NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F051948

Metagenome / Metatranscriptome Family F051948

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051948
Family Type Metagenome / Metatranscriptome
Number of Sequences 143
Average Sequence Length 53 residues
Representative Sequence MIMKIKQWADVCKVHWKEIISLAIALHWLMDLLIIIPLSLAIGYFFGVHIGHSH
Number of Associated Samples 111
Number of Associated Scaffolds 143

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 70.42 %
% of genes near scaffold ends (potentially truncated) 27.27 %
% of genes from short scaffolds (< 2000 bps) 68.53 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (49.650 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(24.476 % of family members)
Environment Ontology (ENVO) Unclassified
(72.727 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(96.503 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 59.76%    β-sheet: 0.00%    Coil/Unstructured: 40.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 143 Family Scaffolds
PF14743DNA_ligase_OB_2 7.69
PF13155Toprim_2 4.90
PF03796DnaB_C 4.20
PF05050Methyltransf_21 3.50
PF03721UDPG_MGDP_dh_N 3.50
PF03332PMM 2.80
PF03083MtN3_slv 2.10
PF03567Sulfotransfer_2 2.10
PF03851UvdE 2.10
PF01370Epimerase 2.10
PF00856SET 1.40
PF00210Ferritin 1.40
PF00984UDPG_MGDP_dh 1.40
PF13489Methyltransf_23 1.40
PF01458SUFBD 0.70
PF027395_3_exonuc_N 0.70
PF00565SNase 0.70
PF07883Cupin_2 0.70
PF09568RE_MjaI 0.70
PF00462Glutaredoxin 0.70
PF16861Carbam_trans_C 0.70
PF06745ATPase 0.70
PF01883FeS_assembly_P 0.70
PF02195ParBc 0.70
PF03819MazG 0.70
PF04434SWIM 0.70
PF10902WYL_2 0.70
PF00156Pribosyltran 0.70
PF09694Gcw_chp 0.70
PF02511Thy1 0.70
PF01379Porphobil_deam 0.70

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 143 Family Scaffolds
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 4.90
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 4.90
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 4.20
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 4.20
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 3.50
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 3.50
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 3.50
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 2.80
COG4095Sugar transporter, SemiSWEET family, contains PQ motifCarbohydrate transport and metabolism [G] 2.10
COG4294UV DNA damage repair endonucleaseReplication, recombination and repair [L] 2.10
COG0719Fe-S cluster assembly scaffold protein SufBPosttranslational modification, protein turnover, chaperones [O] 0.70
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 0.70
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 0.70
COG0181Porphobilinogen deaminaseCoenzyme transport and metabolism [H] 0.70
COG4279Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 0.70
COG4715Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 0.70
COG5431Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domainGeneral function prediction only [R] 0.70

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms50.35 %
UnclassifiedrootN/A49.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10092839All Organisms → Viruses → Predicted Viral1285Open in IMG/M
3300000117|DelMOWin2010_c10068113All Organisms → Viruses → Predicted Viral1451Open in IMG/M
3300000159|LPaug08P2610mDRAFT_c1001319All Organisms → Viruses → Predicted Viral4664Open in IMG/M
3300000159|LPaug08P2610mDRAFT_c1002221All Organisms → Viruses → Predicted Viral3395Open in IMG/M
3300000168|LPjun09P1210mDRAFT_c1013350All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon659Open in IMG/M
3300001460|JGI24003J15210_10002374Not Available8280Open in IMG/M
3300001472|JGI24004J15324_10000047Not Available39630Open in IMG/M
3300001589|JGI24005J15628_10087816All Organisms → Viruses → Predicted Viral1076Open in IMG/M
3300003185|JGI26064J46334_1014233All Organisms → cellular organisms → Bacteria1643Open in IMG/M
3300003476|NAP2_1133632All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300004097|Ga0055584_100682174Not Available1074Open in IMG/M
3300004457|Ga0066224_1118797Not Available575Open in IMG/M
3300005510|Ga0066825_10088758Not Available1119Open in IMG/M
3300005941|Ga0070743_10006651Not Available4131Open in IMG/M
3300006399|Ga0075495_1270954Not Available568Open in IMG/M
3300006735|Ga0098038_1283509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria517Open in IMG/M
3300006752|Ga0098048_1000174Not Available32527Open in IMG/M
3300006922|Ga0098045_1044933All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300006924|Ga0098051_1110929Not Available733Open in IMG/M
3300006925|Ga0098050_1000566Not Available12985Open in IMG/M
3300009079|Ga0102814_10240853Not Available985Open in IMG/M
3300009080|Ga0102815_10408407Not Available755Open in IMG/M
3300009193|Ga0115551_1181128Not Available954Open in IMG/M
3300009428|Ga0114915_1048027All Organisms → Viruses → Predicted Viral1387Open in IMG/M
3300009428|Ga0114915_1085663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED273955Open in IMG/M
3300009436|Ga0115008_10002691Not Available14704Open in IMG/M
3300009436|Ga0115008_10064330All Organisms → cellular organisms → Bacteria2796Open in IMG/M
3300009436|Ga0115008_10118810All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp.1947Open in IMG/M
3300009436|Ga0115008_10354896All Organisms → Viruses → Predicted Viral1040Open in IMG/M
3300009436|Ga0115008_11200615Not Available575Open in IMG/M
3300009496|Ga0115570_10156596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.1060Open in IMG/M
3300009593|Ga0115011_10000018Not Available179318Open in IMG/M
3300009599|Ga0115103_1496428All Organisms → Viruses → Predicted Viral2454Open in IMG/M
3300009677|Ga0115104_10795879Not Available933Open in IMG/M
3300010150|Ga0098056_1011371All Organisms → Viruses → Predicted Viral3254Open in IMG/M
3300012920|Ga0160423_10115682All Organisms → Viruses → Predicted Viral1891Open in IMG/M
3300012920|Ga0160423_10149684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED2731638Open in IMG/M
3300012928|Ga0163110_10080593All Organisms → Viruses → Predicted Viral2129Open in IMG/M
3300012953|Ga0163179_11294150All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300012954|Ga0163111_10002450Not Available11772Open in IMG/M
3300012954|Ga0163111_11275397All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium720Open in IMG/M
3300017706|Ga0181377_1002531All Organisms → cellular organisms → Bacteria → Proteobacteria5509Open in IMG/M
3300017706|Ga0181377_1016880All Organisms → Viruses → Predicted Viral1641Open in IMG/M
3300017706|Ga0181377_1034489All Organisms → Viruses → Predicted Viral1030Open in IMG/M
3300017708|Ga0181369_1038487All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300017709|Ga0181387_1016003Not Available1449Open in IMG/M
3300017709|Ga0181387_1058207Not Available772Open in IMG/M
3300017719|Ga0181390_1108822Not Available733Open in IMG/M
3300017719|Ga0181390_1172961Not Available532Open in IMG/M
3300017720|Ga0181383_1002101Not Available5672Open in IMG/M
3300017720|Ga0181383_1086194Not Available843Open in IMG/M
3300017720|Ga0181383_1153477Not Available618Open in IMG/M
3300017721|Ga0181373_1071160Not Available621Open in IMG/M
3300017725|Ga0181398_1137577Not Available581Open in IMG/M
3300017727|Ga0181401_1139092Not Available598Open in IMG/M
3300017731|Ga0181416_1032551Not Available1225Open in IMG/M
3300017731|Ga0181416_1035060Not Available1179Open in IMG/M
3300017745|Ga0181427_1016195All Organisms → cellular organisms → Bacteria → Proteobacteria1867Open in IMG/M
3300017746|Ga0181389_1137115Not Available657Open in IMG/M
3300017749|Ga0181392_1097739Not Available878Open in IMG/M
3300017758|Ga0181409_1040496All Organisms → Viruses → Predicted Viral1452Open in IMG/M
3300017763|Ga0181410_1181905Not Available582Open in IMG/M
3300017764|Ga0181385_1003972Not Available4999Open in IMG/M
3300017764|Ga0181385_1120188All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M802Open in IMG/M
3300017781|Ga0181423_1137123Not Available947Open in IMG/M
3300017786|Ga0181424_10172990All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon921Open in IMG/M
3300020165|Ga0206125_10268812Not Available645Open in IMG/M
3300020185|Ga0206131_10019643All Organisms → cellular organisms → Bacteria5614Open in IMG/M
3300020247|Ga0211654_1000058Not Available20029Open in IMG/M
3300020266|Ga0211519_1000794Not Available11821Open in IMG/M
3300020347|Ga0211504_1088510Not Available703Open in IMG/M
3300020352|Ga0211505_1100658Not Available689Open in IMG/M
3300020374|Ga0211477_10000362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria28126Open in IMG/M
3300020377|Ga0211647_10091387All Organisms → Viruses → Predicted Viral1056Open in IMG/M
3300020379|Ga0211652_10000043All Organisms → cellular organisms → Bacteria43537Open in IMG/M
3300020381|Ga0211476_10002193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED27311962Open in IMG/M
3300020394|Ga0211497_10177783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED273820Open in IMG/M
3300020400|Ga0211636_10068584All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1473Open in IMG/M
3300020404|Ga0211659_10008275All Organisms → cellular organisms → Bacteria5274Open in IMG/M
3300020413|Ga0211516_10490831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED273537Open in IMG/M
3300020428|Ga0211521_10315061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED273693Open in IMG/M
3300020431|Ga0211554_10084006All Organisms → Viruses → Predicted Viral1654Open in IMG/M
3300020433|Ga0211565_10194319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria881Open in IMG/M
3300020438|Ga0211576_10016838All Organisms → Viruses → Predicted Viral4493Open in IMG/M
3300020438|Ga0211576_10139366All Organisms → Viruses → Predicted Viral1318Open in IMG/M
3300020438|Ga0211576_10529725Not Available592Open in IMG/M
3300020445|Ga0211564_10142820All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED2731190Open in IMG/M
3300020446|Ga0211574_10107007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED2731228Open in IMG/M
3300020451|Ga0211473_10385744All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae717Open in IMG/M
3300020459|Ga0211514_10020789All Organisms → cellular organisms → Bacteria3532Open in IMG/M
3300020463|Ga0211676_10035031All Organisms → Viruses → Predicted Viral3742Open in IMG/M
3300020463|Ga0211676_10618119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED273552Open in IMG/M
3300020468|Ga0211475_10134365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1270Open in IMG/M
3300020469|Ga0211577_10005204Not Available11334Open in IMG/M
3300020469|Ga0211577_10109378All Organisms → cellular organisms → Bacteria1906Open in IMG/M
3300020469|Ga0211577_10169430All Organisms → cellular organisms → Bacteria → Proteobacteria1458Open in IMG/M
3300020469|Ga0211577_10708601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED247589Open in IMG/M
3300020471|Ga0211614_10132295All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300021085|Ga0206677_10004282Not Available11715Open in IMG/M
3300021085|Ga0206677_10024470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1943535Open in IMG/M
3300021085|Ga0206677_10146298Not Available1061Open in IMG/M
3300021085|Ga0206677_10198877Not Available859Open in IMG/M
3300021185|Ga0206682_10020687All Organisms → cellular organisms → Bacteria4188Open in IMG/M
3300021373|Ga0213865_10001714Not Available14136Open in IMG/M
3300021375|Ga0213869_10000012Not Available168488Open in IMG/M
3300021378|Ga0213861_10185338Not Available1147Open in IMG/M
3300021957|Ga0222717_10001974Not Available16245Open in IMG/M
3300021957|Ga0222717_10412064Not Available745Open in IMG/M
3300022074|Ga0224906_1226592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED247503Open in IMG/M
3300024235|Ga0228665_1052063Not Available845Open in IMG/M
3300024248|Ga0228676_1136039Not Available521Open in IMG/M
(restricted) 3300024255|Ga0233438_10077583All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1581Open in IMG/M
3300024266|Ga0228661_1049459Not Available776Open in IMG/M
3300025084|Ga0208298_1000707Not Available13354Open in IMG/M
3300025084|Ga0208298_1020445All Organisms → Viruses → Predicted Viral1473Open in IMG/M
3300025120|Ga0209535_1000256Not Available36536Open in IMG/M
3300025137|Ga0209336_10000171Not Available33208Open in IMG/M
3300025137|Ga0209336_10023112All Organisms → Viruses → Predicted Viral2179Open in IMG/M
3300025137|Ga0209336_10025239All Organisms → Viruses → Predicted Viral2058Open in IMG/M
3300025138|Ga0209634_1002024Not Available14405Open in IMG/M
3300025138|Ga0209634_1079370Not Available1513Open in IMG/M
3300025138|Ga0209634_1299940Not Available553Open in IMG/M
3300025151|Ga0209645_1234913Not Available521Open in IMG/M
3300025276|Ga0208814_1119112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED273635Open in IMG/M
3300025658|Ga0209659_1197646Not Available565Open in IMG/M
3300026505|Ga0228647_1116854Not Available626Open in IMG/M
3300027582|Ga0208971_1113631Not Available618Open in IMG/M
3300027753|Ga0208305_10180088Not Available766Open in IMG/M
3300027833|Ga0209092_10080213All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp.1964Open in IMG/M
3300027833|Ga0209092_10430364Not Available686Open in IMG/M
3300027849|Ga0209712_10292468Not Available922Open in IMG/M
3300028008|Ga0228674_1127702Not Available865Open in IMG/M
3300028124|Ga0228621_1077816Not Available512Open in IMG/M
3300028128|Ga0228645_1071808All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300028136|Ga0228608_1022875All Organisms → cellular organisms → Bacteria1842Open in IMG/M
3300028194|Ga0257106_1256624All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon584Open in IMG/M
3300028279|Ga0228613_1104866Not Available664Open in IMG/M
3300028418|Ga0228615_1008459All Organisms → cellular organisms → Bacteria4073Open in IMG/M
3300031658|Ga0307984_1045468All Organisms → Viruses → Predicted Viral1385Open in IMG/M
3300031766|Ga0315322_10046702All Organisms → Viruses → Predicted Viral3189Open in IMG/M
3300031851|Ga0315320_10021125Not Available5184Open in IMG/M
3300032073|Ga0315315_10099302All Organisms → Viruses → Predicted Viral2710Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine24.48%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine22.38%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater14.69%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater9.09%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater5.59%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater3.50%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean2.10%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine2.10%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.10%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater2.10%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.40%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.40%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.40%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.40%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.70%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.70%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.70%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.70%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.70%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.70%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.70%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.70%
EstuarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine0.70%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000159Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 10mEnvironmentalOpen in IMG/M
3300000168Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 10mEnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300003185Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LVEnvironmentalOpen in IMG/M
3300003476Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 2EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300005510Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020247Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962)EnvironmentalOpen in IMG/M
3300020266Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX556082-ERR598951)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020352Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144)EnvironmentalOpen in IMG/M
3300020374Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618)EnvironmentalOpen in IMG/M
3300020377Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065)EnvironmentalOpen in IMG/M
3300020379Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168)EnvironmentalOpen in IMG/M
3300020381Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620)EnvironmentalOpen in IMG/M
3300020394Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026)EnvironmentalOpen in IMG/M
3300020400Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020413Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092)EnvironmentalOpen in IMG/M
3300020428Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094)EnvironmentalOpen in IMG/M
3300020431Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983)EnvironmentalOpen in IMG/M
3300020433Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020445Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087)EnvironmentalOpen in IMG/M
3300020446Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989)EnvironmentalOpen in IMG/M
3300020451Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)EnvironmentalOpen in IMG/M
3300020459Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095)EnvironmentalOpen in IMG/M
3300020463Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)EnvironmentalOpen in IMG/M
3300020468Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300020471Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300024235Seawater microbial communities from Monterey Bay, California, United States - 79DEnvironmentalOpen in IMG/M
3300024248Seawater microbial communities from Monterey Bay, California, United States - 48D_rEnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024266Seawater microbial communities from Monterey Bay, California, United States - 75DEnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025658Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026505Seawater microbial communities from Monterey Bay, California, United States - 59DEnvironmentalOpen in IMG/M
3300027582Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028124Seawater microbial communities from Monterey Bay, California, United States - 25DEnvironmentalOpen in IMG/M
3300028128Seawater microbial communities from Monterey Bay, California, United States - 57DEnvironmentalOpen in IMG/M
3300028136Seawater microbial communities from Monterey Bay, California, United States - 9DEnvironmentalOpen in IMG/M
3300028194Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10mEnvironmentalOpen in IMG/M
3300028279Seawater microbial communities from Monterey Bay, California, United States - 14DEnvironmentalOpen in IMG/M
3300028418Seawater microbial communities from Monterey Bay, California, United States - 16DEnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1009283933300000101MarineMFAKIKQWQDVCRLHWKEIISLAIALHWVMDLLIIVPISMAIGYLFGVHTGHGH*
DelMOWin2010_1006811323300000117MarineMIMKIKQWADVCKVHWKEIISLAIALHWLMDLLIIIPLSLAIGYFFGVHIGHSH*
LPaug08P2610mDRAFT_100131973300000159MarineMVNKIKHWADVCKLHWKEIISLAVALHWAMDLLIIIPLSLAIGYLFGIHVEH*
LPaug08P2610mDRAFT_100222123300000159MarineVITRIKHWADVCKLHWKEIVSLAVALHWFMDLIVIIPLSILIGYMFGIHTGHAH*
LPjun09P1210mDRAFT_101335033300000168MarineMVSKIKHWADVCKLHWREIITLSIALHWAVDLLIIVPISLAIGYFFGIQVGH*
JGI24003J15210_1000237483300001460MarineMFKKVKQWADVCKIHWKEIISLAIALHWLMDLLIIIPLSLAIGFFFGIHIGEH*
JGI24004J15324_10000047483300001472MarineMVSKIKHWADVCKLHWKEIISLAVALHWLMDLLIIIPLSLTIGYFFGVHIGHSY*
JGI24005J15628_1008781623300001589MarineMIKSIKHWSEVCKVHWKEIITLAIGLHWLMDLLIIIPISLGIGYLFGAHVH*
JGI26064J46334_101423343300003185MarineMVEKIKHWANVCKIHWREIITLSIALHWAVDLLIIVPISLAIGYFTGVHFGHHG*
NAP2_113363213300003476EstuarineIKHWADVCKLHWKEIISLAIALHWLTDLLIIIPLSLVIGYFTGVHFGHGH*
Ga0055584_10068217423300004097Pelagic MarineMIKRIKNWADICKVHWKEIVSLAIALHWLMDLLIIVPISLAIGYFFGVHVGHTH*
Ga0066224_111879723300004457MarineMIKQIKNWADVCKVHWKEIISLAIALHWLMDLLIIIPLSLTIGYLFGIHVEH*
Ga0066825_1008875823300005510MarineMLSKVKHWADVCKIHWKEIISLAIALHWLMDLLIIIPLSIALGFFFGIQFGEH*
Ga0070743_1000665143300005941EstuarineMIKRIKEWKDVCKLHWKEIISLAIALHWAMDLLIIVPISIAIGYLFGIHIGH*
Ga0075495_127095433300006399AqueousLLSRAGRLMFAKIKQWQDVCRLHWKEIISLAIALHWVMDLLIIVPISMAIGYLFGVHTGHGH*
Ga0098038_128350923300006735MarineMVERIKHWADVCKIHWKEIISLAIALHWLMDLIIIIPLSLAIGYFTGVHFGGH*
Ga0098048_1000174263300006752MarineMLSKVKHWADVCKIHWKEIISLAIALHWIMDLLIIIPLSLALGFFFGIQFGEH*
Ga0098045_104493313300006922MarineMIERIKHWKDVCKIHWREIISLAIALHWLLDLLVIVPISLAIGYFFGVHIGHDH*
Ga0098051_111092923300006924MarineMIKRIKDWADVCKVHWKEIISLAVALHWLMDLLIIIPLSLAIGYFFGIHVEH*
Ga0098050_1000566133300006925MarineMLSRIKHWKDVCQLHWKEIISLAIALHWLMDLLVIVPISLAIGYFFGVHIGHD*
Ga0102814_1024085313300009079EstuarineSKGKNVMIKRIKEWKDVCKLHWKEIISLAIALHWAMDLLIIVPISIAIGYLFGIHIGH*
Ga0102815_1040840713300009080EstuarineSKSKGKNVMIKRIKEWKDVCKLHWKEIISLAIALHWAMDLLIIVPISIAIGYLFGIHIGH
Ga0115551_118112823300009193Pelagic MarineMLKKIKHWKDICKVHWKEIVSLAFALHWLLDLLVIVPISIAIGYFFGVHIGHDH*
Ga0114915_104802743300009428Deep OceanMVARIKKWADVCKIHWKEIITLSIALHWAMDLLIIVPISLAIGYFFGIHTGH*
Ga0114915_108566333300009428Deep OceanMVGKIKHWAGVCKLHWKEIVSLAVALHWLMDLLIIIPLSLTIGYLFGIHMEH*
Ga0115008_10002691113300009436MarineMKNRVKHWADVCRVHWREIVSLAIALHWIMDLLIIVPISLAVGYFTGVHFGHHH*
Ga0115008_1006433063300009436MarineVLNKIKHWKDVCQLHWKEIISLAIALHWVMDLLIIVPISIAVGYLFGVHTGHGH*
Ga0115008_1011881053300009436MarineMFAKIKHWKDVCKLHWKEIISLAIALHWAMDLLIIVPISIAIGYLFGVHIGHGH*
Ga0115008_1035489623300009436MarineMLKRIKAWQDVCKLHWKEIISLAIALHWVTDLLIIVPVSMAIGYLFGVHTGHGH*
Ga0115008_1120061523300009436MarineMFAKIKQWQDVCRLHWKEIISLAIALHWVMDLLIIVPVSLAIGYLFGVHTGH*
Ga0115570_1015659623300009496Pelagic MarineMIKQIKNWADVCKVHWKEIISLAIALHWVMDLLIIIPLSLAIGYLFGIHVEH*
Ga0115011_100000181723300009593MarineMVEKIKHWANVCKIHWREIITLSIALHWAVDLLIIVPITLTIGYFTGVHFGGH*
Ga0115103_149642843300009599MarineMLKGIKHWQEVCKLHWKEIITLAIGLHWLMDLLIIVPISLGIGYLFGVHAQ*
Ga0115104_1079587913300009677MarineMVKRIRHWADVCKLHWKEIISLAVALHWLMDLLIIIPLSLTIGYFFGVHI
Ga0098056_101137133300010150MarineMIKRIKNWADVCKVHWKEIISLAIALHWLMDLLVIVPISLAIGYFFGVHIGHTH*
Ga0160423_1011568233300012920Surface SeawaterMVKRIKHWAEVCKIHWKEIISLAVALHWLMDLLVIIPLSMLIGYMFGVHIGHDH*
Ga0160423_1014968423300012920Surface SeawaterMVEKIKHWANVCKIHWREIITLSIALHWMVDLLIIVPISLAIGYFTGIHFGH*
Ga0163110_1008059333300012928Surface SeawaterMLNKVKQWADVCKIHWKEIISLAIALHWLMDLLIIIPLSLAIGYFFGIHIGEH*
Ga0163179_1129415023300012953SeawaterMIKQIKNWADVCKIHWKEIISLAIALHWVMDLLIIIPLSLAIGYLFGIHVEH*
Ga0163111_10002450153300012954Surface SeawaterVFKKVKQWADVCKVHWKEIISLAIALHWLMDLLIIIPLSLAIGYFFGVHIGDH*
Ga0163111_1127539723300012954Surface SeawaterGEFIVFKKVKQWADVCKIHWKEIISLAIALHWLMDLLIIIPLSLAIGYFFGIHIGEH*
Ga0181377_100253193300017706MarineMVKRIRHWADVCKLHWREIISLAIALHWLLDLLVIVPISLAIGY
Ga0181377_101688043300017706MarineMVRRIKDWADVCKVHWKEIISLAVALHWLMDLLIIIPLSLAIGYFFGVHIGHDH
Ga0181377_103448933300017706MarineMVKRIRHWADVCKLHWREIISLAIALHWLLDLLVIVPISLAIGYFFGVHVGHGH
Ga0181369_103848723300017708MarineMVKRIKQWKDVCKLHWKEIISLAIALHWLMDLLIIVPISLAIGYFFGVHVGHGH
Ga0181387_101600323300017709SeawaterMNKKVKHWADVCKLHWKEIISLAVALHWLMDLLIIIPISLAIGYFFGIHTGHGH
Ga0181387_105820723300017709SeawaterMFSKVTQWADVCKIHWKEIVSLAIALHWLMDLLIIIPLSLAIGFFFGIHIGEH
Ga0181390_110882223300017719SeawaterMIMKIKQWADVCKIHWKEIISLAVALHWLMDLLIIIPLSLAIGYFFG
Ga0181390_117296113300017719SeawaterIETSMILRRIKNWADVCKVHWKEIISLAIALHWIMDLLIIIPLSLLIGYFTGVHFGHGH
Ga0181383_100210153300017720SeawaterMFSKVTQWADVCKIHWKEIVSLAIALHWLMDLLIIIPLALGFFFGIQFGEHLWIILLLKISKI
Ga0181383_108619423300017720SeawaterMIKKVKHWADVCKLHWKEIISLAVALHWLMDLLIIIPLSLTIGYFFGVHIGHDH
Ga0181383_115347713300017720SeawaterMIKKVKHWADVCKLHWKEIISLAVALHWLMDLLIIIPISLAIGYFFGIHTGHGH
Ga0181373_107116013300017721MarineKVKHWADVCKIHWKEIISLAIALHWIMDLLIIIPLSLALGFFFGIQFGEH
Ga0181398_113757713300017725SeawaterVTQWADVCKIHWKEIVSLAIALHWLMDLLIIIPLSLAIGFFFGIHIGEH
Ga0181401_113909223300017727SeawaterMKEKIDHWKNICKLHWKEIISLAVALHWLMDLLIIIPLSLTIGYFFGVHIGHDH
Ga0181416_103255113300017731SeawaterMFKKVKQWADVCKIHWKEIISLAIALHWLMDLLIIIPLSLEIVFFFGIHIGEH
Ga0181416_103506023300017731SeawaterMFKKVKQWADVCKIHWKEIVSLAIALHWLMDLLIIIPLSLALGFFFGIQFGEH
Ga0181427_101619593300017745SeawaterGQMVSKIKHWADVCKLHWKEIISLAVALHWLMDLLIIIPLSLTIGYFFGVHIGHDH
Ga0181389_113711513300017746SeawaterMVKRIRHWADVCKLHWKEIISLAVALHWLMDLLIIIPLSLTIGYFFG
Ga0181392_109773953300017749SeawaterVCKLHWKEIISLAVALHWLMDLLIIIPLSLTIGYFFGVHIGHDH
Ga0181409_104049643300017758SeawaterMINRIKHWADVCKIHWREIISLAVALHWLMDLLIIIPLSLTIGYLFGIHVEH
Ga0181410_118190513300017763SeawaterLMFSKIKHWKDVCQLHWKEIISLAIALHWVMDLLIIVPISMAIGYLFGVHTGHGH
Ga0181385_100397253300017764SeawaterMIKKVKHWADVCKLHWKEIISLAVALHWLMDLLIIIPLSLVIGYFFGIHTGHGH
Ga0181385_112018823300017764SeawaterMIKVIKNWADVCKIHWKEIISLAIALHWVMDLLIIIPVSLAIGYLFGIHVEH
Ga0181423_113712333300017781SeawaterDIIVDMLKGIKHWQEVCKLHWKEIITLAIGLHWLMDLLIIVPISLGIGYLFGVHAQ
Ga0181424_1017299043300017786SeawaterMVNRIKHWKDVCKLHWREIISLAIALHWLLDLLVIVPISLAIGYFFGVH
Ga0206125_1026881233300020165SeawaterMLKKIKHWKDICKVHWKEIVSLAFALHWLLDLLVIVPISIAIGYFFGVHIGHDH
Ga0206131_1001964353300020185SeawaterMIKQIKNWADVCKVHWKEIISLAIALHWVMDLLIIIPLSLAIGYLFGIHVEH
Ga0211654_1000058283300020247MarineMLSKVKHWADVCKIHWKEIISLAIALHWIMDLLIIIPLSLALGFFFGIQFGEH
Ga0211519_1000794123300020266MarineMEIIEKFMITKRIKHWADVCKLHWKEIISLAIALHWLTDLLIIIPLSLVIGYFTGVHFGHGH
Ga0211504_108851013300020347MarineMIERIKHWKDVCKIHWREIISLAIALHWLLDLLVIVPISLAIGYFFGVH
Ga0211505_110065823300020352MarineMLQRIKKWKDVCQLHWKEIISLAIALHWVMDLLIIVPVSIAIGYLFGVHTGHGH
Ga0211477_10000362323300020374MarineVQNLVEKIKHWAGVCKIHWREIITLSIALHWAVDLLIIVPISLVIGYFTGVHFGRH
Ga0211647_1009138753300020377MarineMVERIKHWANVCKIHWKEIITLSIALHWMVDLLIIVPISLAIGYFTGVYFGGH
Ga0211652_10000043373300020379MarineMVERIKHWADVCKIHWKEIISLAIALHWLMDLIIIIPLSLAIGYFTGVHFGGH
Ga0211476_10002193153300020381MarineVQNLVEKIKHWASVCKIHWREIITLSIALHWAVDLLIIVPISLVIGYFTGVHFGRH
Ga0211497_1017778323300020394MarineMVEKIKHWANVCKIHWREIITLSIALHWMVDLLIIVPISLAIGYFTGIHFGGH
Ga0211636_1006858433300020400MarineMLLKVKQWADVCKIHWKEIISLAIALHWLMDLLIIIPLSLAIGYFFGIHIGEH
Ga0211659_1000827533300020404MarineVFKKVKQWADVCKVHWKEIISLAIALHWLMDLLIIIPLSLAIGYFFGVHIGDH
Ga0211516_1049083133300020413MarineAGVCKIHWREIIALSIALHWAVDLLIIVPISLVIGYFTGVHFGRH
Ga0211521_1031506143300020428MarineVCKIHWREIITLSIALHWAVDLLIIVPISLVIGYFTGVHFGRH
Ga0211554_1008400623300020431MarineMVEAIRHWADVCKIHWKEIITLSIALHWVMDLLIIVPISLAIGYFTGVHFGGH
Ga0211565_1019431913300020433MarineMVERIKHWANVCKIHWKEIITLSIALHWMVDLLIIVPISLAIGYFTGVYFG
Ga0211576_1001683873300020438MarineMIKRIKNWADVCKVHWKEIISLAVALHWLMDLLIIIPLSLTIGYLFGIHVEH
Ga0211576_1013936643300020438MarineMVKRIKHWADVCQIHWKEIISLAIALHWLMDLLIIVPISLAIGYFTGVHFGGH
Ga0211576_1052972533300020438MarineMVRKIKHWADVCKLHWKEIITLSIALHWAVDLLIIVPISLAIGYFFGVHIGHNH
Ga0211564_1014282043300020445MarineMVEKIKHWANVCKIHWREIITLSIALHWAVDLLIIVPITLTIGYFTGVHFGGH
Ga0211574_1010700763300020446MarineMVEKIKHWANVCKIHWREIITLSIALHWMVDLLIIVPISLAIGYFTGIHFGGHGH
Ga0211473_1038574423300020451MarineMVEKIKHWANVCKIHWREIITLSIALHWAVDLLIIVPISLAIGYFTGVHFGHHG
Ga0211514_1002078993300020459MarineMIKQIKNWADVCKIHWKEIISLAIALHWVMDLLIIIPLSMAIGYLFGIHVEH
Ga0211676_1003503133300020463MarineMIEKVKHWADVCKLHWKEIISLAVALHWLMDLLIIIPLSLAIGYFFGIHTGHGH
Ga0211676_1061811913300020463MarineMSKRIKHWASVCKIHWREILTLSIALHWAVDLLIIVPISLAIG
Ga0211475_1013436523300020468MarineVQNLVEKIKHWAGVCKIHWREIIALSIALHWAVDLLIIVPISLVIGYFTGVHFGRH
Ga0211577_10005204223300020469MarineMVKRIRHWADVCKLHWKEIISLAVALHWLMDLLIIIPLSLTIGYFFGVHIGHDH
Ga0211577_1010937843300020469MarineMVSKIKHWADVCKLHWKEIITLSIALHWAVDLLIIVPISLAIGYFFGVHIGHNH
Ga0211577_1016943023300020469MarineMVSKIKHWADVCKLHWKEIISLAVALHWLMDLLIIIPLSLTIGYFFGVHIGHDH
Ga0211577_1070860113300020469MarineKHWADVCKLHWKEIITLSIALHWAVDLLIIVPISLAIGYFTGVHFGGH
Ga0211614_1013229513300020471MarineMVKRIKHWAEVCKIHWKEILSLAVALHWLMDLLVIIPLSMLIGYLFGVHIGHDH
Ga0206677_10004282113300021085SeawaterMIKRIKDWADICKVHWKEIISLAIALHWLMDLLIIVPISLAIGYFFGVHIGHTH
Ga0206677_1002447073300021085SeawaterMLKGIKHWQEVCKLHWKEIITLAIGLHWLMDLLIIVPISLGIGYLFGVHAQ
Ga0206677_1014629823300021085SeawaterMIMKIKQWADVCKIHWKEIISLAVALHWLMDLLIIIPLSLAIGYFFGVHIGHPH
Ga0206677_1019887723300021085SeawaterMLKRIKAWKDVCQLHWKEIISLAIALHWVMDLLIIVPISMAIGYLFGVHTGHGH
Ga0206682_1002068753300021185SeawaterMFSKVTQWADVCKIHWKEIVSLAIALHWLMDLLIIIPLSLALGFFFGIQFGEH
Ga0206123_1006321553300021365SeawaterMLKKIKHWKDICKVHWKEIVSLAFALHWLLDLLVIVP
Ga0213865_10001714103300021373SeawaterMEYIETSMILRRIKNWADVCKVHWKEIISLAIALHWIMDLLIIIPLSLLIGYFTGVHFGHGH
Ga0213869_100000121263300021375SeawaterMEYIKTSMILRRIKNWADVCKVHWKEIISLAIALHWIMDLLIIIPLSLLIGYFTGVHFGHGH
Ga0213861_1018533833300021378SeawaterMIMKIKQWADVCKVHWKEIISLAIALHWLMDLLIIIPLSLAIGYFFGVHIGHSH
Ga0222717_10001974143300021957Estuarine WaterMIERIKHWKDVCKTHWREIISLAIALHWLLDLLVIVPISLAIGYFFGVHIGHDH
Ga0222717_1041206423300021957Estuarine WaterMIKRIKEWKDVCKLHWKEIISLAIALHWAMDLLIIVPISIAIGYLFGIHIGH
Ga0224906_122659223300022074SeawaterMVERIKHWAKVCKIHWREIITLSIALHWAVDLLIIVPISLAIGYFTGVHFGGH
Ga0228665_105206313300024235SeawaterMEYIETSMILRRIKNWADVCKVHWKEIISLAIALHWIMDLLIIIPLSLLIGYFT
Ga0228676_113603913300024248SeawaterIKNWADVCKVHWKEIISLAIALHWIMDLLIIIPLSLLIGYFTGVHFGHGH
(restricted) Ga0233438_1007758333300024255SeawaterMIERVKHWKDVCKTHWREIISLAIALHWLLDLLVIVPISLAIGYFFGVHIGHDH
Ga0228661_104945923300024266SeawaterMEYIETSMILRRIKNWADVCKVHWKEIISLAIALHWIMDLLIIIPLSLLIGYFTGVHF
Ga0208298_1000707293300025084MarineMLSRIKHWKDVCQLHWKEIISLAIALHWLMDLLVIVPISLAIGYFFGVHIGHD
Ga0208298_102044523300025084MarineMIKRIKNWADVCKVHWKEIISLAIALHWLMDLLVIVPISLAIGYFFGVHIGHTH
Ga0209535_1000256323300025120MarineMFKKVKQWADVCKIHWKEIISLAIALHWLMDLLIIIPLSLAIGFFFGIHIGEH
Ga0209336_10000171243300025137MarineMVSKIKHWADVCKLHWKEIISLAVALHWLMDLLIIIPLSLTIGYFFGVHIGHSY
Ga0209336_1002311233300025137MarineMITRIKKWADVCKLHWKEIISLAVALHWLMDLLIIIPLSLAIGYMFGVHIGHPH
Ga0209336_1002523973300025137MarineMVSKIKHWADVCKLHWREIITLSIALHWAVDLLIIVPISLAIGYFFGIQVGH
Ga0209634_100202453300025138MarineVITRIKHWADVCKLHWKEIVSLAVALHWFMDLIVIIPLSILIGYMFGIHTGHAH
Ga0209634_107937053300025138MarineMVNKIKHWADVCKLHWKEIISLAVALHWAMDLLIIIPLSLAIGYLFGIHVEH
Ga0209634_129994013300025138MarineQMVSKIKHWADVCKLHWKEIVTLSIALHWAVDLIIIVPISLAIGYFFGIHVAH
Ga0209645_123491323300025151MarineMLSKVKHWADVCKIHWKEIISLAIALHWLMDLLIIIPLSIALGFFFGIQFGEH
Ga0208814_111911213300025276Deep OceanMVGKIKHWAGVCKLHWKEIVSLAVALHWLMDLLIIIPLSLTIGYLFGIHMEH
Ga0209659_119764613300025658MarineMIKRIKEWKDVCKLHWKEIISLAIALHWAMDLLIIVPISIAIGYLFGIHIG
Ga0228647_111685413300026505SeawaterFSKVTQWADVCKIHWKEIVSLAIALHWLMDLLIIIPLSLALGFFFGIQFGEH
Ga0208971_111363133300027582MarineDVCQLHWKEIISLAIALHWVMDLLIIVPISMAIGYLFGVHTGHGH
Ga0208305_1018008823300027753EstuarineIESKSKGKNVMIKRIKEWKDVCKLHWKEIISLAIALHWAMDLLIIVPISIAIGYLFGIHIGH
Ga0209092_1008021353300027833MarineMFAKIKHWKDVCKLHWKEIISLAIALHWAMDLLIIVPISIAIGYLFGVHIGHGH
Ga0209092_1043036433300027833MarineMFAKIKQWQDVCRLHWKEIISLAIALHWVMDLLIIVPVSLAIGYLFGVHTGH
Ga0209712_1029246843300027849MarineMFAKIKHWKDVCKLHWKEIISLAIALHWAMDLLIIVPISIAIGYLFGVHTGHGH
Ga0228674_112770223300028008SeawaterMVNRIKHWKDVCKLHWREIISLAIALHWLLDLLVIVPISLAIGYFFGVHIGHDH
Ga0228621_107781613300028124SeawaterMEYIETSMILRRIKNWADVCKVHWKEIISLAIALHWIMDLLIIIPLSLLIGYFTGV
Ga0228645_107180813300028128SeawaterMFKKVKQWADVCKIHWKEIVSLAIALHWLMDLLIIIPLSMALGFFFGIQFGEH
Ga0228608_102287553300028136SeawaterVTQWADVCKIHWKEIVSLAIALHWLMDLLIIIPLSLALGFFFGIQFGEH
Ga0257106_125662433300028194MarineMVSKIKHWADVCKLHWREIITLSIALHWAVDLLIIVPISLAIGYF
Ga0228613_110486613300028279SeawaterMFSKVTQWADVCKIHWKEIVSLAIALHWLMDLLIIIPLSLALGFFFGIQ
Ga0228615_100845913300028418SeawaterGERIMFKKVKQWADVCKIHWKEIISLAIALHWLMDLLIIIPLSLALGFFFGIQFGEH
Ga0307984_104546823300031658MarineMFAKIKHWKDVCKLHWKEIISLAIALHWVMDLLIIVPISIAIGYLFGVHTGHGH
Ga0315322_1004670233300031766SeawaterMINKIKHWADVCKVHWREIISLAIALHWLMDLLIIVPISLAIGYFFGVHIGHDH
Ga0315320_1002112553300031851SeawaterMINRIKHWADVCKIHWREIISLAVALHWLMDLLIIIPLSLAIGYFFGIHVEH
Ga0315315_1009930283300032073SeawaterMVNRIKHWKDVCKLHWREIISLAIALHWLLDLLVIVPISLAIGY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.