NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F051808

Metagenome Family F051808

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051808
Family Type Metagenome
Number of Sequences 143
Average Sequence Length 44 residues
Representative Sequence MTTKRELDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRS
Number of Associated Samples 126
Number of Associated Scaffolds 143

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 25.87 %
% of genes near scaffold ends (potentially truncated) 98.60 %
% of genes from short scaffolds (< 2000 bps) 92.31 %
Associated GOLD sequencing projects 122
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.706 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(12.587 % of family members)
Environment Ontology (ENVO) Unclassified
(41.259 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(61.538 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.17%    β-sheet: 0.00%    Coil/Unstructured: 71.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 143 Family Scaffolds
PF01171ATP_bind_3 52.45
PF09925DUF2157 2.10
PF04519Bactofilin 1.40
PF02540NAD_synthase 0.70
PF13620CarboxypepD_reg 0.70
PF01842ACT 0.70
PF01042Ribonuc_L-PSP 0.70
PF00578AhpC-TSA 0.70
PF13646HEAT_2 0.70

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 143 Family Scaffolds
COG0037tRNA(Ile)-lysidine synthase TilS/MesJTranslation, ribosomal structure and biogenesis [J] 52.45
COG0301Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)Translation, ribosomal structure and biogenesis [J] 52.45
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 52.45
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 52.45
COG06037-cyano-7-deazaguanine synthase (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 52.45
COG1606ATP-utilizing enzyme, PP-loop superfamilyGeneral function prediction only [R] 52.45
COG1664Cytoskeletal protein CcmA, bactofilin familyCytoskeleton [Z] 1.40
COG0171NH3-dependent NAD+ synthetaseCoenzyme transport and metabolism [H] 0.70
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.70


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.71 %
UnclassifiedrootN/A6.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000531|CNBas_1001542Not Available1221Open in IMG/M
3300000956|JGI10216J12902_111270247All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300003319|soilL2_10001824All Organisms → cellular organisms → Bacteria14369Open in IMG/M
3300004114|Ga0062593_102807265All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300005184|Ga0066671_10309692All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium993Open in IMG/M
3300005294|Ga0065705_10242138Not Available1227Open in IMG/M
3300005294|Ga0065705_10740821All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300005336|Ga0070680_100079503All Organisms → cellular organisms → Bacteria2703Open in IMG/M
3300005345|Ga0070692_10917585All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300005364|Ga0070673_100265490All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1501Open in IMG/M
3300005365|Ga0070688_100206979Not Available1375Open in IMG/M
3300005365|Ga0070688_100490359All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium925Open in IMG/M
3300005441|Ga0070700_101193652All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium635Open in IMG/M
3300005444|Ga0070694_101252252All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300005444|Ga0070694_101363555All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300005444|Ga0070694_101543826All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300005445|Ga0070708_100448479All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1217Open in IMG/M
3300005445|Ga0070708_100642601Not Available1000Open in IMG/M
3300005459|Ga0068867_101534472All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium621Open in IMG/M
3300005468|Ga0070707_100930208All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium834Open in IMG/M
3300005471|Ga0070698_101439727All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria640Open in IMG/M
3300005471|Ga0070698_102129174All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300005518|Ga0070699_100266525All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1532Open in IMG/M
3300005547|Ga0070693_100340932All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1023Open in IMG/M
3300005577|Ga0068857_101212819All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium731Open in IMG/M
3300005616|Ga0068852_101994228All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300005617|Ga0068859_100264895All Organisms → cellular organisms → Bacteria → Proteobacteria1810Open in IMG/M
3300005719|Ga0068861_101154375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium747Open in IMG/M
3300005842|Ga0068858_101746268All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300005843|Ga0068860_101890344All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300006796|Ga0066665_11183916All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300006797|Ga0066659_11687055All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300006800|Ga0066660_10165254All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1654Open in IMG/M
3300006845|Ga0075421_101897083All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300006854|Ga0075425_100606057Not Available1259Open in IMG/M
3300006871|Ga0075434_100483654All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1259Open in IMG/M
3300006871|Ga0075434_102411596All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300006903|Ga0075426_10108464All Organisms → cellular organisms → Bacteria → Acidobacteria1992Open in IMG/M
3300006954|Ga0079219_10597168All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium807Open in IMG/M
3300009012|Ga0066710_101810294All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium921Open in IMG/M
3300009088|Ga0099830_10377399All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1144Open in IMG/M
3300009089|Ga0099828_10054407All Organisms → cellular organisms → Bacteria → Acidobacteria3334Open in IMG/M
3300009089|Ga0099828_10674308All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium929Open in IMG/M
3300009092|Ga0105250_10145292All Organisms → cellular organisms → Bacteria → Acidobacteria985Open in IMG/M
3300009098|Ga0105245_12067014All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300009100|Ga0075418_10183448All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2228Open in IMG/M
3300009147|Ga0114129_13017647All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300009156|Ga0111538_12844651All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300009162|Ga0075423_10112325All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia2854Open in IMG/M
3300009162|Ga0075423_10201192All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2089Open in IMG/M
3300009168|Ga0105104_10208723All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1062Open in IMG/M
3300009174|Ga0105241_10388662All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1221Open in IMG/M
3300009176|Ga0105242_10761231All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium954Open in IMG/M
3300010037|Ga0126304_10088194All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1945Open in IMG/M
3300010043|Ga0126380_10961011All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300010044|Ga0126310_11179577All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300010046|Ga0126384_10305562All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1309Open in IMG/M
3300010166|Ga0126306_11667670All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300010303|Ga0134082_10130127All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1010Open in IMG/M
3300010325|Ga0134064_10188878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium733Open in IMG/M
3300010360|Ga0126372_10063476All Organisms → cellular organisms → Bacteria → Acidobacteria2583Open in IMG/M
3300010362|Ga0126377_13384511All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300010366|Ga0126379_13862119All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300010371|Ga0134125_12332411All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300010373|Ga0134128_13052218All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300010375|Ga0105239_10167368All Organisms → cellular organisms → Bacteria → Acidobacteria2458Open in IMG/M
3300010375|Ga0105239_12619061All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300010397|Ga0134124_13026373All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300010399|Ga0134127_13511372All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300010400|Ga0134122_11766106All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium649Open in IMG/M
3300010400|Ga0134122_13204722All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300010401|Ga0134121_10125005All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2175Open in IMG/M
3300011443|Ga0137457_1218290All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium652Open in IMG/M
3300012201|Ga0137365_10385620All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1034Open in IMG/M
3300012205|Ga0137362_10188128All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1776Open in IMG/M
3300012208|Ga0137376_10648444All Organisms → cellular organisms → Bacteria → Acidobacteria912Open in IMG/M
3300012356|Ga0137371_10351280All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1146Open in IMG/M
3300012359|Ga0137385_10334077All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1299Open in IMG/M
3300012359|Ga0137385_10999917All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium690Open in IMG/M
3300012469|Ga0150984_117163299All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium822Open in IMG/M
3300012532|Ga0137373_10364077All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1132Open in IMG/M
3300012684|Ga0136614_10416833All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium979Open in IMG/M
3300012917|Ga0137395_10511892All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium865Open in IMG/M
3300012922|Ga0137394_10094315All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2515Open in IMG/M
3300012923|Ga0137359_11369523All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300012925|Ga0137419_10373473All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300012925|Ga0137419_10999751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium693Open in IMG/M
3300012927|Ga0137416_11646685All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300012948|Ga0126375_11016574All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium676Open in IMG/M
3300012971|Ga0126369_12149512All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium646Open in IMG/M
3300012976|Ga0134076_10492530All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300013100|Ga0157373_11250267All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300013297|Ga0157378_10296811All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1563Open in IMG/M
3300013297|Ga0157378_11108259All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium829Open in IMG/M
3300013308|Ga0157375_11192098All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium893Open in IMG/M
3300014325|Ga0163163_12842782All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300014487|Ga0182000_10063936All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300014488|Ga0182001_10520547All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300014968|Ga0157379_10879519All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium849Open in IMG/M
3300015164|Ga0167652_1074668All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300015373|Ga0132257_102114362All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300018027|Ga0184605_10102188All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1266Open in IMG/M
3300018476|Ga0190274_10024463All Organisms → cellular organisms → Bacteria → Acidobacteria4029Open in IMG/M
3300019767|Ga0190267_10532306All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium705Open in IMG/M
3300021061|Ga0196973_1081370All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300021082|Ga0210380_10347854All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300021445|Ga0182009_10159422Not Available1077Open in IMG/M
3300022694|Ga0222623_10035820All Organisms → cellular organisms → Bacteria1894Open in IMG/M
3300022756|Ga0222622_11167085All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300025321|Ga0207656_10638051All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria544Open in IMG/M
3300025899|Ga0207642_10134397Not Available1295Open in IMG/M
3300025906|Ga0207699_10715550All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium733Open in IMG/M
3300025907|Ga0207645_10972000All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300025908|Ga0207643_10155212Not Available1375Open in IMG/M
3300025917|Ga0207660_11729064All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300025922|Ga0207646_11235847All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium654Open in IMG/M
3300025935|Ga0207709_11458558All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300025940|Ga0207691_11180562All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300025949|Ga0207667_10972694All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium837Open in IMG/M
3300025960|Ga0207651_11492512All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300025961|Ga0207712_11955037All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300026088|Ga0207641_11979998All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300026095|Ga0207676_11693945All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300026118|Ga0207675_100683095All Organisms → cellular organisms → Bacteria → Acidobacteria1034Open in IMG/M
3300026118|Ga0207675_100809025All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium951Open in IMG/M
3300026118|Ga0207675_101362301All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium730Open in IMG/M
3300026295|Ga0209234_1200770Not Available677Open in IMG/M
3300026300|Ga0209027_1308284All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300026307|Ga0209469_1107583All Organisms → cellular organisms → Bacteria → Acidobacteria744Open in IMG/M
3300026547|Ga0209156_10478411All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300027603|Ga0209331_1060247All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium952Open in IMG/M
3300027691|Ga0209485_1173266All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300027846|Ga0209180_10096766All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1679Open in IMG/M
3300027903|Ga0209488_10738841All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M
3300030511|Ga0268241_10182986All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300031231|Ga0170824_119483464All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1048Open in IMG/M
3300031456|Ga0307513_10895095All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300031548|Ga0307408_102480384All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300031954|Ga0306926_12892700All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300032000|Ga0310903_10459375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300032005|Ga0307411_12294250All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300032180|Ga0307471_101410576All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium857Open in IMG/M
3300032180|Ga0307471_101603765All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium807Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.59%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.29%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.99%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.80%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.80%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.10%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.10%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.10%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.10%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.10%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.10%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.10%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.40%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.40%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.40%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.40%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.40%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.40%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.40%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.40%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.40%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.70%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.70%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.70%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.70%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.70%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.70%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.70%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.70%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.70%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.70%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.70%
Quercus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.70%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.70%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.70%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000531Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_AssembledHost-AssociatedOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015164Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300021061Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5-13CEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
CNBas_100154233300000531Quercus RhizosphereMKDLDFSDFPPGTVTDYTTLVCLACIFDIFTKQIG
JGI10216J12902_11127024733300000956SoilMVTSKKRELDLKDFPSGTVTEYTTLVCLACIFDIF
soilL2_10001824153300003319Sugarcane Root And Bulk SoilMKSFELDFSEFPPGSVTEYTTLVCLACIFDIFTKQIGLAPRSAYSEIKRYSP
Ga0062593_10280726523300004114SoilVSKTTKKQKDLDLSAFPPGSVTEFSTLVCLACTFDIFTTQLGLAPRTAYSEI
Ga0066671_1030969223300005184SoilMAATKQLELDLKDFPPGTVTEFTTLVCLACTFDIFTKQLGLAPRTAFSEI
Ga0065705_1024213813300005294Switchgrass RhizosphereMKELDFSGFPPGTITDYTTLVCLACIFDIFTKQIGLAPRS
Ga0065705_1074082123300005294Switchgrass RhizosphereMKKSTELDFSEFPPGTVTEYTTLVCLACIFDIFTKQLGLAPRT
Ga0070680_10007950313300005336Corn RhizosphereMGSAKQELDFSDFPQGAVTEYTTLVCLACIFDIFTKQIGLAPRSAYS
Ga0070692_1091758513300005345Corn, Switchgrass And Miscanthus RhizosphereMVASKKRELDLSAFPSGTVTEYTTLVCLACIFDIFTKQLRM
Ga0070673_10026549013300005364Switchgrass RhizosphereMPATTKKRELDLKDFPPGTVTEFTTLVCLACIFDIFTKQLGLAPRT
Ga0070688_10020697923300005365Switchgrass RhizosphereMTSKRELDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRSAYSEIKRYS
Ga0070688_10049035923300005365Switchgrass RhizosphereMKDLDFSGFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYSEIKRY
Ga0070700_10119365223300005441Corn, Switchgrass And Miscanthus RhizosphereMPATTKKRELELKDFPPGTVTEFTTLVCLACIFDIFTKQLGLAPR
Ga0070694_10125225223300005444Corn, Switchgrass And Miscanthus RhizosphereMKELDFTDFPPGSVTEYTTLVCLACIFDIFTKQIGLAPRSAYTEIKRY
Ga0070694_10136355523300005444Corn, Switchgrass And Miscanthus RhizosphereMKELDFSGFPPGTVTDYTTLVCLACIFDIFTKQIGLAPRSAYSEIK
Ga0070694_10154382623300005444Corn, Switchgrass And Miscanthus RhizosphereMPTKRDLDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRSAYSEI
Ga0070708_10044847913300005445Corn, Switchgrass And Miscanthus RhizosphereMPKAAKRRELDFADFPPGTVTEYSTLVCLACTFDIFTTQLGLAPR
Ga0070708_10064260123300005445Corn, Switchgrass And Miscanthus RhizosphereMPTKRDLDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRSAYSEIKRYSP
Ga0068867_10153447213300005459Miscanthus RhizosphereMATTTKKRELDLSEFPAGTVTEYTTLVCLACIFDIFTKQLGLAPR
Ga0070707_10093020813300005468Corn, Switchgrass And Miscanthus RhizosphereMKELDFSEFPPGTVTEYTTLVCLACIFDIFTKQIELAPRSAYSEIKRYSP
Ga0070698_10143972713300005471Corn, Switchgrass And Miscanthus RhizosphereMSTAKKRHDLDLSAFPLGSVTEYSTLVCLACTFDIFTTQLGLAPRTA
Ga0070698_10212917413300005471Corn, Switchgrass And Miscanthus RhizosphereVSKTATKKKELDLSNFPPGSVTEFSTLVCLACTFDIFTTQLGLAPRTAYS
Ga0070699_10026652513300005518Corn, Switchgrass And Miscanthus RhizosphereMAATKRRELDLSDFPPGTVTEYTTLVCLACIFDIFTRQLGLAPRTAF
Ga0070693_10034093213300005547Corn, Switchgrass And Miscanthus RhizosphereMTSKRELDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLA
Ga0068857_10121281923300005577Corn RhizosphereMKDLDFSDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYTEIKRY
Ga0068852_10199422813300005616Corn RhizosphereMTTKRELDYSAFSPGTVTEYTTLVCLACIFDIFTKQFGLAPRS
Ga0068859_10026489533300005617Switchgrass RhizosphereMPATTKKRELDLKDFPPGTVTEFTTLVCLACIFDIFTKQLG
Ga0068861_10115437513300005719Switchgrass RhizosphereMKAVVPDFSEFPPGTVTEYTTLVCLACIFDIFTKQIGL
Ga0068858_10174626823300005842Switchgrass RhizosphereMKELDLTEFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYT
Ga0068860_10189034423300005843Switchgrass RhizosphereVATNPKRELDLSDFPSGTVTEYTTLVCLACIFDIFTKQLGLAPR
Ga0066665_1118391623300006796SoilMRVMPAPKKKRELDLSEFPPGTITEYTTLVCLACIFDIFTKQ
Ga0066659_1168705513300006797SoilMATTKRRELDLKDFPPGTVTEYTTLVCLACIFDIFTKQLGLAPRTAF
Ga0066660_1016525413300006800SoilMATTKKRELDLSEFPSGSVTEYTTLVCLACIFDIFTKQLGLAARTAF
Ga0075421_10189708323300006845Populus RhizosphereMTAQTRELDFSDFPPGSVTEYTTLVCLACIFDIFTKQFGLAPRSA
Ga0075425_10060605713300006854Populus RhizosphereMPTKRDLDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRSAY
Ga0075434_10048365413300006871Populus RhizosphereMTTAKRELDLKDFPPGTVTEFTTLVCLACIFDIFTKQLGLAPRTAFSEI
Ga0075434_10241159613300006871Populus RhizosphereMASTKKRELDLKDFPPGTVTEYTTLVCLACIFDIFTRQLGLAPRSAFTEIKRHAP
Ga0075426_1010846413300006903Populus RhizosphereMPAAKKQRELDLSEFPSGSVTEYTTLVCLACIFDIFTKQLLLPPRTAFSEI
Ga0079219_1059716813300006954Agricultural SoilMKELDFTDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYTEIKR
Ga0066710_10181029423300009012Grasslands SoilMVTLSKKRELDFGDFPTGSVTEYTTLDCLACTFDIFTAQLGLAPRTAY
Ga0099830_1037739913300009088Vadose Zone SoilMATTKKRELDLSDFPPGTVTEYTTLVCLACIFDIF
Ga0099828_1005440733300009089Vadose Zone SoilMPPTKQRELDLSEFPSGTVTEYTTLVCLACIFDIFTKQLGLAPRT
Ga0099828_1067430823300009089Vadose Zone SoilMPTTKKRELDLKEFPPGTVTEYTTLVCLACIFDIFTKQLGLAPR
Ga0105250_1014529223300009092Switchgrass RhizosphereMKELDFTDFPPGSVTEYTTLVCLACIFDIFTKQIGLAPRSAYTEIKRYSP
Ga0105245_1206701413300009098Miscanthus RhizosphereMKELDLTELPPGTVTEYTTLVCLACIFDIFTKQIGLAPRS
Ga0075418_1018344843300009100Populus RhizosphereMTAQTRELDFSDFSPGSVTEYTTLVCLACIFDIFTKQFGLALRSAYS
Ga0114129_1301764723300009147Populus RhizosphereMATMKKREIDLSEFPPGTVTEYTTLVCLACIFDISTKPLRLA
Ga0111538_1284465123300009156Populus RhizosphereMTAKRELDYSAFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRSAYSEIKRYSP
Ga0075423_1011232513300009162Populus RhizosphereMKDLDFSEFPPGTVTEYTTLVCLACIFDIFTKQIGL
Ga0075423_1020119213300009162Populus RhizosphereMPTKRDLDFSAFPPGTVTEYTTLVCLACIFDIFTKQFG
Ga0105104_1020872323300009168Freshwater SedimentMTKRELDFSDFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRSAYSEIKRYS
Ga0105241_1038866223300009174Corn RhizosphereMAQAKKQRELDFSEFPPGTVTEYTTLVCLACIFDIFTKQLGLAPRTAFSEI
Ga0105242_1076123123300009176Miscanthus RhizosphereMATAKKRELDLSGFPPGTVTEFTTLVCLACIFDIFTQQLGLAPRTAFSEVKR
Ga0126304_1008819433300010037Serpentine SoilMTTKRELDFTAFPPGTVSEYTTLVCLACIFDIFTKQFGLAARSAYSEIKRY*
Ga0126380_1096101123300010043Tropical Forest SoilMATTKKRELDLKDFPAGTVTEFTTLVCLACIFDIFTKQLGLAARTAFS
Ga0126310_1117957713300010044Serpentine SoilMPSATKKRELDFSAFPPGAVSEYSTELCLACIFDVFTKQLAMLGHRRA
Ga0126384_1030556213300010046Tropical Forest SoilMAQARKQRELDLSEFPPGTVTEYTTFVCLACIFDIFTKQ
Ga0126306_1166767013300010166Serpentine SoilMATATKKRELDFSDFPPGTVTEYTRQLCLACIFDIFTA
Ga0134082_1013012713300010303Grasslands SoilMTPTKKREIDLSEFPPGTVTEYTTLVCLACIFDIFTRQLGLAPRTAFSEVK
Ga0134064_1018887813300010325Grasslands SoilMATSTKQRELDLSEFPAGTVTEFTTLVCLACIFDI
Ga0126372_1006347633300010360Tropical Forest SoilMPSTRELDFSGFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYSEIK
Ga0126377_1338451113300010362Tropical Forest SoilMAQAKKQRELDLGEFPPGTVTEYTTLVCLACIFDIFTKQLQLAPRTAFSEIK
Ga0126379_1386211913300010366Tropical Forest SoilMPATAKKRELDFKEFPAGTVTEYTTLVCLACIFDIFT
Ga0134125_1233241123300010371Terrestrial SoilMPTAKKKPLDLSAFPPGSVTEFSTLVCLACTFEIFTTQLGLAPRTAYSEIR
Ga0134128_1305221813300010373Terrestrial SoilMTATKKKREVDLSAFPPGSVTEYSTLVCLACVFDIFTTQLGFAPRTA
Ga0105239_1016736843300010375Corn RhizosphereMTTKGELDFSAFPPGSVTEYTTLVCLACIFDIFTKQFGLAPRSAY
Ga0105239_1261906123300010375Corn RhizosphereMQMKDLDFSDFPPGTVTEYTTLVCLACIFDIFTKQ
Ga0134124_1302637323300010397Terrestrial SoilMKELDFSDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYTEIKRYSP
Ga0134127_1351137223300010399Terrestrial SoilMKELDFSDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYSEIKRYSPTV
Ga0134122_1176610613300010400Terrestrial SoilMPATTKTRELDLKDFPPGTVTEFTTLVCLACIFDIFTKQLGLAPRTA
Ga0134122_1320472223300010400Terrestrial SoilMPQAVKQRELDLSQFPPGTITEYTTFVCLACIFDIFTK
Ga0134121_1012500513300010401Terrestrial SoilMTSKRELDFSAFPPGTVTEDATLVCLACIFDIFTKQFGLA
Ga0137457_121829023300011443SoilMTTKRELDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRS
Ga0137365_1038562013300012201Vadose Zone SoilMGKNRELDFSGFPPGTITEYTTLICLACIFDIFTKQIG
Ga0137362_1018812813300012205Vadose Zone SoilMGNNRELDFSGFPPGTITEYTTLVCLACIFDIFTKQI
Ga0137376_1064844413300012208Vadose Zone SoilMPKTKRELDLSEFPPGTITEYTTLVCLACIFDIFTKQLGLAPRTAFSEVKR
Ga0137371_1035128023300012356Vadose Zone SoilMAKPKRELDLNDFPPGTVTEYTTLVCLACIFDIFTKQLGLAPRTAF
Ga0137385_1033407723300012359Vadose Zone SoilMVTLSKKRELDFGDFPTGSVTEYTTLVCLACTFDIFTAQLG
Ga0137385_1099991723300012359Vadose Zone SoilMAITKKRELDLSEFPPGTITEYTTLVCLACIFDIFTKQFGLAARTAFSEI
Ga0150984_11716329923300012469Avena Fatua RhizosphereMPAASKKRELDFGGFPPGTVTEYTTLVCLACIFDIFTKQLGLAPRTA
Ga0137373_1036407713300012532Vadose Zone SoilMATAKKSELELKDFPPGTVTEYTTLVCLACIFDIFTKQL
Ga0136614_1041683323300012684Polar Desert SandMAATSKAKTFELDWSAFPPGAVNEYTTQICLACIFDVFTGQLGLAPRT
Ga0137395_1051189223300012917Vadose Zone SoilMPGPTKKRELDLSEFPPGTVTEYTTLVCLACIFDIFTKQLGLAPR
Ga0137394_1009431543300012922Vadose Zone SoilMQPTKQRELDLTEFPPGTVTEYTTLVYLACIFDIFP
Ga0137359_1136952313300012923Vadose Zone SoilMTAKQRELDLTEFPSGTVTEYTTLVCLACIFDIFTKQLNLAPR
Ga0137419_1037347323300012925Vadose Zone SoilMPAPTKKRELDLSEFPPGTITEYTTLVCLACIFDIFTKQLGLAPRTAFSEVKR
Ga0137419_1099975113300012925Vadose Zone SoilVSTTKKRELDLSDFPPGTVTEYTTLVCLARIFDIFTRHLGLAPRTAFSE
Ga0137416_1164668513300012927Vadose Zone SoilMSTTKNKRELDLSAFPSGTVTEYSTLVCLACTFEIFTTQLGLAPRTAYSE
Ga0126375_1101657413300012948Tropical Forest SoilMPTTRELDFSGFPPGTVTEYTTLVCLACIFDIFTKQIGL
Ga0126369_1214951223300012971Tropical Forest SoilMSKSRELDFKDFPSGTVTEFTTLVCLACIFDIFTTQLR
Ga0134076_1049253023300012976Grasslands SoilMRVMPATKKQRELDLSEFPPGTITEYTTLVCLACIFDIFTKQF
Ga0157373_1125026723300013100Corn RhizosphereMTTKRFELDLSEFPSGSITEYTTLVCLACIFDIFTRQLGLAPR
Ga0157378_1029681133300013297Miscanthus RhizosphereMIKKSRELDLSDFPAGTVTEYTTLVCLACIFDIFTRQFDLAPRKAY
Ga0157378_1110825923300013297Miscanthus RhizosphereVATNPRRELDLSDFPSGTVTEYTTLVCLACIFDIFTKQLGLAPRTAFSEIKRH
Ga0157375_1119209813300013308Miscanthus RhizosphereVATNPKRELDLSGFPSGTVTEYTTLVCLACIFDIFTKQLGLAP
Ga0163163_1284278213300014325Switchgrass RhizosphereMKLTELDFSEFPPGTVTDYTTLVCLACIFDVFTKQIGLAPRSAYSEIKRY
Ga0182000_1006393633300014487SoilMAAKPGTRELDLSEFPKGTVTEFTTLVCLACIFDIFTKQLGLAPRTAFSEIK
Ga0182001_1052054723300014488SoilMATATKKRELDFQAFPPGTVAEYTTRLCLACIFDVFTAQL
Ga0157379_1087951923300014968Switchgrass RhizosphereMGAERSELDFSAFPPGTVTEYTTLVCLACIFDIFTKQIG
Ga0167652_107466813300015164Glacier Forefield SoilMPPPKKRELDLSEFPRGTITEYTTLVCLACIFDIFTKQLGLAPRTA
Ga0132257_10211436223300015373Arabidopsis RhizosphereMKELDFSGFPPGTVTDYTTLVCLACIFDIFTKQIGLA
Ga0184605_1010218823300018027Groundwater SedimentMPTAKKKPLDLSAFPPGIVTEYSTLVCLACTFEIFTTQLGLAPRTAYSEI
Ga0190274_1002446333300018476SoilMTKKKELVLDSGDFPAGSVTEYSTLVCLACTFDIFTKQRGLAPR
Ga0190267_1053230623300019767SoilMATTASKKRELDWSDFPPGTVTEYTRLLCLACIFDIFTE
Ga0196973_108137013300021061SoilMVVTAAKKRELNFADFPPGAITEYTTLLCLACIFDIFTKQLG
Ga0210380_1034785413300021082Groundwater SedimentMTTKRELDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLAPRSAYSEIKR
Ga0182009_1015942223300021445SoilMKKSTELDFSEFPPGTVTEYTTLVCLACIFDIFTKQLGLAP
Ga0222623_1003582013300022694Groundwater SedimentMATTKKRELDLSEFPPGTVTEYTTLVCLACIFDIFTKQL
Ga0222622_1116708513300022756Groundwater SedimentMGKAAKPGEFDLSEFPQGSVTEYSTLVCLACTFDIFTSQLGLAPRTA
Ga0207656_1063805133300025321Corn RhizosphereMKELDLTDFPPGTVTEYTTLVCLACIFDIFTKQIG
Ga0207642_1013439733300025899Miscanthus RhizosphereMTTKGELDFSAFPPGSVTEYTTLVCLACIFDIFTKQFGLAP
Ga0207699_1071555013300025906Corn, Switchgrass And Miscanthus RhizosphereMATKRDLDFSAFPPGTVTEYTTLVCLACIFDIFTKQFGLA
Ga0207645_1097200013300025907Miscanthus RhizosphereMATTQTREIDLSAFPSGTVTEFTTLVCLACIFDIFTKQLGLAPRTAFSEI
Ga0207643_1015521213300025908Miscanthus RhizosphereMKELDFTDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYTE
Ga0207660_1172906413300025917Corn RhizosphereMIKKSRELDLSDFPAGTVTEYITLVCLACIFDIFTRQFDLAP
Ga0207646_1123584713300025922Corn, Switchgrass And Miscanthus RhizosphereMGKNRELDFSGFPPGTITEYTTLVCLACIFDIFTKQIRLA
Ga0207709_1145855813300025935Miscanthus RhizosphereMKELDFTDFPPGTVTAYTTLVCLACIFDIFTKQIGLAPRSAYSEIKRYSPT
Ga0207691_1118056213300025940Miscanthus RhizosphereMKELDFSDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRS
Ga0207667_1097269413300025949Corn RhizosphereMTELDFSDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYSEIK
Ga0207651_1149251213300025960Switchgrass RhizosphereMKDLDFSGFPPGTVTEYTTLVCLACIFDIFTKQIGL
Ga0207712_1195503713300025961Switchgrass RhizosphereMTTKRFELDLSEFPSGSITEYTTLVCLACIFDIFTRQLGL
Ga0207641_1197999823300026088Switchgrass RhizosphereMKELDFSDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSA
Ga0207676_1169394513300026095Switchgrass RhizosphereMTTKGELDFSAFPPGSVTEYTTLVCLACIFDIFTKQ
Ga0207675_10068309513300026118Switchgrass RhizosphereMKELDFTDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPR
Ga0207675_10080902523300026118Switchgrass RhizosphereMGAERSELDFSAFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYSEIK
Ga0207675_10136230113300026118Switchgrass RhizosphereMTAKRELDYSAFSPGTVTEYTTLVCLACIFDIFTKQFGLAPRS
Ga0209234_120077023300026295Grasslands SoilMPATKKQRELDLSEFPSGSVTEYTTLVCLACIFDIFTKQL
Ga0209027_130828413300026300Grasslands SoilMRVMPATKKQRELDLSEFPPGTITEYTTLVCLACIFDIFTK
Ga0209469_110758323300026307SoilMRVMPAPKKKRELDLSEFPPGTITEYTTLVCLACIFDIFTKQLGLAARTAFSEIKR
Ga0209156_1047841113300026547SoilMSKNREIDLSEFPAGTVTEFTTLVCLACIFDIFTKQLGLAPRT
Ga0209331_106024713300027603Forest SoilMATTRKRELDLKDFPPGTITEYTTLVCLACIFDIFTKQLGLAPRTA
Ga0209485_117326613300027691Agricultural SoilMKLTELDFSDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYSEIKRYS
Ga0209180_1009676633300027846Vadose Zone SoilMPAKQRELDLTEFPSGTVTEYTTLVCLACIFDIFTKQLNLAPRTAFSEIKRHT
Ga0209488_1073884123300027903Vadose Zone SoilMAATKKRELDLRDFPPGTVTEFTTLVCLACIFDIFTKQLGLTPRTAFSEVKR
Ga0268241_1018298623300030511SoilMKDLDFSDFPPGTVTEYTTLVCLACIFDIFTKQIGLAPRSAYSEIKRY
Ga0170824_11948346413300031231Forest SoilMAAKPRAHELDLSGFPKGTVTEYTTLVCLACIFDIFTKQLGLAPRTAF
Ga0307513_1089509513300031456EctomycorrhizaMATATKKPLDLSDFPAGSVTEYTTLVCLACTFDIFT
Ga0307408_10248038423300031548RhizosphereMATASKKRELDFTDFPPGTVAEYATLLCLACIFDIFTVQLGLAPRTA
Ga0306926_1289270013300031954SoilMVRSVELDLTEFPSGTVTEFTTLVCLACIFDIFTK
Ga0310903_1045937523300032000SoilMTQTRELDFSDFPPGSVTEYTTLVCLACIFDIFTKQFGL
Ga0307411_1229425023300032005RhizosphereMAASAKKRELDFSAFPPGAVTEYSTLLCLACIFDIFTK
Ga0307471_10141057613300032180Hardwood Forest SoilMVTLSKKRELDFGDFPKGSVTEYTTLVCLACTFDIFTAQLG
Ga0307471_10160376523300032180Hardwood Forest SoilMPSTRELDFSAFPPGTVTEYTTLVCLACIFDIFTKQI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.