| Basic Information | |
|---|---|
| Family ID | F051838 |
| Family Type | Metagenome |
| Number of Sequences | 143 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKD |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 64.34 % |
| % of genes near scaffold ends (potentially truncated) | 99.30 % |
| % of genes from short scaffolds (< 2000 bps) | 90.21 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.301 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (27.273 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.140 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.434 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.56% β-sheet: 23.26% Coil/Unstructured: 44.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF01734 | Patatin | 43.36 |
| PF00571 | CBS | 9.79 |
| PF09925 | DUF2157 | 5.59 |
| PF03061 | 4HBT | 4.90 |
| PF13414 | TPR_11 | 2.80 |
| PF02540 | NAD_synthase | 2.10 |
| PF00730 | HhH-GPD | 2.10 |
| PF08308 | PEGA | 2.10 |
| PF13360 | PQQ_2 | 1.40 |
| PF09969 | DUF2203 | 0.70 |
| PF05635 | 23S_rRNA_IVP | 0.70 |
| PF13349 | DUF4097 | 0.70 |
| PF10576 | EndIII_4Fe-2S | 0.70 |
| PF02537 | CRCB | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 43.36 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 43.36 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 43.36 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 2.10 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 2.10 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 2.10 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 2.10 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 2.10 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 2.10 |
| COG0239 | Fluoride ion exporter CrcB/FEX, affects chromosome condensation | Cell cycle control, cell division, chromosome partitioning [D] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.30 % |
| Unclassified | root | N/A | 0.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001686|C688J18823_10851445 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 579 | Open in IMG/M |
| 3300002560|JGI25383J37093_10068481 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300002560|JGI25383J37093_10071653 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1074 | Open in IMG/M |
| 3300002908|JGI25382J43887_10051955 | All Organisms → cellular organisms → Bacteria | 2227 | Open in IMG/M |
| 3300004281|Ga0066397_10016001 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1048 | Open in IMG/M |
| 3300005171|Ga0066677_10594004 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 629 | Open in IMG/M |
| 3300005171|Ga0066677_10606225 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300005172|Ga0066683_10622048 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 651 | Open in IMG/M |
| 3300005178|Ga0066688_10815231 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 582 | Open in IMG/M |
| 3300005180|Ga0066685_10152315 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1573 | Open in IMG/M |
| 3300005180|Ga0066685_10507541 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 834 | Open in IMG/M |
| 3300005180|Ga0066685_10759246 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 660 | Open in IMG/M |
| 3300005180|Ga0066685_11104114 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005341|Ga0070691_10659680 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 624 | Open in IMG/M |
| 3300005406|Ga0070703_10073358 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1148 | Open in IMG/M |
| 3300005445|Ga0070708_100559327 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1079 | Open in IMG/M |
| 3300005446|Ga0066686_10203490 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300005447|Ga0066689_10974657 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 522 | Open in IMG/M |
| 3300005451|Ga0066681_10747035 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 593 | Open in IMG/M |
| 3300005467|Ga0070706_100355492 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300005471|Ga0070698_102083606 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 521 | Open in IMG/M |
| 3300005518|Ga0070699_100056757 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3391 | Open in IMG/M |
| 3300005536|Ga0070697_100830662 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300005547|Ga0070693_100393679 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300005553|Ga0066695_10499295 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 747 | Open in IMG/M |
| 3300005558|Ga0066698_10496433 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300005558|Ga0066698_10611035 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 733 | Open in IMG/M |
| 3300005561|Ga0066699_10170942 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1497 | Open in IMG/M |
| 3300005574|Ga0066694_10139555 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1146 | Open in IMG/M |
| 3300005576|Ga0066708_10123532 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1564 | Open in IMG/M |
| 3300005576|Ga0066708_10638920 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 679 | Open in IMG/M |
| 3300005598|Ga0066706_10798277 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 744 | Open in IMG/M |
| 3300006031|Ga0066651_10114206 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1377 | Open in IMG/M |
| 3300006034|Ga0066656_10090276 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
| 3300006046|Ga0066652_101106444 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 750 | Open in IMG/M |
| 3300006049|Ga0075417_10185768 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 979 | Open in IMG/M |
| 3300006791|Ga0066653_10438611 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 666 | Open in IMG/M |
| 3300006796|Ga0066665_11571505 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 516 | Open in IMG/M |
| 3300006797|Ga0066659_11336669 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 598 | Open in IMG/M |
| 3300006797|Ga0066659_11490004 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 566 | Open in IMG/M |
| 3300006852|Ga0075433_10158149 | All Organisms → cellular organisms → Bacteria | 2016 | Open in IMG/M |
| 3300006852|Ga0075433_10338714 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1329 | Open in IMG/M |
| 3300006854|Ga0075425_100837617 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1053 | Open in IMG/M |
| 3300006880|Ga0075429_100829053 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300006880|Ga0075429_101437698 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 600 | Open in IMG/M |
| 3300006903|Ga0075426_10446362 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 958 | Open in IMG/M |
| 3300006903|Ga0075426_10844407 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300006918|Ga0079216_10204547 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1086 | Open in IMG/M |
| 3300007258|Ga0099793_10013810 | All Organisms → cellular organisms → Bacteria | 3197 | Open in IMG/M |
| 3300007265|Ga0099794_10629700 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 569 | Open in IMG/M |
| 3300009012|Ga0066710_100554860 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1738 | Open in IMG/M |
| 3300009012|Ga0066710_100662413 | All Organisms → cellular organisms → Bacteria | 1589 | Open in IMG/M |
| 3300009012|Ga0066710_101044303 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300009012|Ga0066710_101660278 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 975 | Open in IMG/M |
| 3300009089|Ga0099828_11209507 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300009090|Ga0099827_10284198 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1397 | Open in IMG/M |
| 3300009090|Ga0099827_11901318 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
| 3300009137|Ga0066709_100753298 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1406 | Open in IMG/M |
| 3300009137|Ga0066709_102052785 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 791 | Open in IMG/M |
| 3300010303|Ga0134082_10095868 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300010303|Ga0134082_10530423 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 516 | Open in IMG/M |
| 3300010329|Ga0134111_10135641 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 966 | Open in IMG/M |
| 3300010333|Ga0134080_10083906 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1293 | Open in IMG/M |
| 3300010333|Ga0134080_10644009 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 520 | Open in IMG/M |
| 3300010333|Ga0134080_10652399 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 517 | Open in IMG/M |
| 3300010335|Ga0134063_10438008 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 646 | Open in IMG/M |
| 3300010337|Ga0134062_10124921 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1125 | Open in IMG/M |
| 3300011438|Ga0137451_1035017 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1460 | Open in IMG/M |
| 3300012179|Ga0137334_1136233 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 556 | Open in IMG/M |
| 3300012200|Ga0137382_11309574 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
| 3300012203|Ga0137399_10177731 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300012207|Ga0137381_10123659 | All Organisms → cellular organisms → Bacteria | 2212 | Open in IMG/M |
| 3300012207|Ga0137381_10137977 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2092 | Open in IMG/M |
| 3300012207|Ga0137381_10665467 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 906 | Open in IMG/M |
| 3300012209|Ga0137379_11838172 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012210|Ga0137378_10454599 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300012285|Ga0137370_10227270 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1101 | Open in IMG/M |
| 3300012918|Ga0137396_10467024 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 935 | Open in IMG/M |
| 3300012925|Ga0137419_10421047 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1047 | Open in IMG/M |
| 3300012944|Ga0137410_11880296 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 530 | Open in IMG/M |
| 3300012948|Ga0126375_10806235 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 744 | Open in IMG/M |
| 3300012971|Ga0126369_10770372 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300012972|Ga0134077_10365014 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 618 | Open in IMG/M |
| 3300012972|Ga0134077_10406054 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 589 | Open in IMG/M |
| 3300012975|Ga0134110_10429916 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 590 | Open in IMG/M |
| 3300012976|Ga0134076_10034443 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
| 3300014150|Ga0134081_10016989 | All Organisms → cellular organisms → Bacteria | 2020 | Open in IMG/M |
| 3300014157|Ga0134078_10056586 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1372 | Open in IMG/M |
| 3300014157|Ga0134078_10259611 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300014157|Ga0134078_10270378 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 720 | Open in IMG/M |
| 3300014166|Ga0134079_10043594 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1554 | Open in IMG/M |
| 3300015052|Ga0137411_1265225 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 728 | Open in IMG/M |
| 3300015356|Ga0134073_10037795 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1244 | Open in IMG/M |
| 3300015359|Ga0134085_10333828 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 671 | Open in IMG/M |
| 3300017659|Ga0134083_10100033 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300018054|Ga0184621_10129164 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 906 | Open in IMG/M |
| 3300018431|Ga0066655_10105749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1587 | Open in IMG/M |
| 3300018431|Ga0066655_10423983 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 878 | Open in IMG/M |
| 3300018431|Ga0066655_10826257 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 631 | Open in IMG/M |
| 3300018433|Ga0066667_10253445 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1336 | Open in IMG/M |
| 3300018433|Ga0066667_10385222 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1128 | Open in IMG/M |
| 3300018468|Ga0066662_10862658 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 885 | Open in IMG/M |
| 3300018482|Ga0066669_11042463 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 738 | Open in IMG/M |
| 3300018482|Ga0066669_11248427 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 671 | Open in IMG/M |
| 3300019360|Ga0187894_10217768 | Not Available | 922 | Open in IMG/M |
| 3300019877|Ga0193722_1001704 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 5202 | Open in IMG/M |
| 3300020004|Ga0193755_1028155 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300020004|Ga0193755_1126426 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 793 | Open in IMG/M |
| 3300021344|Ga0193719_10006190 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 4930 | Open in IMG/M |
| 3300026295|Ga0209234_1056778 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1489 | Open in IMG/M |
| 3300026296|Ga0209235_1205658 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 667 | Open in IMG/M |
| 3300026297|Ga0209237_1043562 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2324 | Open in IMG/M |
| 3300026298|Ga0209236_1060227 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
| 3300026298|Ga0209236_1066230 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
| 3300026300|Ga0209027_1141685 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 825 | Open in IMG/M |
| 3300026301|Ga0209238_1215864 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 564 | Open in IMG/M |
| 3300026313|Ga0209761_1140039 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300026313|Ga0209761_1192543 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 908 | Open in IMG/M |
| 3300026315|Ga0209686_1096254 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300026315|Ga0209686_1122453 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 865 | Open in IMG/M |
| 3300026317|Ga0209154_1103844 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1210 | Open in IMG/M |
| 3300026318|Ga0209471_1019690 | All Organisms → cellular organisms → Bacteria | 3418 | Open in IMG/M |
| 3300026324|Ga0209470_1239893 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 733 | Open in IMG/M |
| 3300026324|Ga0209470_1386894 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 500 | Open in IMG/M |
| 3300026329|Ga0209375_1274010 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 555 | Open in IMG/M |
| 3300026331|Ga0209267_1337061 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 500 | Open in IMG/M |
| 3300026343|Ga0209159_1002017 | All Organisms → cellular organisms → Bacteria | 14630 | Open in IMG/M |
| 3300026527|Ga0209059_1015212 | All Organisms → cellular organisms → Bacteria | 3491 | Open in IMG/M |
| 3300026527|Ga0209059_1110238 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1083 | Open in IMG/M |
| 3300026532|Ga0209160_1000581 | All Organisms → cellular organisms → Bacteria | 30465 | Open in IMG/M |
| 3300026532|Ga0209160_1163043 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 988 | Open in IMG/M |
| 3300026537|Ga0209157_1107791 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300026538|Ga0209056_10237129 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1305 | Open in IMG/M |
| 3300026540|Ga0209376_1069454 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
| 3300026547|Ga0209156_10299016 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 727 | Open in IMG/M |
| 3300026557|Ga0179587_10996042 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 552 | Open in IMG/M |
| 3300027778|Ga0209464_10074243 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1143 | Open in IMG/M |
| 3300027787|Ga0209074_10267754 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 671 | Open in IMG/M |
| 3300027875|Ga0209283_10348082 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300027875|Ga0209283_10417548 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300031152|Ga0307501_10206846 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11 | 564 | Open in IMG/M |
| 3300031740|Ga0307468_100334654 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1120 | Open in IMG/M |
| 3300032180|Ga0307471_100427623 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 27.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 18.18% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 13.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.59% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.50% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.40% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.40% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.40% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.70% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.70% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J18823_108514452 | 3300001686 | Soil | MRASEVMIADPVVAAAGATSSEVAALMRIKNISVVPVVDN |
| JGI25383J37093_100684812 | 3300002560 | Grasslands Soil | LRASEVMIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNP |
| JGI25383J37093_100716531 | 3300002560 | Grasslands Soil | MRASEIMIADPVVAAAGATSAEVAALMRVKNISVVPVVDN |
| JGI25382J43887_100519551 | 3300002908 | Grasslands Soil | LRASDVMIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNP |
| Ga0066397_100160012 | 3300004281 | Tropical Forest Soil | MRASEVMIAEPVVAAAGATSSEVAALMRVKNISVVPVVDNPKDRKYLGT |
| Ga0066677_105940042 | 3300005171 | Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPK |
| Ga0066677_106062252 | 3300005171 | Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDR |
| Ga0066683_106220481 | 3300005172 | Soil | LRASEVMIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDRRYLG |
| Ga0066688_108152311 | 3300005178 | Soil | MLAREIMIPEPFVAAAGATSAELALLMRAKDISVVPLVDNPKDRRY |
| Ga0066685_101523151 | 3300005180 | Soil | MLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYLGTI |
| Ga0066685_105075411 | 3300005180 | Soil | MIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYLGTI |
| Ga0066685_107592462 | 3300005180 | Soil | LLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPK |
| Ga0066685_111041141 | 3300005180 | Soil | MLAREIMIPEPFVAAAGATTAEVALLMRAKDISVVPVVDNPKDR |
| Ga0070691_106596801 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | LLARDVMIASPVVVAAGATSAEVASLMKLRNISVAPVVDNPKDLGYLG |
| Ga0070703_100733581 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAHEIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNP |
| Ga0070708_1005593271 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKD |
| Ga0066686_102034902 | 3300005446 | Soil | MLAREIMIPEPFVAAAGATSAEVALLMVAKDISVVPVVDNPK |
| Ga0066689_109746571 | 3300005447 | Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDN |
| Ga0066681_107470351 | 3300005451 | Soil | MRASEVMIADPVVAAAGATSAEVAALMRVKNISVVPVVDNPKDRR |
| Ga0070706_1003554921 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRY |
| Ga0070698_1020836061 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VLAREIMIPEPFVAAAGATSAEVAVLMRMKDISVVPVVDNPKDRR |
| Ga0070699_1000567575 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VLAREIMIPEPFVAAAGATSAEVAVLMRMKDISVVPVVDNPKDRRY |
| Ga0070697_1008306621 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VLASAVMIADPLAAAAGATSAEVAALMRSRNISVVPVIDNPKD |
| Ga0070693_1003936791 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MRASEVMITDVIVAAAGATSSEVAALMRVKNISVVPVVDNP |
| Ga0066695_104992952 | 3300005553 | Soil | VLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPK |
| Ga0066698_104964331 | 3300005558 | Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVV |
| Ga0066698_106110352 | 3300005558 | Soil | MIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRY |
| Ga0066699_101709423 | 3300005561 | Soil | VLAREIMIPEPFVAAAGATSAEVALLMQAKDISVVP |
| Ga0066694_101395553 | 3300005574 | Soil | MLAREIMIPEPFVAAAGATSSEVALLMRAKDISVVP |
| Ga0066708_101235323 | 3300005576 | Soil | MHASEVMIPDPVVAAAGATSSEVAALMRVKDISVVPVVD |
| Ga0066708_106389202 | 3300005576 | Soil | VLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVP |
| Ga0066706_107982772 | 3300005598 | Soil | MIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDRRYLG |
| Ga0066651_101142061 | 3300006031 | Soil | MIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNP |
| Ga0066656_100902761 | 3300006034 | Soil | MRASEVMVADPIVAAAGATSSEVAALMRVKNISVVPVVDN |
| Ga0066652_1011064441 | 3300006046 | Soil | MIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYLGTIS |
| Ga0075417_101857682 | 3300006049 | Populus Rhizosphere | MRASEVMIADPVVAAAGATSSEVAALMRLKNISVVPVVDNPKDRHYMG |
| Ga0066653_104386111 | 3300006791 | Soil | MIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDLRYLGTISD |
| Ga0066665_115715052 | 3300006796 | Soil | LRASEVMIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDRRYLGTI |
| Ga0066659_113366691 | 3300006797 | Soil | LRASDVMIPDPYVAAAGATSAEVAALMRMKDISVVP |
| Ga0066659_114900042 | 3300006797 | Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYLG |
| Ga0075433_101581493 | 3300006852 | Populus Rhizosphere | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPV |
| Ga0075433_103387141 | 3300006852 | Populus Rhizosphere | MRASEVMIADPIVVAAGATSSEVAALMRTKNISVVPVV |
| Ga0075425_1008376171 | 3300006854 | Populus Rhizosphere | MRASEVMIADPVVAAAGATSSEVAALMRLKNISVVPVV |
| Ga0075429_1008290532 | 3300006880 | Populus Rhizosphere | MRASEVMIADPIVVAAGATSSEVAALMRIKNISVVPVVDN |
| Ga0075429_1014376982 | 3300006880 | Populus Rhizosphere | MKASEVMIPDPLVAAAGATSSEVAALMRLKNISVVPVV |
| Ga0075426_104463622 | 3300006903 | Populus Rhizosphere | MRASEIMIKDPVVAAAGATSAEVATLMRMKDISVVPVVDNPKDRRYL |
| Ga0075426_108444071 | 3300006903 | Populus Rhizosphere | MRAQDIMIADPVVAAAGATSAEVATLMRMKDISVVPVVDNPKDRRY |
| Ga0079216_102045473 | 3300006918 | Agricultural Soil | MKASEAMIPEPIVAAAGATTSEVAALMRIKNIAVVPVVDNPKDRRYLGT |
| Ga0099793_100138104 | 3300007258 | Vadose Zone Soil | MRASEVMIADPVVAAAGATSSEVAALMRLKNISVVPVVDNPKDRHY |
| Ga0099794_106297001 | 3300007265 | Vadose Zone Soil | MRASEVMIGDPVVAAAGATSAEVAHLMRAKNISVVPVVDNPK |
| Ga0066710_1005548601 | 3300009012 | Grasslands Soil | MIFVPYVVAAGATRDAVALLMRATDISVVPVVDNHKARRYLGMLSDRDFVTGGV |
| Ga0066710_1006624131 | 3300009012 | Grasslands Soil | VLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKD |
| Ga0066710_1010443033 | 3300009012 | Grasslands Soil | MIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDRRYLGTIS |
| Ga0066710_1016602781 | 3300009012 | Grasslands Soil | MIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDRRYLGTISD |
| Ga0099828_112095072 | 3300009089 | Vadose Zone Soil | MLAREIMIPEPFVAAAGATSSEVALLMRAKDISVVPVVDNPKDRRY |
| Ga0099827_102841981 | 3300009090 | Vadose Zone Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKGISVVPVVDN |
| Ga0099827_119013182 | 3300009090 | Vadose Zone Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISTVPVVDNPKD |
| Ga0066709_1007532983 | 3300009137 | Grasslands Soil | MIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYLGTISD |
| Ga0066709_1020527852 | 3300009137 | Grasslands Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDRR |
| Ga0134082_100958681 | 3300010303 | Grasslands Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRY |
| Ga0134082_105304232 | 3300010303 | Grasslands Soil | MIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPK |
| Ga0134111_101356411 | 3300010329 | Grasslands Soil | MRAAEVMIADPVVAAAGATSSEVAALMRIKNISVVPV |
| Ga0134080_100839061 | 3300010333 | Grasslands Soil | MLAREIMIPEPFVAAAGATSSEVALLMRAKDISVVPVVDNPKDRRYLGT |
| Ga0134080_106440091 | 3300010333 | Grasslands Soil | MIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYL |
| Ga0134080_106523992 | 3300010333 | Grasslands Soil | MRASEVMIADPVVAAAGATSSEVAALMRVKNISVVPVVDNPKDR |
| Ga0134063_104380081 | 3300010335 | Grasslands Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPL |
| Ga0134062_101249212 | 3300010337 | Grasslands Soil | LIQEVPVLAREIMIPEPFVAAAGATSAELALLMRAKDISVVPVVDNPKD |
| Ga0137451_10350171 | 3300011438 | Soil | MIADPIVVAAGATSSEVAALMRTKNISVVPVVDNPK |
| Ga0137334_11362331 | 3300012179 | Soil | MRASEVMIADPVVAAAGATSAEVAALMRVKNISVVP |
| Ga0137382_113095741 | 3300012200 | Vadose Zone Soil | MLAREIMIPEPLVAAAGATSAEVALLMRAKDISVVPVVDNPKDR |
| Ga0137399_101777314 | 3300012203 | Vadose Zone Soil | MIPEPFVAAAGATSAEVALVMRAKDISVVPVVDNPKDRRY |
| Ga0137381_101236591 | 3300012207 | Vadose Zone Soil | MRASEVMIRDPVVAAAGATSAEVATLMRMKDISVVPVVDNPKD |
| Ga0137381_101379774 | 3300012207 | Vadose Zone Soil | MIPEPVVAAAGATSAEVALLMRAKDISVVPVVDNP |
| Ga0137381_106654672 | 3300012207 | Vadose Zone Soil | MIPDPDVAAAGASSAEVAALMRMKDISVVPVVDNT |
| Ga0137379_118381721 | 3300012209 | Vadose Zone Soil | MIPEPVVVAAGATSAEVALLMRAKDISVVPVVDNPKDRRYL |
| Ga0137378_104545991 | 3300012210 | Vadose Zone Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPLVDNPKDRRYLGTISD |
| Ga0137370_102272704 | 3300012285 | Vadose Zone Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDIPVVPLLDNPKDRS* |
| Ga0137396_104670241 | 3300012918 | Vadose Zone Soil | MRASEVMIADPVVAAAGATSSEVAALMRVKNISVVPVVDNPKDLHYLGT |
| Ga0137419_104210472 | 3300012925 | Vadose Zone Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVD |
| Ga0137410_118802961 | 3300012944 | Vadose Zone Soil | MRASEVMIADPVVAAAGATSSEVAALMRLKNISVVPVVDNPKDRH |
| Ga0126375_108062352 | 3300012948 | Tropical Forest Soil | MRASEVMIADPVVAAAGATSSEVAALMRMKNISVV |
| Ga0126369_107703721 | 3300012971 | Tropical Forest Soil | MIPDPLVAAAGATSAEVAALMRSRNISVVPVIDNPKDRRYLGTV |
| Ga0134077_103650141 | 3300012972 | Grasslands Soil | MHASEVMIPDPVVAAAGATSSEVAALMRVKDISVVPVVDNPKDRRYM |
| Ga0134077_104060542 | 3300012972 | Grasslands Soil | MRASEVMITDVIVAAAGATSSEVAALMRVKNISVVPVVD |
| Ga0134110_104299162 | 3300012975 | Grasslands Soil | MIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNP |
| Ga0134076_100344434 | 3300012976 | Grasslands Soil | MVADPIVAAAGATSSEVAALMRVKNISVVPVVDNPKDRHY |
| Ga0134081_100169891 | 3300014150 | Grasslands Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYL |
| Ga0134078_100565861 | 3300014157 | Grasslands Soil | MVTDVIVAAAGATSAEVAALMRVKNISVVPVVDNPKD |
| Ga0134078_102596111 | 3300014157 | Grasslands Soil | MLAREIMIPEPFVAAAGATSAEVALLMVAKDISVVPLVDNPKDRRYL |
| Ga0134078_102703781 | 3300014157 | Grasslands Soil | LLAREIMIPEPFVAAAGATSAELALLMRAKDISVVPVVDNPKDR |
| Ga0134079_100435941 | 3300014166 | Grasslands Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVV |
| Ga0137411_12652251 | 3300015052 | Vadose Zone Soil | MIADPVVAAAGATSSEVAALMRMKNISVVPVVDNPKDRHYPTAERFPIVI |
| Ga0134073_100377951 | 3300015356 | Grasslands Soil | MLAREIMIPEPFVAAAGATSAEVALLMVAKDISVVPVVDNPKD |
| Ga0134085_103338282 | 3300015359 | Grasslands Soil | MLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNP |
| Ga0134083_101000331 | 3300017659 | Grasslands Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPLVDNPKDRRYLGT |
| Ga0184621_101291641 | 3300018054 | Groundwater Sediment | MRASEVMIADPVVAAAGATSSEVAALMRMKNISVVPVVDNPKDRHYLGT |
| Ga0066655_101057492 | 3300018431 | Grasslands Soil | MLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPK |
| Ga0066655_104239831 | 3300018431 | Grasslands Soil | AHLITGVPLLAREIMIPEPFVAAAGATSAELALLMRAKDISVVPVVDNPKDRR |
| Ga0066655_108262571 | 3300018431 | Grasslands Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPLVDNPKDRRY |
| Ga0066667_102534453 | 3300018433 | Grasslands Soil | MRAAEVMIADPVVAAAGATSAEVDALMRVKNIYVVPVVDNHKDRRYQGTISDRNIVAH |
| Ga0066667_103852223 | 3300018433 | Grasslands Soil | MRASEVMIADPVIAAAGATSSEVAALMRLKNISVV |
| Ga0066662_108626582 | 3300018468 | Grasslands Soil | MRAAEVMILDPVVAAAGATSSEIAALMRVKNISVVPVVDNP |
| Ga0066669_110424632 | 3300018482 | Grasslands Soil | MIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYLG |
| Ga0066669_112484271 | 3300018482 | Grasslands Soil | MRASEMMVTDVIVAAAGATSAEVAALMRVKNISVVPVVDNPKDRHYLGT |
| Ga0187894_102177681 | 3300019360 | Microbial Mat On Rocks | LLASSVMIPDPLCAAAGATSAEVAALMRTKNISVVPVIDN |
| Ga0193722_10017047 | 3300019877 | Soil | MRASEVMIADPVVAAAGATSSEVAALMRVKNISVVPVVDNP |
| Ga0193755_10281552 | 3300020004 | Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVP |
| Ga0193755_11264262 | 3300020004 | Soil | MRASEVMIADPVVAAAGATSSEVAALMRVKNISVVPVVDNPKDRHY |
| Ga0193719_100061901 | 3300021344 | Soil | MRASEVMVADPVVAAAGATSSEVAALMRLKNISVVP |
| Ga0209234_10567781 | 3300026295 | Grasslands Soil | MLAREIMIPEPFVAAAGATSAELALLMRAKDISVVP |
| Ga0209235_12056581 | 3300026296 | Grasslands Soil | VLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVP |
| Ga0209237_10435624 | 3300026297 | Grasslands Soil | MIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDRRYL |
| Ga0209236_10602271 | 3300026298 | Grasslands Soil | MIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNP |
| Ga0209236_10662304 | 3300026298 | Grasslands Soil | MRASEVMIADPVVAAAGATSAEVAALMRVKNISVVPVVD |
| Ga0209027_11416852 | 3300026300 | Grasslands Soil | MIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYL |
| Ga0209238_12158642 | 3300026301 | Grasslands Soil | MIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDRRY |
| Ga0209761_11400393 | 3300026313 | Grasslands Soil | MRASEVMIADPVVAAAGATSAEVAALMRVKNISVVPVVDN |
| Ga0209761_11925431 | 3300026313 | Grasslands Soil | MLAREIMIPEPFVAAAGATSAELALLMRAKDISVVPLVDNPKDRRYLG |
| Ga0209686_10962541 | 3300026315 | Soil | MLAREIMIPEPFVAAAGATSAEVALLMQAKDISVVPAV |
| Ga0209686_11224532 | 3300026315 | Soil | MRAAEVMIADPVVAAAGATSAEVAALMRVKNISVVP |
| Ga0209154_11038443 | 3300026317 | Soil | VGGVRADTLRAMLAREIMIPEPLVAAAGATSAEVALLMRAKDISVVPVVDNPKDR |
| Ga0209471_10196901 | 3300026318 | Soil | MIPEPFVAAAGATSAEVALLMRGKDISVVPVVDNPKDRRYLGTI |
| Ga0209470_12398931 | 3300026324 | Soil | MLAREIMIPEPFVAAAGATSAEVALLMRGKDISVV |
| Ga0209470_13868942 | 3300026324 | Soil | MRASEVMVADPIVAAAGATSSEVAALMRVKNISVVPVVD |
| Ga0209375_12740102 | 3300026329 | Soil | LLAREIMIPEPFVAAAGATSAELALLMRAKDISVVPVVDNPKDRR |
| Ga0209267_13370612 | 3300026331 | Soil | MRASEVMIADPVVAAAGATSSEVAALMRVKNISVVPVVDNPKDRHYLG |
| Ga0209159_100201712 | 3300026343 | Soil | MIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDR |
| Ga0209059_10152121 | 3300026527 | Soil | VLAREIMIPEPFVAAAGATSAEVALLMQAKDISVVPVV |
| Ga0209059_11102381 | 3300026527 | Soil | MLAREIMIPEPFVAAAGATSAEVALLMQAKDISVVPVV |
| Ga0209160_100058131 | 3300026532 | Soil | LLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYL |
| Ga0209160_11630431 | 3300026532 | Soil | MLAREIMIPEPFVAAAGATSAEVALLMRGKDISVVP |
| Ga0209157_11077912 | 3300026537 | Soil | MLAREIMIPEPFVAAAGATSAEVALLMVAKDISVVPVVDNP |
| Ga0209056_102371291 | 3300026538 | Soil | MIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDRRYLGTI |
| Ga0209376_10694541 | 3300026540 | Soil | MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPLVD |
| Ga0209156_102990162 | 3300026547 | Soil | MIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYLGTI |
| Ga0179587_109960422 | 3300026557 | Vadose Zone Soil | VLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYLGT |
| Ga0209464_100742431 | 3300027778 | Wetland Sediment | MRASEVMIPEPIVAAAGATTSEVAALMRIKNIAVVP |
| Ga0209074_102677541 | 3300027787 | Agricultural Soil | MKAADVMIADPVVAAAGATCAEIAALMRIKNISVVPVVD |
| Ga0209283_103480821 | 3300027875 | Vadose Zone Soil | MIPDPYVAAAGATSAEVAALMRMKNISVVPVVDNPKDRRYLGT |
| Ga0209283_104175481 | 3300027875 | Vadose Zone Soil | VLASAVMIADPLVAAAGATSAEVAALMRSRNISVVPV |
| Ga0307501_102068462 | 3300031152 | Soil | MRAAEVMIADPVVAAAGATSSEIAALMRVKNLSVVPVVDNPKDRKYLG |
| Ga0307468_1003346543 | 3300031740 | Hardwood Forest Soil | MRASEVMIADPVVAAAGATSSEVAALMRVKNISVVPVVDNPKDRH |
| Ga0307471_1004276233 | 3300032180 | Hardwood Forest Soil | LLAREIMIPEPFVAAAGATSAEVALLMQMKDISVVPVVDNP |
| ⦗Top⦘ |