| Basic Information | |
|---|---|
| Family ID | F051821 |
| Family Type | Metagenome |
| Number of Sequences | 143 |
| Average Sequence Length | 46 residues |
| Representative Sequence | TQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 76.92 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.301 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (17.483 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.664 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.343 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 75.56% β-sheet: 0.00% Coil/Unstructured: 24.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF00082 | Peptidase_S8 | 24.48 |
| PF13242 | Hydrolase_like | 16.78 |
| PF13344 | Hydrolase_6 | 11.89 |
| PF07883 | Cupin_2 | 2.10 |
| PF01636 | APH | 2.10 |
| PF00561 | Abhydrolase_1 | 1.40 |
| PF03823 | Neurokinin_B | 0.70 |
| PF04675 | DNA_ligase_A_N | 0.70 |
| PF13670 | PepSY_2 | 0.70 |
| PF01590 | GAF | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.30 % |
| Unclassified | root | N/A | 0.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0716518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 944 | Open in IMG/M |
| 3300000956|JGI10216J12902_108890621 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300000956|JGI10216J12902_108965234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 503 | Open in IMG/M |
| 3300005166|Ga0066674_10169301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1035 | Open in IMG/M |
| 3300005166|Ga0066674_10418761 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005178|Ga0066688_10502601 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300005181|Ga0066678_10514476 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300005336|Ga0070680_100188951 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
| 3300005336|Ga0070680_100241597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1526 | Open in IMG/M |
| 3300005340|Ga0070689_101396194 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005343|Ga0070687_100496626 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300005345|Ga0070692_10053150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae | 2111 | Open in IMG/M |
| 3300005345|Ga0070692_10619475 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005345|Ga0070692_10697955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 682 | Open in IMG/M |
| 3300005364|Ga0070673_101000109 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300005406|Ga0070703_10018055 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
| 3300005444|Ga0070694_100095841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae | 2090 | Open in IMG/M |
| 3300005444|Ga0070694_100273068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1286 | Open in IMG/M |
| 3300005444|Ga0070694_100285621 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300005444|Ga0070694_100294548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1241 | Open in IMG/M |
| 3300005445|Ga0070708_102230528 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005446|Ga0066686_10055450 | All Organisms → cellular organisms → Bacteria | 2433 | Open in IMG/M |
| 3300005446|Ga0066686_11037269 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005467|Ga0070706_100019473 | All Organisms → cellular organisms → Bacteria | 6258 | Open in IMG/M |
| 3300005467|Ga0070706_100252211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1647 | Open in IMG/M |
| 3300005467|Ga0070706_101094744 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005468|Ga0070707_100645084 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300005468|Ga0070707_100888593 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300005471|Ga0070698_100210661 | All Organisms → cellular organisms → Bacteria | 1878 | Open in IMG/M |
| 3300005471|Ga0070698_100271248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1628 | Open in IMG/M |
| 3300005471|Ga0070698_101434190 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005518|Ga0070699_101234980 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005536|Ga0070697_100959494 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300005536|Ga0070697_101205834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 674 | Open in IMG/M |
| 3300005559|Ga0066700_10660625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 722 | Open in IMG/M |
| 3300005577|Ga0068857_100006049 | All Organisms → cellular organisms → Bacteria | 10337 | Open in IMG/M |
| 3300005615|Ga0070702_101714704 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005844|Ga0068862_100983813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 833 | Open in IMG/M |
| 3300006049|Ga0075417_10039032 | All Organisms → cellular organisms → Bacteria | 2006 | Open in IMG/M |
| 3300006796|Ga0066665_10069248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2500 | Open in IMG/M |
| 3300006796|Ga0066665_10242004 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
| 3300006844|Ga0075428_101576950 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300006852|Ga0075433_10415489 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300006854|Ga0075425_100680964 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300006876|Ga0079217_10031536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1983 | Open in IMG/M |
| 3300006876|Ga0079217_10117806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1227 | Open in IMG/M |
| 3300006876|Ga0079217_10118621 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300006903|Ga0075426_10308360 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300006969|Ga0075419_10052401 | All Organisms → cellular organisms → Bacteria | 2567 | Open in IMG/M |
| 3300006969|Ga0075419_10082192 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
| 3300007004|Ga0079218_11721262 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300009012|Ga0066710_100076273 | All Organisms → cellular organisms → Bacteria | 4337 | Open in IMG/M |
| 3300009012|Ga0066710_100082004 | All Organisms → cellular organisms → Bacteria | 4211 | Open in IMG/M |
| 3300009012|Ga0066710_100390021 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2072 | Open in IMG/M |
| 3300009012|Ga0066710_100403918 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
| 3300009036|Ga0105244_10481703 | Not Available | 571 | Open in IMG/M |
| 3300009089|Ga0099828_11762144 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300009089|Ga0099828_11843460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 531 | Open in IMG/M |
| 3300009090|Ga0099827_10913301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 761 | Open in IMG/M |
| 3300009137|Ga0066709_100329377 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2088 | Open in IMG/M |
| 3300009147|Ga0114129_10326760 | All Organisms → cellular organisms → Bacteria | 2038 | Open in IMG/M |
| 3300009147|Ga0114129_11282380 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300009147|Ga0114129_12282930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 650 | Open in IMG/M |
| 3300009176|Ga0105242_11940524 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300009176|Ga0105242_12199846 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300010304|Ga0134088_10058091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1784 | Open in IMG/M |
| 3300010323|Ga0134086_10204004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 739 | Open in IMG/M |
| 3300010329|Ga0134111_10029586 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1904 | Open in IMG/M |
| 3300010336|Ga0134071_10034869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2219 | Open in IMG/M |
| 3300010336|Ga0134071_10433386 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300010375|Ga0105239_11867687 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300010399|Ga0134127_10135131 | All Organisms → cellular organisms → Bacteria | 2216 | Open in IMG/M |
| 3300010400|Ga0134122_11319245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 730 | Open in IMG/M |
| 3300010401|Ga0134121_11171324 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300010403|Ga0134123_10354135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1327 | Open in IMG/M |
| 3300010403|Ga0134123_10717749 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300012096|Ga0137389_10199267 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300012203|Ga0137399_10053097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2956 | Open in IMG/M |
| 3300012204|Ga0137374_10749996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 728 | Open in IMG/M |
| 3300012210|Ga0137378_11053380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 728 | Open in IMG/M |
| 3300012225|Ga0137434_1085688 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300012353|Ga0137367_10658599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 730 | Open in IMG/M |
| 3300012355|Ga0137369_10025764 | All Organisms → cellular organisms → Bacteria | 5469 | Open in IMG/M |
| 3300012355|Ga0137369_10059312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3296 | Open in IMG/M |
| 3300012356|Ga0137371_10713787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 766 | Open in IMG/M |
| 3300012359|Ga0137385_10404383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1164 | Open in IMG/M |
| 3300012359|Ga0137385_10475723 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300012360|Ga0137375_10621800 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300012532|Ga0137373_10112507 | All Organisms → cellular organisms → Bacteria | 2357 | Open in IMG/M |
| 3300012532|Ga0137373_10292155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1299 | Open in IMG/M |
| 3300012685|Ga0137397_10310429 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300012922|Ga0137394_10127313 | All Organisms → cellular organisms → Bacteria | 2158 | Open in IMG/M |
| 3300012922|Ga0137394_11195272 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300013308|Ga0157375_11947073 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300014745|Ga0157377_10293510 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300015371|Ga0132258_12850785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1203 | Open in IMG/M |
| 3300018000|Ga0184604_10112345 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300018000|Ga0184604_10196731 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300018000|Ga0184604_10263927 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300018027|Ga0184605_10339003 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300018028|Ga0184608_10013663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2822 | Open in IMG/M |
| 3300018028|Ga0184608_10518476 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300018031|Ga0184634_10496155 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300018056|Ga0184623_10010248 | All Organisms → cellular organisms → Bacteria | 4037 | Open in IMG/M |
| 3300018056|Ga0184623_10255622 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300018075|Ga0184632_10301500 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300018482|Ga0066669_12394674 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300019869|Ga0193705_1095732 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300021363|Ga0193699_10168382 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300021363|Ga0193699_10220795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 788 | Open in IMG/M |
| 3300022534|Ga0224452_1250445 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300022694|Ga0222623_10075514 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300025885|Ga0207653_10002733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5613 | Open in IMG/M |
| 3300025908|Ga0207643_10223650 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300025910|Ga0207684_10394230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1190 | Open in IMG/M |
| 3300025912|Ga0207707_10084037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2780 | Open in IMG/M |
| 3300025912|Ga0207707_10936016 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300025917|Ga0207660_10021485 | All Organisms → cellular organisms → Bacteria | 4339 | Open in IMG/M |
| 3300025935|Ga0207709_11062752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 664 | Open in IMG/M |
| 3300026023|Ga0207677_11505229 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300026075|Ga0207708_10103467 | All Organisms → cellular organisms → Bacteria | 2206 | Open in IMG/M |
| 3300026075|Ga0207708_10863752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 782 | Open in IMG/M |
| 3300026089|Ga0207648_11535183 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300026116|Ga0207674_10195090 | All Organisms → cellular organisms → Bacteria | 1975 | Open in IMG/M |
| 3300026118|Ga0207675_100359373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1428 | Open in IMG/M |
| 3300026323|Ga0209472_1060194 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300026323|Ga0209472_1091817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1221 | Open in IMG/M |
| 3300026324|Ga0209470_1021050 | All Organisms → cellular organisms → Bacteria | 3516 | Open in IMG/M |
| 3300026324|Ga0209470_1047217 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2096 | Open in IMG/M |
| 3300027395|Ga0209996_1021328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 912 | Open in IMG/M |
| 3300027873|Ga0209814_10013463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3251 | Open in IMG/M |
| 3300027873|Ga0209814_10112583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1159 | Open in IMG/M |
| 3300027880|Ga0209481_10043699 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
| 3300028380|Ga0268265_10965929 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300028799|Ga0307284_10357952 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300028814|Ga0307302_10242767 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300028814|Ga0307302_10350654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 728 | Open in IMG/M |
| 3300028819|Ga0307296_10068701 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
| 3300028824|Ga0307310_10064086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1563 | Open in IMG/M |
| 3300028828|Ga0307312_10350004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 966 | Open in IMG/M |
| 3300028878|Ga0307278_10146650 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300031965|Ga0326597_10700927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1065 | Open in IMG/M |
| 3300032075|Ga0310890_11522200 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 17.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.19% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.20% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.50% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.10% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.10% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.40% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.40% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.70% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.70% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_07165181 | 3300000033 | Soil | ELRANSGTQFNPVVVEAFIXTVVGERRKXARGAESPHQQVYQQAVEAVRVSL* |
| JGI10216J12902_1088906214 | 3300000956 | Soil | AMSAKAALRELRANSGTQFNPVVVEAFIKTVVGERRKTARGAESPHQQVYQQAVEAVRVSL* |
| JGI10216J12902_1089652341 | 3300000956 | Soil | VVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVSL* |
| Ga0066674_101693011 | 3300005166 | Soil | NPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVSL* |
| Ga0066674_104187612 | 3300005166 | Soil | NPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVAL* |
| Ga0066688_105026011 | 3300005178 | Soil | RELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRITL* |
| Ga0066678_105144762 | 3300005181 | Soil | LSAKAALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVAL |
| Ga0070680_1001889511 | 3300005336 | Corn Rhizosphere | SGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVQAVRSTF* |
| Ga0070680_1002415971 | 3300005336 | Corn Rhizosphere | SGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL* |
| Ga0070689_1013961942 | 3300005340 | Switchgrass Rhizosphere | PVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTF* |
| Ga0070687_1004966261 | 3300005343 | Switchgrass Rhizosphere | NSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTI* |
| Ga0070692_100531501 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | PALSAKQALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVQAVRSTF* |
| Ga0070692_106194751 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | PALSAKQALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVQL* |
| Ga0070692_106979554 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | PVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL* |
| Ga0070673_1010001092 | 3300005364 | Switchgrass Rhizosphere | AKQALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTF* |
| Ga0070703_100180553 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | PVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVQAVRSTF* |
| Ga0070694_1000958413 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AKQALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVQAVRSTF* |
| Ga0070694_1002730684 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | TQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL* |
| Ga0070694_1002856211 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | TQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTF* |
| Ga0070694_1002945484 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | SGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVQL* |
| Ga0070708_1022305282 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ANSGTQFNPVVVEAFIKTVVGERRKSARGADSPHQQVYQQAVQAVRSTF* |
| Ga0066686_100554506 | 3300005446 | Soil | FNPVVVEAFIKTVVGERRKSARGAQSPHEQVYQQAVEAVRVSL* |
| Ga0066686_110372691 | 3300005446 | Soil | FNPVVVEAFIKTVVGERRKSARGAQSPHEQVYQQAVEAVRLTL* |
| Ga0070706_1000194731 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | QFNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVSL* |
| Ga0070706_1002522111 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TQFNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVSL* |
| Ga0070706_1010947442 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | FNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTF* |
| Ga0070707_1006450843 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RKAALRELRANSGTQFNPVVVEAFVRAVIGERRKARRTGTSDELVLQQALATVRVTV* |
| Ga0070707_1008885932 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | NSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVQAVRSTF* |
| Ga0070698_1002106612 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVQAVRSTF* |
| Ga0070698_1002712481 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL* |
| Ga0070698_1014341902 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | SAKQALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVQAVRSTF* |
| Ga0070699_1012349801 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | NSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL* |
| Ga0070697_1009594941 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | NSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTF* |
| Ga0070697_1012058344 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVQL* |
| Ga0066700_106606251 | 3300005559 | Soil | KAALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVSL* |
| Ga0068857_10000604913 | 3300005577 | Corn Rhizosphere | FIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL* |
| Ga0070702_1017147043 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | ANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL* |
| Ga0068862_1009838131 | 3300005844 | Switchgrass Rhizosphere | NPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL* |
| Ga0075417_100390323 | 3300006049 | Populus Rhizosphere | TQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRLTL* |
| Ga0066665_100692485 | 3300006796 | Soil | FNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVSL* |
| Ga0066665_102420041 | 3300006796 | Soil | FNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVAL* |
| Ga0075428_1015769502 | 3300006844 | Populus Rhizosphere | NPVVVEAFIKTVVGERHKSARGVASPHEQVYQQALEAVRVTL* |
| Ga0075433_104154892 | 3300006852 | Populus Rhizosphere | TQFNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRITL* |
| Ga0075425_1006809641 | 3300006854 | Populus Rhizosphere | TQFNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVTL* |
| Ga0079217_100315366 | 3300006876 | Agricultural Soil | GTQFNPLVVEAFIKTVVGERRKTARGAESPHQQVYQQAVEAVRVSL* |
| Ga0079217_101178061 | 3300006876 | Agricultural Soil | QFNPLVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL* |
| Ga0079217_101186211 | 3300006876 | Agricultural Soil | GTQFNPLVVEAFIKTVVGERRKTARGAESPHQQVYQQAVEAVRLTF* |
| Ga0075426_103083601 | 3300006903 | Populus Rhizosphere | FIKTVVGERRKSARGAESPHEQVYQQAVEAVRVTL* |
| Ga0075419_100524011 | 3300006969 | Populus Rhizosphere | GTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL* |
| Ga0075419_100821921 | 3300006969 | Populus Rhizosphere | GTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRLTL* |
| Ga0079218_117212624 | 3300007004 | Agricultural Soil | AKAALRELRANSGTQFNPLVVEAFIKTVVGERRKTARGAESPHQQVYQQAVEAVRVSL* |
| Ga0066710_1000762739 | 3300009012 | Grasslands Soil | ALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVSL |
| Ga0066710_1000820049 | 3300009012 | Grasslands Soil | FNPVVVEAFIKTVVGERRKSARGAPSPHEQVYQQAVEAVRVSL |
| Ga0066710_1003900213 | 3300009012 | Grasslands Soil | VEAFIKTVVGERRKSARGAQSPHEQVYQQAVEAVRLTF |
| Ga0066710_1004039183 | 3300009012 | Grasslands Soil | FNPVVVEAFIKTVVGERRKSARGAPSPHEQVYQQAVEAVRVAL |
| Ga0105244_104817032 | 3300009036 | Miscanthus Rhizosphere | KQALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTF* |
| Ga0099828_117621441 | 3300009089 | Vadose Zone Soil | SGTQFNPVVVEAFIKTVVGERRKSARGAQSPHEQVYQQAVEAVRISL* |
| Ga0099828_118434601 | 3300009089 | Vadose Zone Soil | SGTQFNPVVVEAFIKTVVGERRKSARGAQSPHEQVYQQAVEAVRVSL* |
| Ga0099827_109133014 | 3300009090 | Vadose Zone Soil | AHSGTQFNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVSL* |
| Ga0066709_1003293771 | 3300009137 | Grasslands Soil | QFNPVVVEAFIKTVVGERRKSARGAQSPHEQVYQQAVEAVRLTL* |
| Ga0114129_103267601 | 3300009147 | Populus Rhizosphere | GTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTL* |
| Ga0114129_112823801 | 3300009147 | Populus Rhizosphere | GTQFNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRITL* |
| Ga0114129_122829304 | 3300009147 | Populus Rhizosphere | GTQFNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVSL* |
| Ga0105242_119405242 | 3300009176 | Miscanthus Rhizosphere | FIKTVVGERRKSARGAESPHQQVYQQAVQAVRSTF* |
| Ga0105242_121998461 | 3300009176 | Miscanthus Rhizosphere | AALRELRANSGTQFNPLVVEAFIKTVVGERRKAARGAESPHQQVYQQAVEAVRVSL* |
| Ga0134088_100580911 | 3300010304 | Grasslands Soil | FIKTVVGERRKSARGAQSPHEQVYQQAVEAVRVSL* |
| Ga0134086_102040044 | 3300010323 | Grasslands Soil | EAFIKTVVGERRKSARGAQSPHEQVYQQAVEAVRVSL* |
| Ga0134111_100295862 | 3300010329 | Grasslands Soil | RANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVAL* |
| Ga0134071_100348691 | 3300010336 | Grasslands Soil | QFNPVVVEAFIKTVVGERRKSARGAQSPHEQVYQQAVEAVRVSL* |
| Ga0134071_104333861 | 3300010336 | Grasslands Soil | PVVVEAFIKTVVGERRKSARGAQSPHEQVYQQAVEAVRLTL* |
| Ga0105239_118676872 | 3300010375 | Corn Rhizosphere | ALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVQAVRSTF* |
| Ga0134127_101351313 | 3300010399 | Terrestrial Soil | ALSAKQALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVQAVRSTF* |
| Ga0134122_113192451 | 3300010400 | Terrestrial Soil | VVAEALNKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL* |
| Ga0134121_111713241 | 3300010401 | Terrestrial Soil | LSAKQALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVQAVRSTF |
| Ga0134123_103541354 | 3300010403 | Terrestrial Soil | ELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL* |
| Ga0134123_107177492 | 3300010403 | Terrestrial Soil | ANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVQAVRSTF* |
| Ga0137389_101992671 | 3300012096 | Vadose Zone Soil | GTQFNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVTL* |
| Ga0137399_100530977 | 3300012203 | Vadose Zone Soil | ALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL* |
| Ga0137374_107499964 | 3300012204 | Vadose Zone Soil | FIKTVVGERRKSARGAESPHEQVYQQAVEAVRVSL* |
| Ga0137378_110533804 | 3300012210 | Vadose Zone Soil | VVVEAFIKTVVGERRKSARGAQSPHEQVYQQAVEAVRVSL* |
| Ga0137434_10856881 | 3300012225 | Soil | ELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRLTF* |
| Ga0137367_106585991 | 3300012353 | Vadose Zone Soil | HSGTQFNPVVVEAFIKTVIGERRKSARGAESPHEHVYQQAVEAVRVSV* |
| Ga0137369_1002576410 | 3300012355 | Vadose Zone Soil | AKQALRELRAHSGTQFNPVVVEAFIKTVIGERRKSARGAESPHEHVYQQAVEAVRVSV* |
| Ga0137369_100593128 | 3300012355 | Vadose Zone Soil | NPVVVEAFITTVVGERRKSARGAESPHQQVYQQAVQAVRVAL* |
| Ga0137371_107137871 | 3300012356 | Vadose Zone Soil | VVEAFIKTVVGERRKSARGAQSPHEQVYQQAVEAGRVSL* |
| Ga0137385_104043834 | 3300012359 | Vadose Zone Soil | ANSGTQFNPVVVEAFIKTVVGERRKSARGAQSPHEQVYQQAVEAVRVSL* |
| Ga0137385_104757231 | 3300012359 | Vadose Zone Soil | ANSGTQFNPVVVEAFIKTVVGERRKSARGAQSPHEQVYQQAVEAVRLTL* |
| Ga0137375_106218001 | 3300012360 | Vadose Zone Soil | PVVVEAFITTVVGERRKSARGAESPHQQVYQQAVQAVRSTF* |
| Ga0137373_101125071 | 3300012532 | Vadose Zone Soil | HSGTQFNPVVVEAFITTVVGERRKSARGAESPHQQVYQQAVQAVRSTF* |
| Ga0137373_102921554 | 3300012532 | Vadose Zone Soil | NPVVVEAFIKTVIGERRKSARGAASPHEHVYQQAVEAVRVSV* |
| Ga0137397_103104292 | 3300012685 | Vadose Zone Soil | NPLVVEAFIKTVVGERRKSARGAESPHQQVYEQAVQAVRSTF* |
| Ga0137394_101273133 | 3300012922 | Vadose Zone Soil | GTQFNPLVVEAFIKTVVGERRKSARGAESPHQQVYEQAVQAVRSTF* |
| Ga0137394_111952721 | 3300012922 | Vadose Zone Soil | GTQFNPLVVEAFIKTVVGERRKSARGAESPHQQVYEQAVQAVRVQL* |
| Ga0157375_119470731 | 3300013308 | Miscanthus Rhizosphere | QALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTF* |
| Ga0157377_102935102 | 3300014745 | Miscanthus Rhizosphere | IKTVVGERRKSARGAESPHQQVYQQAVEAVRSTI* |
| Ga0132258_128507851 | 3300015371 | Arabidopsis Rhizosphere | SGTQFNPVVVEAFIKTVVGERRKTARGVQSPHQQVYQQAVEAVRVSL* |
| Ga0184604_101123451 | 3300018000 | Groundwater Sediment | GTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTF |
| Ga0184604_101967311 | 3300018000 | Groundwater Sediment | GTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL |
| Ga0184604_102639271 | 3300018000 | Groundwater Sediment | NPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTF |
| Ga0184605_103390032 | 3300018027 | Groundwater Sediment | PVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTF |
| Ga0184608_100136631 | 3300018028 | Groundwater Sediment | NSGTQFNPVVVEAFITTVVGERRKSARGAESPHQQVYQQAVEAVRVQL |
| Ga0184608_105184761 | 3300018028 | Groundwater Sediment | NSGTQFNPVVVEAFITTVVGERRKSARGAESPHQQVYQQAVQAVRSTF |
| Ga0184634_104961553 | 3300018031 | Groundwater Sediment | VVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL |
| Ga0184623_100102488 | 3300018056 | Groundwater Sediment | GTQFNPLVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL |
| Ga0184623_102556222 | 3300018056 | Groundwater Sediment | GTQFNPLVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRITL |
| Ga0184632_103015001 | 3300018075 | Groundwater Sediment | FNRVLVAAFMKTVVGERRKSARGAETPHQQVYQQAVEAVRSTF |
| Ga0066669_123946742 | 3300018482 | Grasslands Soil | SAKAALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVAL |
| Ga0193705_10957322 | 3300019869 | Soil | SGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTF |
| Ga0193699_101683821 | 3300021363 | Soil | PVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRITL |
| Ga0193699_102207954 | 3300021363 | Soil | VVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL |
| Ga0224452_12504451 | 3300022534 | Groundwater Sediment | RELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTF |
| Ga0222623_100755142 | 3300022694 | Groundwater Sediment | PVVVEAFITTVVGERRKSARGAESPHQQVYQQAVQAVRSTF |
| Ga0207653_100027331 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVQL |
| Ga0207643_102236501 | 3300025908 | Miscanthus Rhizosphere | VEAFIKTVVGERRKTARGAESPHQQVYQQAVEAVRITF |
| Ga0207684_103942301 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVSL |
| Ga0207707_100840371 | 3300025912 | Corn Rhizosphere | KQALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL |
| Ga0207707_109360162 | 3300025912 | Corn Rhizosphere | ANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVQAVRSTF |
| Ga0207660_100214856 | 3300025917 | Corn Rhizosphere | NPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVQAVRSTF |
| Ga0207709_110627521 | 3300025935 | Miscanthus Rhizosphere | AFIKTVAGERRKSARGAESPHQQVYQQAVEAVRVSL |
| Ga0207677_115052293 | 3300026023 | Miscanthus Rhizosphere | RELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL |
| Ga0207708_101034676 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | YRPALSAKQALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL |
| Ga0207708_108637522 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | YRPALSAKQALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVQAVRSTF |
| Ga0207648_115351831 | 3300026089 | Miscanthus Rhizosphere | QALRELRANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVQAVRSTF |
| Ga0207674_101950903 | 3300026116 | Corn Rhizosphere | AFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTF |
| Ga0207675_1003593734 | 3300026118 | Switchgrass Rhizosphere | PVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL |
| Ga0209472_10601941 | 3300026323 | Soil | QFNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVAL |
| Ga0209472_10918174 | 3300026323 | Soil | QFNPVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVSL |
| Ga0209470_10210501 | 3300026324 | Soil | TQFNPVVVEAFIKTVVGERRKSARGAQSPHEQVYQQAVEAVRVSL |
| Ga0209470_10472173 | 3300026324 | Soil | TQFNPVVVEAFIKTVVGERRKSARGAQSPHEQVYQQAVEAVRLTL |
| Ga0209996_10213284 | 3300027395 | Arabidopsis Thaliana Rhizosphere | QFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL |
| Ga0209814_100134633 | 3300027873 | Populus Rhizosphere | VEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRLTL |
| Ga0209814_101125834 | 3300027873 | Populus Rhizosphere | VEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL |
| Ga0209481_100436991 | 3300027880 | Populus Rhizosphere | SGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRLTL |
| Ga0268265_109659291 | 3300028380 | Switchgrass Rhizosphere | SGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVQAVRSTF |
| Ga0307284_103579521 | 3300028799 | Soil | VEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTL |
| Ga0307302_102427671 | 3300028814 | Soil | AFIKTVVGERRKSARGAESPHQQVYQQAVEAVRLTF |
| Ga0307302_103506544 | 3300028814 | Soil | VEAFIKTVFGERRKSARGAESPHQQVYQQAVEAVRVSL |
| Ga0307296_100687013 | 3300028819 | Soil | FNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTF |
| Ga0307310_100640861 | 3300028824 | Soil | RANSGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL |
| Ga0307312_103500044 | 3300028828 | Soil | SGTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRVSL |
| Ga0307278_101466502 | 3300028878 | Soil | TQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTF |
| Ga0326597_107009271 | 3300031965 | Soil | PVVVEAFIKTVVGERRKSARGAESPHEQVYQQAVEAVRVSL |
| Ga0310890_115222002 | 3300032075 | Soil | LRANSSTQFNPVVVEAFIKTVVGERRKSARGAESPHQQVYQQAVEAVRSTF |
| ⦗Top⦘ |