLAVAEGVVGHKWAGIDAAKYSNPAKKVMYNFAPRLDGDIIDSHANLAATEKVLDHAYTLA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.