| Basic Information | |
|---|---|
| Family ID | F051780 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 143 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MILTFSSQIESADGERRIIAGKIVPYEEVGNTSVGKV |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 59.70 % |
| % of genes near scaffold ends (potentially truncated) | 93.01 % |
| % of genes from short scaffolds (< 2000 bps) | 85.31 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (66.434 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (41.259 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.727 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (76.224 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 15.38% Coil/Unstructured: 84.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF04860 | Phage_portal | 86.71 |
| PF03237 | Terminase_6N | 3.50 |
| PF03354 | TerL_ATPase | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.92 % |
| Unclassified | root | N/A | 16.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002091|JGI24028J26656_1011235 | All Organisms → Viruses → Predicted Viral | 1070 | Open in IMG/M |
| 3300002408|B570J29032_108786272 | Not Available | 509 | Open in IMG/M |
| 3300002408|B570J29032_109276357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300003277|JGI25908J49247_10052183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1066 | Open in IMG/M |
| 3300003393|JGI25909J50240_1018904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1601 | Open in IMG/M |
| 3300003394|JGI25907J50239_1115294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300003411|JGI25911J50253_10130636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
| 3300003431|JGI25913J50563_1064657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
| 3300003616|JGI25928J51866_1056671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 920 | Open in IMG/M |
| 3300005517|Ga0070374_10596349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300005527|Ga0068876_10224226 | Not Available | 1084 | Open in IMG/M |
| 3300005580|Ga0049083_10256296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300005582|Ga0049080_10205787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300005805|Ga0079957_1242250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 842 | Open in IMG/M |
| 3300006805|Ga0075464_10769447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300006805|Ga0075464_11062976 | Not Available | 509 | Open in IMG/M |
| 3300006920|Ga0070748_1303447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300007363|Ga0075458_10267094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300007861|Ga0105736_1170939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300008114|Ga0114347_1227460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300008120|Ga0114355_1196873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300008122|Ga0114359_1109190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 979 | Open in IMG/M |
| 3300008265|Ga0114361_1089302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
| 3300008266|Ga0114363_1110399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 974 | Open in IMG/M |
| 3300008339|Ga0114878_1024369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2793 | Open in IMG/M |
| 3300009026|Ga0102829_1195456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300009026|Ga0102829_1254870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300009152|Ga0114980_10321250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
| 3300009164|Ga0114975_10755764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300009183|Ga0114974_10596940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300009187|Ga0114972_10397687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| 3300010885|Ga0133913_11149853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1995 | Open in IMG/M |
| 3300012006|Ga0119955_1123459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300012013|Ga0153805_1082979 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 544 | Open in IMG/M |
| 3300013005|Ga0164292_10815542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300013010|Ga0129327_10245639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10584454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300017701|Ga0181364_1050700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300017707|Ga0181363_1090700 | Not Available | 518 | Open in IMG/M |
| 3300017722|Ga0181347_1153287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300017722|Ga0181347_1170186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300017723|Ga0181362_1008897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2154 | Open in IMG/M |
| 3300017723|Ga0181362_1061034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
| 3300017736|Ga0181365_1072476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
| 3300017736|Ga0181365_1072559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 848 | Open in IMG/M |
| 3300017736|Ga0181365_1120596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300017736|Ga0181365_1162126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300017736|Ga0181365_1162283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300017736|Ga0181365_1165894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300017747|Ga0181352_1080763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
| 3300017766|Ga0181343_1148195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300017777|Ga0181357_1275718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300017778|Ga0181349_1289105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300017780|Ga0181346_1158261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
| 3300017780|Ga0181346_1325016 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 516 | Open in IMG/M |
| 3300017784|Ga0181348_1293457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300017785|Ga0181355_1213295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
| 3300017785|Ga0181355_1275522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300019784|Ga0181359_1069796 | Not Available | 1333 | Open in IMG/M |
| 3300019784|Ga0181359_1116495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
| 3300019784|Ga0181359_1145567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300019784|Ga0181359_1239436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300020048|Ga0207193_1448887 | Not Available | 856 | Open in IMG/M |
| 3300020084|Ga0194110_10307382 | Not Available | 1117 | Open in IMG/M |
| 3300020151|Ga0211736_10016960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300020172|Ga0211729_10539262 | Not Available | 1280 | Open in IMG/M |
| 3300020172|Ga0211729_11080815 | Not Available | 1024 | Open in IMG/M |
| 3300020204|Ga0194116_10278686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
| 3300020542|Ga0208857_1021353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1070 | Open in IMG/M |
| 3300020553|Ga0208855_1016390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1134 | Open in IMG/M |
| 3300021952|Ga0213921_1005653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2523 | Open in IMG/M |
| 3300021952|Ga0213921_1057983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300021962|Ga0222713_10286427 | Not Available | 1056 | Open in IMG/M |
| 3300021963|Ga0222712_10645522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300022072|Ga0196889_1025579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1213 | Open in IMG/M |
| 3300022179|Ga0181353_1074507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
| 3300022179|Ga0181353_1159236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300022407|Ga0181351_1153566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
| 3300022407|Ga0181351_1170386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
| 3300022407|Ga0181351_1219578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300022407|Ga0181351_1261777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300023174|Ga0214921_10253553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1029 | Open in IMG/M |
| 3300023184|Ga0214919_10083585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2803 | Open in IMG/M |
| 3300024346|Ga0244775_11511205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300024481|Ga0256330_1139973 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 511 | Open in IMG/M |
| 3300025647|Ga0208160_1081783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
| 3300025896|Ga0208916_10017851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2791 | Open in IMG/M |
| 3300027127|Ga0255071_1043596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300027290|Ga0255136_1068541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300027518|Ga0208787_1097726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300027563|Ga0209552_1141514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300027608|Ga0208974_1096629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
| 3300027621|Ga0208951_1017887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2276 | Open in IMG/M |
| 3300027659|Ga0208975_1035157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1584 | Open in IMG/M |
| 3300027688|Ga0209553_1119930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 926 | Open in IMG/M |
| 3300027688|Ga0209553_1177507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300027689|Ga0209551_1115480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
| 3300027689|Ga0209551_1249073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300027721|Ga0209492_1047110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1518 | Open in IMG/M |
| 3300027733|Ga0209297_1203383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300027736|Ga0209190_1032217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2801 | Open in IMG/M |
| 3300027736|Ga0209190_1160376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
| 3300027754|Ga0209596_1181175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 913 | Open in IMG/M |
| 3300027756|Ga0209444_10187567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300027763|Ga0209088_10129463 | Not Available | 1132 | Open in IMG/M |
| 3300027764|Ga0209134_10027716 | All Organisms → Viruses → Predicted Viral | 1824 | Open in IMG/M |
| 3300027772|Ga0209768_10385670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300027777|Ga0209829_10433157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300027782|Ga0209500_10138518 | Not Available | 1159 | Open in IMG/M |
| 3300027785|Ga0209246_10127781 | Not Available | 998 | Open in IMG/M |
| 3300027793|Ga0209972_10036072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2813 | Open in IMG/M |
| 3300027798|Ga0209353_10192203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
| 3300027808|Ga0209354_10042647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1823 | Open in IMG/M |
| 3300027808|Ga0209354_10167003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 896 | Open in IMG/M |
| 3300027808|Ga0209354_10296962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300027816|Ga0209990_10032383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2795 | Open in IMG/M |
| 3300027896|Ga0209777_10110746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 2323 | Open in IMG/M |
| 3300027969|Ga0209191_1331893 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 554 | Open in IMG/M |
| 3300028108|Ga0256305_1175825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300028394|Ga0304730_1270420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300031758|Ga0315907_10432041 | Not Available | 1055 | Open in IMG/M |
| 3300031758|Ga0315907_10654104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
| 3300031787|Ga0315900_10954795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300031951|Ga0315904_10049978 | All Organisms → cellular organisms → Bacteria | 4673 | Open in IMG/M |
| 3300032046|Ga0315289_11366567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300032173|Ga0315268_10963880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300033981|Ga0334982_0114559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1406 | Open in IMG/M |
| 3300033993|Ga0334994_0039303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3016 | Open in IMG/M |
| 3300034018|Ga0334985_0308217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 988 | Open in IMG/M |
| 3300034062|Ga0334995_0354093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
| 3300034104|Ga0335031_0615978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300034117|Ga0335033_0468415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300034168|Ga0335061_0095070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1589 | Open in IMG/M |
| 3300034283|Ga0335007_0453902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 41.26% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.39% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.59% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.50% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.80% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.10% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.10% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.10% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.40% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.40% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.70% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.70% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.70% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.70% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.70% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.70% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.70% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.70% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.70% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003431 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300003616 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
| 3300008265 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020542 | Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027127 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027290 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8d | Environmental | Open in IMG/M |
| 3300027518 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028108 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24028J26656_10112352 | 3300002091 | Lentic | MQLTFSSQMITAADGERRIIAGQIVPFGAVGNTSAG |
| B570J29032_1087862721 | 3300002408 | Freshwater | MKLTFSSQVEAADTERRVIAGKIVPFEEVGNTSVGK |
| B570J29032_1092763571 | 3300002408 | Freshwater | MLLTFSSQIESADGERRVIAGKIVPFESVGRTSVGPVVFAKGSIDVG |
| JGI25908J49247_100521831 | 3300003277 | Freshwater Lake | MGGFKLILTFSSAVESADTERRIIAGKIVPYESVGNTSAGPV |
| JGI25909J50240_10189042 | 3300003393 | Freshwater Lake | MLLTFSSAVESADTERRIIAGKIVPYEAVGNTSAGPVMFAKIL* |
| JGI25907J50239_11152941 | 3300003394 | Freshwater Lake | MLLTFNSQIESADGERRVIAGKIVPFEVPGNTSVGKVVFAKGS |
| JGI25911J50253_101306362 | 3300003411 | Freshwater Lake | MRTIMLLTFSSQIESADNERRVIAGKIVPFEEVGNTSVGKVVF |
| JGI25913J50563_10646571 | 3300003431 | Freshwater Lake | MGGFKLILTFSSQIESADGERRIIAGKIVPFETVGNTSVGKVV |
| JGI25928J51866_10566711 | 3300003616 | Freshwater Lake | LILTFSSAVESADTERRIIAGKIVPYEAIGNTSAGPVMFAKD |
| Ga0070374_105963493 | 3300005517 | Freshwater Lake | MGRFKLILTFSSAVESADTERRIIAGKIVPYEAIGNTS |
| Ga0068876_102242262 | 3300005527 | Freshwater Lake | MKLTFSSHVEAADTERRVIAGKIVPFEEVGNTSVGKVVF |
| Ga0049083_102562963 | 3300005580 | Freshwater Lentic | MGGFKLILTFSSAVESADTERRIIAGKIVPYESVGNTSAGPVMFAKDSI |
| Ga0049080_102057871 | 3300005582 | Freshwater Lentic | MRAIMLLTFSSQIESADNERRVIAGKIVPFEEVGNTS |
| Ga0079957_12422502 | 3300005805 | Lake | MRTLMLLTFSSQIESADGERRVIAGKIVPFEVPGNTSVGKVV |
| Ga0075464_107694471 | 3300006805 | Aqueous | MRVTMLLTFSSSIESSDTERRVIAGKIVPYERVGFTSAGPVVFAKD |
| Ga0075464_110629761 | 3300006805 | Aqueous | MKLTFSSPIEAADTERRVIAGKIVPFEEVGNTSVG |
| Ga0070748_13034471 | 3300006920 | Aqueous | METQMLLTFSSHIESADGERRIIAGKIVPYEEVGNTSVGKVV |
| Ga0075458_102670942 | 3300007363 | Aqueous | MGGFKLILTFSSQIESSDNERRVIAGKIVPFETPGNTSVGKVVFAK |
| Ga0102856_10283171 | 3300007636 | Estuarine | VKLTFSSAIEAADTERRIIAGVVVPFGEIGNTSVGP |
| Ga0105736_11709392 | 3300007861 | Estuary Water | MLLTFSSAVESADTERRIIAGKIVPYEAVGNTSAGPVMFAKDSID |
| Ga0114347_12274602 | 3300008114 | Freshwater, Plankton | MILTFSSQVEAADGERRVIAGKIVPYESVGHTSVGPVVF |
| Ga0114355_11968732 | 3300008120 | Freshwater, Plankton | MKLTFSSHVEAADTERRVIAGKIVPFEEVGNTSVGKV |
| Ga0114359_11091901 | 3300008122 | Freshwater, Plankton | MKLTFSSQIEAADGERRVIAGKIVPFESVGHTSVGKVVFAKNSIE |
| Ga0114361_10893022 | 3300008265 | Freshwater, Plankton | MKLTFSSHVEAADTERRVIAGKIVPFEEVGNTSVGKVV |
| Ga0114363_11103991 | 3300008266 | Freshwater, Plankton | MKLTFSSQIEAADGERRVIAGKIVPFESVGHTSVGKVV |
| Ga0114878_10243691 | 3300008339 | Freshwater Lake | MILTFSSQVEAADTERRVIAGKIVPFEEVGNTSVGK |
| Ga0102829_11954561 | 3300009026 | Estuarine | MFLEFSSSIESSDTERRVIAGKIVPYEKVGFTSAGPVVF |
| Ga0102829_12548702 | 3300009026 | Estuarine | MQLNFNSPIEAADGERRIVSGQIVPFGSVGNTSIGR |
| Ga0114980_103212501 | 3300009152 | Freshwater Lake | MFLNFSSAIESSDSERRIIAGKIVPYEKVGFTSAGPVVFAKDS |
| Ga0114975_107557642 | 3300009164 | Freshwater Lake | MGGFKLILTFSSQIESADTERRVIAGKIVPFETPGNTS |
| Ga0114974_105969401 | 3300009183 | Freshwater Lake | MGGFKLILTFSSQIESADSERRVIAGKIVPFETPGNTS |
| Ga0114972_103976873 | 3300009187 | Freshwater Lake | MLLTFSSSIESSDTERRVIAGKIVPYEVVGNTSAGPVVFAKDSIAI |
| Ga0133913_111498533 | 3300010885 | Freshwater Lake | MILTFSSQVEAADGERRVIAGKIVPFESVGHTSVGPV |
| Ga0119955_11234591 | 3300012006 | Freshwater | MLLTFSSSVEASDSERKIIAGKIVPFGEVGNTSVGK |
| Ga0153805_10829792 | 3300012013 | Surface Ice | MQLNFNSSIEATDQERRIIAGKIVPFGEIGNTSVGKV |
| Ga0164292_108155421 | 3300013005 | Freshwater | MLLTFSSNLESADTERRIIAGKIVPYESVGSTSAGPVMF |
| Ga0129327_102456391 | 3300013010 | Freshwater To Marine Saline Gradient | MQLNFNSSIEATDQERRIIAGKIVPFGEIGNTSVGKVV |
| (restricted) Ga0172373_105844542 | 3300013131 | Freshwater | MLLTFSSAVEAADGERRVIAGKIVPFESVGNTSAGPVMFAK |
| Ga0181364_10507002 | 3300017701 | Freshwater Lake | MLLTFSSNLESADTERRIIAGKIVPYESVGSTSAG |
| Ga0181363_10907001 | 3300017707 | Freshwater Lake | MILTFSSQVEAADGERRVIAGKIVPFESVGHTSVGPT |
| Ga0181347_11532872 | 3300017722 | Freshwater Lake | MRAIMLLTFSSQIESADNERRVIAGKIVPFEEVGNTSV |
| Ga0181347_11701861 | 3300017722 | Freshwater Lake | MLLTFSSAVESADTERRIIAGKIVPYEAVGNTSAGPVMFA |
| Ga0181362_10088971 | 3300017723 | Freshwater Lake | MLLTFSSQIESADGERRIIAGKIVPFETPGNTSVGKVVFAKG |
| Ga0181362_10610342 | 3300017723 | Freshwater Lake | MRAIMLLTFSSQIESADNERRVIAGKIVPFEEVGNTSVGKVVF |
| Ga0181365_10312741 | 3300017736 | Freshwater Lake | MKQPLHLTFNTSVEAADADRRIIAGKIVPFGEIGNTSSGRVV |
| Ga0181365_10724762 | 3300017736 | Freshwater Lake | MRAIMLLTFSSQIESADNERRVIAGKIVPFEEVGNT |
| Ga0181365_10725593 | 3300017736 | Freshwater Lake | MGGFKLILTFSSAVESADTERRIIAGKIVPYESVGNTSA |
| Ga0181365_10845472 | 3300017736 | Freshwater Lake | VQPLHLTFNTTVEAADADRRIIAGKIVPFGEIGNTSSGRVVFERG |
| Ga0181365_11205961 | 3300017736 | Freshwater Lake | MRAIMLLTVSSQIESADNERRVIAGKIVPFEEVGNTSVGKVVFA |
| Ga0181365_11621261 | 3300017736 | Freshwater Lake | MGGFKLILTFNSAVESADTERRIIAGKIVPYEAIGNTSAGPVMFAKD |
| Ga0181365_11622832 | 3300017736 | Freshwater Lake | MGRFKLILTFSSAVESADTERRIIAGKIVPYESVGNT |
| Ga0181365_11658941 | 3300017736 | Freshwater Lake | MGGFKLILTFSSQIESADSERRVIAGKIVPFETPGNTSVGKV |
| Ga0181352_10807631 | 3300017747 | Freshwater Lake | MLLTFSSAVESADTERRIIAGKIVPYETVGNTSAGPVVFAKDSIDI |
| Ga0181343_11481952 | 3300017766 | Freshwater Lake | MILTFSSQIESADGERRIIAGKIVPYEEVGNTSVGKVVFAKD |
| Ga0181357_10921621 | 3300017777 | Freshwater Lake | METQPLHLTFNTTVEAADADRRIIAGKIVPFGEIGHTSAGQVVFEKG |
| Ga0181357_12757181 | 3300017777 | Freshwater Lake | MGGFKLILTFSSQIESADTERRVIAGKIVPFETPGNTSVGKV |
| Ga0181349_12246502 | 3300017778 | Freshwater Lake | VKQPLHLTFNTSVEAADADRRIIAGKIVPFGEIGNTSSGRVVFE |
| Ga0181349_12891052 | 3300017778 | Freshwater Lake | MLLTFNSQIESADGERRIIAGKIVPFETPGNTSVGKVVFAKG |
| Ga0181346_11582612 | 3300017780 | Freshwater Lake | MQLNFNSTIEATDQERRIIAGKIVPFGEIGNTSVGKVVF |
| Ga0181346_13250162 | 3300017780 | Freshwater Lake | MQLNFNSTIEATDQERRIIAGKIVPFGEIGNTSVGKVVFEA |
| Ga0181348_12934571 | 3300017784 | Freshwater Lake | MGGFKLILTFSSQIESADGERRVIAGKIVPFETVG |
| Ga0181355_12132952 | 3300017785 | Freshwater Lake | MQLNFNSTIEPTDQELRIIAGKMVPFGEIGNTSVGKVVFEAC |
| Ga0181355_12755221 | 3300017785 | Freshwater Lake | MQLNFNSTIEATDQERRIIAGKIVPFGEIGNTSVG |
| Ga0181359_10697962 | 3300019784 | Freshwater Lake | MRVQMLLTFSSSVESADTERRVIAGKIVPYEVVGNTSAGPV |
| Ga0181359_11164951 | 3300019784 | Freshwater Lake | MLLTFSSQIESADGERRIIAGKIVPFETPGNTSVGKVVFANSLP |
| Ga0181359_11455672 | 3300019784 | Freshwater Lake | VKQPLHLTFNTSVEAADADRRIIAGKIVPFGEIGNTS |
| Ga0181359_12394361 | 3300019784 | Freshwater Lake | MLLTFSSNVESADTERRIIAGKIVPYETVGNTSAGPVMFAK |
| Ga0207193_14488871 | 3300020048 | Freshwater Lake Sediment | MILTFSSHIESADNERRVIAGKIVPFEEVGNTSVGKV |
| Ga0194110_103073822 | 3300020084 | Freshwater Lake | MEMKEQMLLTFNSAVEAADGERRIIAGKIVPFESVGNTS |
| Ga0211736_100169601 | 3300020151 | Freshwater | MLLTFSSHIESADGERRVIAGKIVPFEEVGNTSVGKVVFAK |
| Ga0211729_105392622 | 3300020172 | Freshwater | MRAAMLLTFSSQIESADGERRVIAGKIVPFETPGN |
| Ga0211729_110808151 | 3300020172 | Freshwater | MILTFSSQIESADGERRIIAGKIVPYEEVGNTSVGKV |
| Ga0194116_102786862 | 3300020204 | Freshwater Lake | MEMKEQMLLTFNSAVEAADGERRIIAGKIVPFESVGNTSVGPVMFAKGS |
| Ga0208857_10213531 | 3300020542 | Freshwater | MILTFSSQVEASDAERRVIAGKIVPFESVGHTSVGPVVFAKGSIEI |
| Ga0208855_10163901 | 3300020553 | Freshwater | MGGFKLILTFSSQIESADSERRVIAGKIVPFETPGNTSVGKVV |
| Ga0213921_10056531 | 3300021952 | Freshwater | MEMRAIMFLNFSSAIESSDSERRIIAGKIVPYEKVGFTSAGPVVF |
| Ga0213921_10579832 | 3300021952 | Freshwater | MNLTFSCAIEAADTERRIIAGQIVPFGAIGNTNVGKVVFERGSIK |
| Ga0222713_102864272 | 3300021962 | Estuarine Water | MRAAMLLTFSSQIESADGERRVIAGKIVPFEVPGNTSVGKVVFAKG |
| Ga0222712_106455222 | 3300021963 | Estuarine Water | MLLTFSSSVESADTERRVIAGKIVPYEVVGNTSAGPVVFAKDS |
| Ga0196889_10255791 | 3300022072 | Aqueous | MGGFKLILTFSSQIESADSERRVIAGKIVPFETPGNTSVG |
| Ga0181353_10745071 | 3300022179 | Freshwater Lake | MDQANLLTFSGTIEASDSARRVISGKIVPFGEIGQ |
| Ga0181353_11592361 | 3300022179 | Freshwater Lake | MRVAMLLTFNSQIQSADGERRVIAGKIVPFETPGNTSVGKVVFAKGSI |
| Ga0181354_11194901 | 3300022190 | Freshwater Lake | VKLTFSSAIEAADTERRIIAGVVVPFGEIALPFPL |
| Ga0181351_11535662 | 3300022407 | Freshwater Lake | MLLTFSSAVESADTERRIIAGKIVPYESVGSTSAG |
| Ga0181351_11703861 | 3300022407 | Freshwater Lake | MLLTFSSQIESADGERRIIAGKIVPFETPGNTSVGK |
| Ga0181351_12195781 | 3300022407 | Freshwater Lake | MRVKMLLTFSSNLESADTERRIIAGKIVPYETVGSTSAG |
| Ga0181351_12617771 | 3300022407 | Freshwater Lake | MRVAMLLTFNSQIESADGERRIIAGKIVPFEVPGNTSVGKVVFAKGS |
| Ga0214921_102535532 | 3300023174 | Freshwater | MFLEFSSAIESSDSERRVIAGKIVPYEKVGFTSAGPVVFAKDSI |
| Ga0214919_100835853 | 3300023184 | Freshwater | MEMRVVMLLTFSSSIESSDTERRVISGKIVPYNEVGNTS |
| Ga0244775_115112052 | 3300024346 | Estuarine | MRVLMLLTFSSQIESADGERRVIAGKIVPFETPGNTS |
| Ga0256330_11399731 | 3300024481 | Freshwater | METPMLLQFSSPIESSDSERRIIAGKIVPFGEVGNTSAGAVVF |
| Ga0208160_10817831 | 3300025647 | Aqueous | MKLTFSSQIEAADTERRVIAGKIVPFEEVGNTSVGKVVFA |
| Ga0208644_11812522 | 3300025889 | Aqueous | MILTFSADIQAADEESRTLAGQIVPFNVPGNTSAGKVVFAEG |
| Ga0208916_100178513 | 3300025896 | Aqueous | MDQANLLTFSGTIEASDSARRVISGKIVPFGEIGQTSAG |
| Ga0255071_10435962 | 3300027127 | Freshwater | MLLTFSSAIESSDTERRVIAGKIVPYERVGFTSAGPVV |
| Ga0255136_10685411 | 3300027290 | Freshwater | MRVAMLLTFNSQIESADGERRIIAGKIVPFETPGNT |
| Ga0208787_10977261 | 3300027518 | Deep Subsurface | MLLTFSSHIESADNERRVIAGKIVPYEAVGNTSAGPVVF |
| Ga0209552_11415142 | 3300027563 | Freshwater Lake | MRVAMLLTFNSQIQSADGERRVIAGKIVPFETPGNTSVGKVVFA |
| Ga0208974_10966291 | 3300027608 | Freshwater Lentic | MGGFKLILTFSSAVESADTERRIIAGKIVPYESVGN |
| Ga0208951_10178873 | 3300027621 | Freshwater Lentic | MLLTFSSNLESADTERRIIAGKIVPYESVGSTSAGPVMFA |
| Ga0208975_10351571 | 3300027659 | Freshwater Lentic | MLLTFNSQIESADGERRIIAGKIVPFEVPGNTSVGKVVFA |
| Ga0209553_11199301 | 3300027688 | Freshwater Lake | MGGFKLILTFSSAVESADTERRIIAGKIVPYEAIGNTSAGPVMFAKDSI |
| Ga0209553_11775071 | 3300027688 | Freshwater Lake | MRATMLLTFSSQIESADNERRVIAGKIVPFEEVGNTSVGKVVFAK |
| Ga0209551_11154803 | 3300027689 | Freshwater Lake | MGGFKLILTFSSAVESADTERRIIAGKIVPYEAIG |
| Ga0209551_12490731 | 3300027689 | Freshwater Lake | MRTIMLLTFSSQIESADNERRVIAGKIVPFEEVGN |
| Ga0209492_10471103 | 3300027721 | Freshwater Sediment | MKLTFSSHIEAADTERRVIAGKIVPFEEVGNTSVGKVVFA |
| Ga0209297_12033831 | 3300027733 | Freshwater Lake | MRAIMFLEFSSSIESSDTERRVIAGKIVPYEKVGYTS |
| Ga0209190_10322171 | 3300027736 | Freshwater Lake | MEMRVVMLLTFSSSIESSDTERRVIAGKIVPYNEVGNTSVGAV |
| Ga0209190_11603762 | 3300027736 | Freshwater Lake | MRVTMFLEFSSSIESSDTERRVIAGKIVPYEKVGFTSA |
| Ga0209084_10294503 | 3300027749 | Freshwater Lake | MQLTFSSQMITAADGERRIIAGQIVPFGAVGNTSAGKTIFERGSI |
| Ga0209596_11811751 | 3300027754 | Freshwater Lake | MRVQMLLTFSSSVESADTERRVIAGKIVPYEVVGNTSAGPVVFA |
| Ga0209444_101875672 | 3300027756 | Freshwater Lake | MEMRVAMLLTFNSQIESADGERRIIAGKIVPFETPG |
| Ga0209088_101294632 | 3300027763 | Freshwater Lake | METQMLLTFSSHIESADGERRIIAGKIVPYEEVGNTSVGKV |
| Ga0209134_100277163 | 3300027764 | Freshwater Lake | MKLTFSSQIQSADGERRIIAGKIVPYEEVGNTSAGKV |
| Ga0209768_103856701 | 3300027772 | Freshwater Lake | MGGFKLILTFSSQIESADTERRVIAGKIVPFETPGN |
| Ga0209829_104331571 | 3300027777 | Freshwater Lake | MRVVMLLTFSSSIESSDTERRVIAGKIVPYNEVGNTSVG |
| Ga0209500_101385182 | 3300027782 | Freshwater Lake | MLLTFSSAIESSDTERRVIAGKIVPYEKVGFTSAGPVVFAKD |
| Ga0209500_102434071 | 3300027782 | Freshwater Lake | MFLEFSSSIESSDTERRVIAGKIVPYERVGFTSAGPVVFAKDSIDIG |
| Ga0209246_101277811 | 3300027785 | Freshwater Lake | MRTIMLLTFSSQIESADNERRVIAGKIVPFEEVGNTS |
| Ga0209972_100360724 | 3300027793 | Freshwater Lake | MKLTFSSHVEAADTERRVIAGKIVPFEEVGNTSVGKVVFAK |
| Ga0209353_101922031 | 3300027798 | Freshwater Lake | MRTIMLLTFSSQIESADNERRVIAGKIVPFEEVGNTSVGKVVFA |
| Ga0209354_100426471 | 3300027808 | Freshwater Lake | MLLTFNSQIESADGERRIIAGKIVPFETPGNTSVGKVVFAKGS |
| Ga0209354_101670031 | 3300027808 | Freshwater Lake | MGGFKLILTFSSQIESADGERRVIAGKIVPFETIGNTSVGKVVF |
| Ga0209354_102969621 | 3300027808 | Freshwater Lake | MLLTFSSAVESADTERRIIAGKIVPYEAVGNTSAGPV |
| Ga0209990_100323831 | 3300027816 | Freshwater Lake | MLLTFSSHIESADGERRVIAGKIVPFEEVGNTSVGRV |
| Ga0209777_101107461 | 3300027896 | Freshwater Lake Sediment | MQLTFSSQIEAADGERRIIAGQIVPFGSVGNTSAGRVIFE |
| Ga0209191_13318931 | 3300027969 | Freshwater Lake | MFLEFSSAIESSDSERRIIAGKIVPYEKVGFTSAGPV |
| Ga0256305_11758251 | 3300028108 | Freshwater | MRAAMLLTFSSQIESADGERRVIAGKIVPFETPGNTSVGKVV |
| Ga0304730_12704201 | 3300028394 | Freshwater Lake | METQPLHLTFNTTVEAADADRRIIAGKIVPFGEIGN |
| Ga0315907_104320411 | 3300031758 | Freshwater | MRTLMLLTFSSQIESADGERRVIAGKIVPFEVPGNT |
| Ga0315907_106541041 | 3300031758 | Freshwater | MKLTFSSPIEAADTERRVIAGKIVPFEEVGNTSVGKV |
| Ga0315900_109547952 | 3300031787 | Freshwater | MLLTFSSQIESADGERRVIAGKIVPFEVPGNTSAGKVVFAKGSIEVGDP |
| Ga0315904_100499787 | 3300031951 | Freshwater | MILTFSSQVEAADTERRVIAGKIVPFEEVGNTSVGKVVFA |
| Ga0315289_113665671 | 3300032046 | Sediment | MRITMLLTFSSNLESADTERRIIAGKIVPYETVGSTSAGPV |
| Ga0315268_109638802 | 3300032173 | Sediment | MRITMLLTFSSNLESADTERRIIAGKIVPYETVGST |
| Ga0334982_0114559_1300_1404 | 3300033981 | Freshwater | MGGFKLILTFSSQIESADSERRVIAGKIVPFETPG |
| Ga0334994_0039303_2_142 | 3300033993 | Freshwater | MILTFSSQVEAADGERRIIAGKIVPYESVGHTSVGPVVFAKDSIEIG |
| Ga0334985_0308217_1_120 | 3300034018 | Freshwater | MKLTFSSHVEAADTERRVIAGKIVPFEEVGNTSVGKVVFA |
| Ga0334995_0354093_806_937 | 3300034062 | Freshwater | MILTFSSQVEAADGERRVIAGKIVPFESVGHTSVGPVVFAKGSI |
| Ga0335031_0615978_499_636 | 3300034104 | Freshwater | MGGFKLILTFSSQIESADGERRVIAGKIVPFESVGNTSVGKVVFAK |
| Ga0335033_0468415_470_607 | 3300034117 | Freshwater | MKLTFSSQVEAADGERRVIAGKIVPFESVGHTSVGKVVFAKNSIEI |
| Ga0335061_0095070_2_121 | 3300034168 | Freshwater | MGGFKLILTFSSQIESADGERRVIAGKIVPFETVGNTSVG |
| Ga0335007_0453902_3_107 | 3300034283 | Freshwater | MLLTFSSHIESADGERRVIAGKIVPFEEVGNTSVG |
| ⦗Top⦘ |