Basic Information | |
---|---|
Family ID | F051808 |
Family Type | Metagenome |
Number of Sequences | 143 |
Average Sequence Length | 44 residues |
Representative Sequence | MTTKRELDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRS |
Number of Associated Samples | 126 |
Number of Associated Scaffolds | 143 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 25.87 % |
% of genes near scaffold ends (potentially truncated) | 98.60 % |
% of genes from short scaffolds (< 2000 bps) | 92.31 % |
Associated GOLD sequencing projects | 122 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.706 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.587 % of family members) |
Environment Ontology (ENVO) | Unclassified (41.259 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.538 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.17% β-sheet: 0.00% Coil/Unstructured: 71.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 143 Family Scaffolds |
---|---|---|
PF01171 | ATP_bind_3 | 52.45 |
PF09925 | DUF2157 | 2.10 |
PF04519 | Bactofilin | 1.40 |
PF02540 | NAD_synthase | 0.70 |
PF13620 | CarboxypepD_reg | 0.70 |
PF01842 | ACT | 0.70 |
PF01042 | Ribonuc_L-PSP | 0.70 |
PF00578 | AhpC-TSA | 0.70 |
PF13646 | HEAT_2 | 0.70 |
COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
---|---|---|---|
COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 52.45 |
COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 52.45 |
COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 52.45 |
COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 52.45 |
COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 52.45 |
COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 52.45 |
COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 1.40 |
COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.70 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.70 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.71 % |
Unclassified | root | N/A | 6.29 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000531|CNBas_1001542 | Not Available | 1221 | Open in IMG/M |
3300000956|JGI10216J12902_111270247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300003319|soilL2_10001824 | All Organisms → cellular organisms → Bacteria | 14369 | Open in IMG/M |
3300004114|Ga0062593_102807265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
3300005184|Ga0066671_10309692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 993 | Open in IMG/M |
3300005294|Ga0065705_10242138 | Not Available | 1227 | Open in IMG/M |
3300005294|Ga0065705_10740821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
3300005336|Ga0070680_100079503 | All Organisms → cellular organisms → Bacteria | 2703 | Open in IMG/M |
3300005345|Ga0070692_10917585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
3300005364|Ga0070673_100265490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1501 | Open in IMG/M |
3300005365|Ga0070688_100206979 | Not Available | 1375 | Open in IMG/M |
3300005365|Ga0070688_100490359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 925 | Open in IMG/M |
3300005441|Ga0070700_101193652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 635 | Open in IMG/M |
3300005444|Ga0070694_101252252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300005444|Ga0070694_101363555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
3300005444|Ga0070694_101543826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300005445|Ga0070708_100448479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1217 | Open in IMG/M |
3300005445|Ga0070708_100642601 | Not Available | 1000 | Open in IMG/M |
3300005459|Ga0068867_101534472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 621 | Open in IMG/M |
3300005468|Ga0070707_100930208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 834 | Open in IMG/M |
3300005471|Ga0070698_101439727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 640 | Open in IMG/M |
3300005471|Ga0070698_102129174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300005518|Ga0070699_100266525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1532 | Open in IMG/M |
3300005547|Ga0070693_100340932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
3300005577|Ga0068857_101212819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
3300005616|Ga0068852_101994228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
3300005617|Ga0068859_100264895 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1810 | Open in IMG/M |
3300005719|Ga0068861_101154375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
3300005842|Ga0068858_101746268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
3300005843|Ga0068860_101890344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300006796|Ga0066665_11183916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300006797|Ga0066659_11687055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300006800|Ga0066660_10165254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1654 | Open in IMG/M |
3300006845|Ga0075421_101897083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300006854|Ga0075425_100606057 | Not Available | 1259 | Open in IMG/M |
3300006871|Ga0075434_100483654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1259 | Open in IMG/M |
3300006871|Ga0075434_102411596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300006903|Ga0075426_10108464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1992 | Open in IMG/M |
3300006954|Ga0079219_10597168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
3300009012|Ga0066710_101810294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 921 | Open in IMG/M |
3300009088|Ga0099830_10377399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1144 | Open in IMG/M |
3300009089|Ga0099828_10054407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3334 | Open in IMG/M |
3300009089|Ga0099828_10674308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 929 | Open in IMG/M |
3300009092|Ga0105250_10145292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
3300009098|Ga0105245_12067014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300009100|Ga0075418_10183448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2228 | Open in IMG/M |
3300009147|Ga0114129_13017647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300009156|Ga0111538_12844651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
3300009162|Ga0075423_10112325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 2854 | Open in IMG/M |
3300009162|Ga0075423_10201192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2089 | Open in IMG/M |
3300009168|Ga0105104_10208723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1062 | Open in IMG/M |
3300009174|Ga0105241_10388662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1221 | Open in IMG/M |
3300009176|Ga0105242_10761231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 954 | Open in IMG/M |
3300010037|Ga0126304_10088194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1945 | Open in IMG/M |
3300010043|Ga0126380_10961011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
3300010044|Ga0126310_11179577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300010046|Ga0126384_10305562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1309 | Open in IMG/M |
3300010166|Ga0126306_11667670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
3300010303|Ga0134082_10130127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1010 | Open in IMG/M |
3300010325|Ga0134064_10188878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
3300010360|Ga0126372_10063476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2583 | Open in IMG/M |
3300010362|Ga0126377_13384511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300010366|Ga0126379_13862119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300010371|Ga0134125_12332411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300010373|Ga0134128_13052218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300010375|Ga0105239_10167368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2458 | Open in IMG/M |
3300010375|Ga0105239_12619061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300010397|Ga0134124_13026373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300010399|Ga0134127_13511372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300010400|Ga0134122_11766106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 649 | Open in IMG/M |
3300010400|Ga0134122_13204722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300010401|Ga0134121_10125005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2175 | Open in IMG/M |
3300011443|Ga0137457_1218290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
3300012201|Ga0137365_10385620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1034 | Open in IMG/M |
3300012205|Ga0137362_10188128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1776 | Open in IMG/M |
3300012208|Ga0137376_10648444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
3300012356|Ga0137371_10351280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1146 | Open in IMG/M |
3300012359|Ga0137385_10334077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1299 | Open in IMG/M |
3300012359|Ga0137385_10999917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 690 | Open in IMG/M |
3300012469|Ga0150984_117163299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
3300012532|Ga0137373_10364077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1132 | Open in IMG/M |
3300012684|Ga0136614_10416833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
3300012917|Ga0137395_10511892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 865 | Open in IMG/M |
3300012922|Ga0137394_10094315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2515 | Open in IMG/M |
3300012923|Ga0137359_11369523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300012925|Ga0137419_10373473 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300012925|Ga0137419_10999751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
3300012927|Ga0137416_11646685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300012948|Ga0126375_11016574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
3300012971|Ga0126369_12149512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
3300012976|Ga0134076_10492530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300013100|Ga0157373_11250267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300013297|Ga0157378_10296811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1563 | Open in IMG/M |
3300013297|Ga0157378_11108259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
3300013308|Ga0157375_11192098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
3300014325|Ga0163163_12842782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300014487|Ga0182000_10063936 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
3300014488|Ga0182001_10520547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300014968|Ga0157379_10879519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
3300015164|Ga0167652_1074668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300015373|Ga0132257_102114362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
3300018027|Ga0184605_10102188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1266 | Open in IMG/M |
3300018476|Ga0190274_10024463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4029 | Open in IMG/M |
3300019767|Ga0190267_10532306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
3300021061|Ga0196973_1081370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
3300021082|Ga0210380_10347854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300021445|Ga0182009_10159422 | Not Available | 1077 | Open in IMG/M |
3300022694|Ga0222623_10035820 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
3300022756|Ga0222622_11167085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300025321|Ga0207656_10638051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 544 | Open in IMG/M |
3300025899|Ga0207642_10134397 | Not Available | 1295 | Open in IMG/M |
3300025906|Ga0207699_10715550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
3300025907|Ga0207645_10972000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300025908|Ga0207643_10155212 | Not Available | 1375 | Open in IMG/M |
3300025917|Ga0207660_11729064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300025922|Ga0207646_11235847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
3300025935|Ga0207709_11458558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300025940|Ga0207691_11180562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
3300025949|Ga0207667_10972694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
3300025960|Ga0207651_11492512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300025961|Ga0207712_11955037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300026088|Ga0207641_11979998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300026095|Ga0207676_11693945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
3300026118|Ga0207675_100683095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
3300026118|Ga0207675_100809025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 951 | Open in IMG/M |
3300026118|Ga0207675_101362301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
3300026295|Ga0209234_1200770 | Not Available | 677 | Open in IMG/M |
3300026300|Ga0209027_1308284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300026307|Ga0209469_1107583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
3300026547|Ga0209156_10478411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300027603|Ga0209331_1060247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 952 | Open in IMG/M |
3300027691|Ga0209485_1173266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300027846|Ga0209180_10096766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1679 | Open in IMG/M |
3300027903|Ga0209488_10738841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
3300030511|Ga0268241_10182986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300031231|Ga0170824_119483464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1048 | Open in IMG/M |
3300031456|Ga0307513_10895095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300031548|Ga0307408_102480384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300031954|Ga0306926_12892700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300032000|Ga0310903_10459375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
3300032005|Ga0307411_12294250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300032180|Ga0307471_101410576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
3300032180|Ga0307471_101603765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.29% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.99% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.80% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.10% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.10% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.10% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.10% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.40% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.40% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.40% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.40% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.40% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.40% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.40% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.40% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.70% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.70% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.70% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.70% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.70% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.70% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.70% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.70% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.70% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.70% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.70% |
Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.70% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.70% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.70% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.70% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Host-Associated | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015164 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300021061 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5-13C | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
CNBas_10015423 | 3300000531 | Quercus Rhizosphere | MKDLDFSDFPPGTVTDYTTLVCLACIFDIFTKQIG |
JGI10216J12902_1112702473 | 3300000956 | Soil | MVTSKKRELDLKDFPSGTVTEYTTLVCLACIFDIF |
soilL2_1000182415 | 3300003319 | Sugarcane Root And Bulk Soil | MKSFELDFSEFPPGSVTEYTTLVCLACIFDIFTKQIGLAPRSAYSEIKRYSP |
Ga0062593_1028072652 | 3300004114 | Soil | VSKTTKKQKDLDLSAFPPGSVTEFSTLVCLACTFDIFTTQLGLAPRTAYSEI |
Ga0066671_103096922 | 3300005184 | Soil | MAATKQLELDLKDFPPGTVTEFTTLVCLACTFDIFTKQLGLAPRTAFSEI |
Ga0065705_102421381 | 3300005294 | Switchgrass Rhizosphere | MKELDFSGFPPGTITDYTTLVCLACIFDIFTKQIGLAPRS |
Ga0065705_107408212 | 3300005294 | Switchgrass Rhizosphere | MKKSTELDFSEFPPGTVTEYTTLVCLACIFDIFTKQLGLAPRT |
Ga0070680_1000795031 | 3300005336 | Corn Rhizosphere | MGSAKQELDFSDFPQGAVTEYTTLVCLACIFDIFTKQIGLAPRSAYS |
Ga0070692_109175851 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MVASKKRELDLSAFPSGTVTEYTTLVCLACIFDIFTKQLRM |
Ga0070673_1002654901 | 3300005364 | Switchgrass Rhizosphere | MPATTKKRELDLKDFPPGTVTEFTTLVCLACIFDIFTKQLGLAPRT |
Ga0070688_1002069792 | 3300005365 | Switchgrass Rhizosphere | MTSKRELDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRSAYSEIKRYS |
Ga0070688_1004903592 | 3300005365 | Switchgrass Rhizosphere | MKDLDFSGFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYSEIKRY |
Ga0070700_1011936522 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MPATTKKRELELKDFPPGTVTEFTTLVCLACIFDIFTKQLGLAPR |
Ga0070694_1012522522 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MKELDFTDFPPGSVTEYTTLVCLACIFDIFTKQIGLAPRSAYTEIKRY |
Ga0070694_1013635552 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MKELDFSGFPPGTVTDYTTLVCLACIFDIFTKQIGLAPRSAYSEIK |
Ga0070694_1015438262 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTKRDLDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRSAYSEI |
Ga0070708_1004484791 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKAAKRRELDFADFPPGTVTEYSTLVCLACTFDIFTTQLGLAPR |
Ga0070708_1006426012 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTKRDLDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRSAYSEIKRYSP |
Ga0068867_1015344721 | 3300005459 | Miscanthus Rhizosphere | MATTTKKRELDLSEFPAGTVTEYTTLVCLACIFDIFTKQLGLAPR |
Ga0070707_1009302081 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKELDFSEFPPGTVTEYTTLVCLACIFDIFTKQIELAPRSAYSEIKRYSP |
Ga0070698_1014397271 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTAKKRHDLDLSAFPLGSVTEYSTLVCLACTFDIFTTQLGLAPRTA |
Ga0070698_1021291741 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VSKTATKKKELDLSNFPPGSVTEFSTLVCLACTFDIFTTQLGLAPRTAYS |
Ga0070699_1002665251 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATKRRELDLSDFPPGTVTEYTTLVCLACIFDIFTRQLGLAPRTAF |
Ga0070693_1003409321 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSKRELDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLA |
Ga0068857_1012128192 | 3300005577 | Corn Rhizosphere | MKDLDFSDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYTEIKRY |
Ga0068852_1019942281 | 3300005616 | Corn Rhizosphere | MTTKRELDYSAFSPGTVTEYTTLVCLACIFDIFTKQFGLAPRS |
Ga0068859_1002648953 | 3300005617 | Switchgrass Rhizosphere | MPATTKKRELDLKDFPPGTVTEFTTLVCLACIFDIFTKQLG |
Ga0068861_1011543751 | 3300005719 | Switchgrass Rhizosphere | MKAVVPDFSEFPPGTVTEYTTLVCLACIFDIFTKQIGL |
Ga0068858_1017462682 | 3300005842 | Switchgrass Rhizosphere | MKELDLTEFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYT |
Ga0068860_1018903442 | 3300005843 | Switchgrass Rhizosphere | VATNPKRELDLSDFPSGTVTEYTTLVCLACIFDIFTKQLGLAPR |
Ga0066665_111839162 | 3300006796 | Soil | MRVMPAPKKKRELDLSEFPPGTITEYTTLVCLACIFDIFTKQ |
Ga0066659_116870551 | 3300006797 | Soil | MATTKRRELDLKDFPPGTVTEYTTLVCLACIFDIFTKQLGLAPRTAF |
Ga0066660_101652541 | 3300006800 | Soil | MATTKKRELDLSEFPSGSVTEYTTLVCLACIFDIFTKQLGLAARTAF |
Ga0075421_1018970832 | 3300006845 | Populus Rhizosphere | MTAQTRELDFSDFPPGSVTEYTTLVCLACIFDIFTKQFGLAPRSA |
Ga0075425_1006060571 | 3300006854 | Populus Rhizosphere | MPTKRDLDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRSAY |
Ga0075434_1004836541 | 3300006871 | Populus Rhizosphere | MTTAKRELDLKDFPPGTVTEFTTLVCLACIFDIFTKQLGLAPRTAFSEI |
Ga0075434_1024115961 | 3300006871 | Populus Rhizosphere | MASTKKRELDLKDFPPGTVTEYTTLVCLACIFDIFTRQLGLAPRSAFTEIKRHAP |
Ga0075426_101084641 | 3300006903 | Populus Rhizosphere | MPAAKKQRELDLSEFPSGSVTEYTTLVCLACIFDIFTKQLLLPPRTAFSEI |
Ga0079219_105971681 | 3300006954 | Agricultural Soil | MKELDFTDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYTEIKR |
Ga0066710_1018102942 | 3300009012 | Grasslands Soil | MVTLSKKRELDFGDFPTGSVTEYTTLDCLACTFDIFTAQLGLAPRTAY |
Ga0099830_103773991 | 3300009088 | Vadose Zone Soil | MATTKKRELDLSDFPPGTVTEYTTLVCLACIFDIF |
Ga0099828_100544073 | 3300009089 | Vadose Zone Soil | MPPTKQRELDLSEFPSGTVTEYTTLVCLACIFDIFTKQLGLAPRT |
Ga0099828_106743082 | 3300009089 | Vadose Zone Soil | MPTTKKRELDLKEFPPGTVTEYTTLVCLACIFDIFTKQLGLAPR |
Ga0105250_101452922 | 3300009092 | Switchgrass Rhizosphere | MKELDFTDFPPGSVTEYTTLVCLACIFDIFTKQIGLAPRSAYTEIKRYSP |
Ga0105245_120670141 | 3300009098 | Miscanthus Rhizosphere | MKELDLTELPPGTVTEYTTLVCLACIFDIFTKQIGLAPRS |
Ga0075418_101834484 | 3300009100 | Populus Rhizosphere | MTAQTRELDFSDFSPGSVTEYTTLVCLACIFDIFTKQFGLALRSAYS |
Ga0114129_130176472 | 3300009147 | Populus Rhizosphere | MATMKKREIDLSEFPPGTVTEYTTLVCLACIFDISTKPLRLA |
Ga0111538_128446512 | 3300009156 | Populus Rhizosphere | MTAKRELDYSAFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRSAYSEIKRYSP |
Ga0075423_101123251 | 3300009162 | Populus Rhizosphere | MKDLDFSEFPPGTVTEYTTLVCLACIFDIFTKQIGL |
Ga0075423_102011921 | 3300009162 | Populus Rhizosphere | MPTKRDLDFSAFPPGTVTEYTTLVCLACIFDIFTKQFG |
Ga0105104_102087232 | 3300009168 | Freshwater Sediment | MTKRELDFSDFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRSAYSEIKRYS |
Ga0105241_103886622 | 3300009174 | Corn Rhizosphere | MAQAKKQRELDFSEFPPGTVTEYTTLVCLACIFDIFTKQLGLAPRTAFSEI |
Ga0105242_107612312 | 3300009176 | Miscanthus Rhizosphere | MATAKKRELDLSGFPPGTVTEFTTLVCLACIFDIFTQQLGLAPRTAFSEVKR |
Ga0126304_100881943 | 3300010037 | Serpentine Soil | MTTKRELDFTAFPPGTVSEYTTLVCLACIFDIFTKQFGLAARSAYSEIKRY* |
Ga0126380_109610112 | 3300010043 | Tropical Forest Soil | MATTKKRELDLKDFPAGTVTEFTTLVCLACIFDIFTKQLGLAARTAFS |
Ga0126310_111795771 | 3300010044 | Serpentine Soil | MPSATKKRELDFSAFPPGAVSEYSTELCLACIFDVFTKQLAMLGHRRA |
Ga0126384_103055621 | 3300010046 | Tropical Forest Soil | MAQARKQRELDLSEFPPGTVTEYTTFVCLACIFDIFTKQ |
Ga0126306_116676701 | 3300010166 | Serpentine Soil | MATATKKRELDFSDFPPGTVTEYTRQLCLACIFDIFTA |
Ga0134082_101301271 | 3300010303 | Grasslands Soil | MTPTKKREIDLSEFPPGTVTEYTTLVCLACIFDIFTRQLGLAPRTAFSEVK |
Ga0134064_101888781 | 3300010325 | Grasslands Soil | MATSTKQRELDLSEFPAGTVTEFTTLVCLACIFDI |
Ga0126372_100634763 | 3300010360 | Tropical Forest Soil | MPSTRELDFSGFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYSEIK |
Ga0126377_133845111 | 3300010362 | Tropical Forest Soil | MAQAKKQRELDLGEFPPGTVTEYTTLVCLACIFDIFTKQLQLAPRTAFSEIK |
Ga0126379_138621191 | 3300010366 | Tropical Forest Soil | MPATAKKRELDFKEFPAGTVTEYTTLVCLACIFDIFT |
Ga0134125_123324112 | 3300010371 | Terrestrial Soil | MPTAKKKPLDLSAFPPGSVTEFSTLVCLACTFEIFTTQLGLAPRTAYSEIR |
Ga0134128_130522181 | 3300010373 | Terrestrial Soil | MTATKKKREVDLSAFPPGSVTEYSTLVCLACVFDIFTTQLGFAPRTA |
Ga0105239_101673684 | 3300010375 | Corn Rhizosphere | MTTKGELDFSAFPPGSVTEYTTLVCLACIFDIFTKQFGLAPRSAY |
Ga0105239_126190612 | 3300010375 | Corn Rhizosphere | MQMKDLDFSDFPPGTVTEYTTLVCLACIFDIFTKQ |
Ga0134124_130263732 | 3300010397 | Terrestrial Soil | MKELDFSDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYTEIKRYSP |
Ga0134127_135113722 | 3300010399 | Terrestrial Soil | MKELDFSDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYSEIKRYSPTV |
Ga0134122_117661061 | 3300010400 | Terrestrial Soil | MPATTKTRELDLKDFPPGTVTEFTTLVCLACIFDIFTKQLGLAPRTA |
Ga0134122_132047222 | 3300010400 | Terrestrial Soil | MPQAVKQRELDLSQFPPGTITEYTTFVCLACIFDIFTK |
Ga0134121_101250051 | 3300010401 | Terrestrial Soil | MTSKRELDFSAFPPGTVTEDATLVCLACIFDIFTKQFGLA |
Ga0137457_12182902 | 3300011443 | Soil | MTTKRELDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRS |
Ga0137365_103856201 | 3300012201 | Vadose Zone Soil | MGKNRELDFSGFPPGTITEYTTLICLACIFDIFTKQIG |
Ga0137362_101881281 | 3300012205 | Vadose Zone Soil | MGNNRELDFSGFPPGTITEYTTLVCLACIFDIFTKQI |
Ga0137376_106484441 | 3300012208 | Vadose Zone Soil | MPKTKRELDLSEFPPGTITEYTTLVCLACIFDIFTKQLGLAPRTAFSEVKR |
Ga0137371_103512802 | 3300012356 | Vadose Zone Soil | MAKPKRELDLNDFPPGTVTEYTTLVCLACIFDIFTKQLGLAPRTAF |
Ga0137385_103340772 | 3300012359 | Vadose Zone Soil | MVTLSKKRELDFGDFPTGSVTEYTTLVCLACTFDIFTAQLG |
Ga0137385_109999172 | 3300012359 | Vadose Zone Soil | MAITKKRELDLSEFPPGTITEYTTLVCLACIFDIFTKQFGLAARTAFSEI |
Ga0150984_1171632992 | 3300012469 | Avena Fatua Rhizosphere | MPAASKKRELDFGGFPPGTVTEYTTLVCLACIFDIFTKQLGLAPRTA |
Ga0137373_103640771 | 3300012532 | Vadose Zone Soil | MATAKKSELELKDFPPGTVTEYTTLVCLACIFDIFTKQL |
Ga0136614_104168332 | 3300012684 | Polar Desert Sand | MAATSKAKTFELDWSAFPPGAVNEYTTQICLACIFDVFTGQLGLAPRT |
Ga0137395_105118922 | 3300012917 | Vadose Zone Soil | MPGPTKKRELDLSEFPPGTVTEYTTLVCLACIFDIFTKQLGLAPR |
Ga0137394_100943154 | 3300012922 | Vadose Zone Soil | MQPTKQRELDLTEFPPGTVTEYTTLVYLACIFDIFP |
Ga0137359_113695231 | 3300012923 | Vadose Zone Soil | MTAKQRELDLTEFPSGTVTEYTTLVCLACIFDIFTKQLNLAPR |
Ga0137419_103734732 | 3300012925 | Vadose Zone Soil | MPAPTKKRELDLSEFPPGTITEYTTLVCLACIFDIFTKQLGLAPRTAFSEVKR |
Ga0137419_109997511 | 3300012925 | Vadose Zone Soil | VSTTKKRELDLSDFPPGTVTEYTTLVCLARIFDIFTRHLGLAPRTAFSE |
Ga0137416_116466851 | 3300012927 | Vadose Zone Soil | MSTTKNKRELDLSAFPSGTVTEYSTLVCLACTFEIFTTQLGLAPRTAYSE |
Ga0126375_110165741 | 3300012948 | Tropical Forest Soil | MPTTRELDFSGFPPGTVTEYTTLVCLACIFDIFTKQIGL |
Ga0126369_121495122 | 3300012971 | Tropical Forest Soil | MSKSRELDFKDFPSGTVTEFTTLVCLACIFDIFTTQLR |
Ga0134076_104925302 | 3300012976 | Grasslands Soil | MRVMPATKKQRELDLSEFPPGTITEYTTLVCLACIFDIFTKQF |
Ga0157373_112502672 | 3300013100 | Corn Rhizosphere | MTTKRFELDLSEFPSGSITEYTTLVCLACIFDIFTRQLGLAPR |
Ga0157378_102968113 | 3300013297 | Miscanthus Rhizosphere | MIKKSRELDLSDFPAGTVTEYTTLVCLACIFDIFTRQFDLAPRKAY |
Ga0157378_111082592 | 3300013297 | Miscanthus Rhizosphere | VATNPRRELDLSDFPSGTVTEYTTLVCLACIFDIFTKQLGLAPRTAFSEIKRH |
Ga0157375_111920981 | 3300013308 | Miscanthus Rhizosphere | VATNPKRELDLSGFPSGTVTEYTTLVCLACIFDIFTKQLGLAP |
Ga0163163_128427821 | 3300014325 | Switchgrass Rhizosphere | MKLTELDFSEFPPGTVTDYTTLVCLACIFDVFTKQIGLAPRSAYSEIKRY |
Ga0182000_100639363 | 3300014487 | Soil | MAAKPGTRELDLSEFPKGTVTEFTTLVCLACIFDIFTKQLGLAPRTAFSEIK |
Ga0182001_105205472 | 3300014488 | Soil | MATATKKRELDFQAFPPGTVAEYTTRLCLACIFDVFTAQL |
Ga0157379_108795192 | 3300014968 | Switchgrass Rhizosphere | MGAERSELDFSAFPPGTVTEYTTLVCLACIFDIFTKQIG |
Ga0167652_10746681 | 3300015164 | Glacier Forefield Soil | MPPPKKRELDLSEFPRGTITEYTTLVCLACIFDIFTKQLGLAPRTA |
Ga0132257_1021143622 | 3300015373 | Arabidopsis Rhizosphere | MKELDFSGFPPGTVTDYTTLVCLACIFDIFTKQIGLA |
Ga0184605_101021882 | 3300018027 | Groundwater Sediment | MPTAKKKPLDLSAFPPGIVTEYSTLVCLACTFEIFTTQLGLAPRTAYSEI |
Ga0190274_100244633 | 3300018476 | Soil | MTKKKELVLDSGDFPAGSVTEYSTLVCLACTFDIFTKQRGLAPR |
Ga0190267_105323062 | 3300019767 | Soil | MATTASKKRELDWSDFPPGTVTEYTRLLCLACIFDIFTE |
Ga0196973_10813701 | 3300021061 | Soil | MVVTAAKKRELNFADFPPGAITEYTTLLCLACIFDIFTKQLG |
Ga0210380_103478541 | 3300021082 | Groundwater Sediment | MTTKRELDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRSAYSEIKR |
Ga0182009_101594222 | 3300021445 | Soil | MKKSTELDFSEFPPGTVTEYTTLVCLACIFDIFTKQLGLAP |
Ga0222623_100358201 | 3300022694 | Groundwater Sediment | MATTKKRELDLSEFPPGTVTEYTTLVCLACIFDIFTKQL |
Ga0222622_111670851 | 3300022756 | Groundwater Sediment | MGKAAKPGEFDLSEFPQGSVTEYSTLVCLACTFDIFTSQLGLAPRTA |
Ga0207656_106380513 | 3300025321 | Corn Rhizosphere | MKELDLTDFPPGTVTEYTTLVCLACIFDIFTKQIG |
Ga0207642_101343973 | 3300025899 | Miscanthus Rhizosphere | MTTKGELDFSAFPPGSVTEYTTLVCLACIFDIFTKQFGLAP |
Ga0207699_107155501 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MATKRDLDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLA |
Ga0207645_109720001 | 3300025907 | Miscanthus Rhizosphere | MATTQTREIDLSAFPSGTVTEFTTLVCLACIFDIFTKQLGLAPRTAFSEI |
Ga0207643_101552121 | 3300025908 | Miscanthus Rhizosphere | MKELDFTDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYTE |
Ga0207660_117290641 | 3300025917 | Corn Rhizosphere | MIKKSRELDLSDFPAGTVTEYITLVCLACIFDIFTRQFDLAP |
Ga0207646_112358471 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKNRELDFSGFPPGTITEYTTLVCLACIFDIFTKQIRLA |
Ga0207709_114585581 | 3300025935 | Miscanthus Rhizosphere | MKELDFTDFPPGTVTAYTTLVCLACIFDIFTKQIGLAPRSAYSEIKRYSPT |
Ga0207691_111805621 | 3300025940 | Miscanthus Rhizosphere | MKELDFSDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRS |
Ga0207667_109726941 | 3300025949 | Corn Rhizosphere | MTELDFSDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYSEIK |
Ga0207651_114925121 | 3300025960 | Switchgrass Rhizosphere | MKDLDFSGFPPGTVTEYTTLVCLACIFDIFTKQIGL |
Ga0207712_119550371 | 3300025961 | Switchgrass Rhizosphere | MTTKRFELDLSEFPSGSITEYTTLVCLACIFDIFTRQLGL |
Ga0207641_119799982 | 3300026088 | Switchgrass Rhizosphere | MKELDFSDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSA |
Ga0207676_116939451 | 3300026095 | Switchgrass Rhizosphere | MTTKGELDFSAFPPGSVTEYTTLVCLACIFDIFTKQ |
Ga0207675_1006830951 | 3300026118 | Switchgrass Rhizosphere | MKELDFTDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPR |
Ga0207675_1008090252 | 3300026118 | Switchgrass Rhizosphere | MGAERSELDFSAFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYSEIK |
Ga0207675_1013623011 | 3300026118 | Switchgrass Rhizosphere | MTAKRELDYSAFSPGTVTEYTTLVCLACIFDIFTKQFGLAPRS |
Ga0209234_12007702 | 3300026295 | Grasslands Soil | MPATKKQRELDLSEFPSGSVTEYTTLVCLACIFDIFTKQL |
Ga0209027_13082841 | 3300026300 | Grasslands Soil | MRVMPATKKQRELDLSEFPPGTITEYTTLVCLACIFDIFTK |
Ga0209469_11075832 | 3300026307 | Soil | MRVMPAPKKKRELDLSEFPPGTITEYTTLVCLACIFDIFTKQLGLAARTAFSEIKR |
Ga0209156_104784111 | 3300026547 | Soil | MSKNREIDLSEFPAGTVTEFTTLVCLACIFDIFTKQLGLAPRT |
Ga0209331_10602471 | 3300027603 | Forest Soil | MATTRKRELDLKDFPPGTITEYTTLVCLACIFDIFTKQLGLAPRTA |
Ga0209485_11732661 | 3300027691 | Agricultural Soil | MKLTELDFSDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYSEIKRYS |
Ga0209180_100967663 | 3300027846 | Vadose Zone Soil | MPAKQRELDLTEFPSGTVTEYTTLVCLACIFDIFTKQLNLAPRTAFSEIKRHT |
Ga0209488_107388412 | 3300027903 | Vadose Zone Soil | MAATKKRELDLRDFPPGTVTEFTTLVCLACIFDIFTKQLGLTPRTAFSEVKR |
Ga0268241_101829862 | 3300030511 | Soil | MKDLDFSDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYSEIKRY |
Ga0170824_1194834641 | 3300031231 | Forest Soil | MAAKPRAHELDLSGFPKGTVTEYTTLVCLACIFDIFTKQLGLAPRTAF |
Ga0307513_108950951 | 3300031456 | Ectomycorrhiza | MATATKKPLDLSDFPAGSVTEYTTLVCLACTFDIFT |
Ga0307408_1024803842 | 3300031548 | Rhizosphere | MATASKKRELDFTDFPPGTVAEYATLLCLACIFDIFTVQLGLAPRTA |
Ga0306926_128927001 | 3300031954 | Soil | MVRSVELDLTEFPSGTVTEFTTLVCLACIFDIFTK |
Ga0310903_104593752 | 3300032000 | Soil | MTQTRELDFSDFPPGSVTEYTTLVCLACIFDIFTKQFGL |
Ga0307411_122942502 | 3300032005 | Rhizosphere | MAASAKKRELDFSAFPPGAVTEYSTLLCLACIFDIFTK |
Ga0307471_1014105761 | 3300032180 | Hardwood Forest Soil | MVTLSKKRELDFGDFPKGSVTEYTTLVCLACTFDIFTAQLG |
Ga0307471_1016037652 | 3300032180 | Hardwood Forest Soil | MPSTRELDFSAFPPGTVTEYTTLVCLACIFDIFTKQI |
⦗Top⦘ |