| Basic Information | |
|---|---|
| Family ID | F051764 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 143 |
| Average Sequence Length | 42 residues |
| Representative Sequence | SLGDVRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRNN |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.30 % |
| % of genes from short scaffolds (< 2000 bps) | 90.21 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.210 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (48.951 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.650 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.056 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 41.43% β-sheet: 0.00% Coil/Unstructured: 58.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF03364 | Polyketide_cyc | 37.76 |
| PF07332 | Phage_holin_3_6 | 7.69 |
| PF05974 | DUF892 | 6.99 |
| PF07295 | DUF1451 | 5.59 |
| PF12277 | DUF3618 | 5.59 |
| PF13185 | GAF_2 | 0.70 |
| PF07043 | DUF1328 | 0.70 |
| PF02870 | Methyltransf_1N | 0.70 |
| PF00004 | AAA | 0.70 |
| PF01442 | Apolipoprotein | 0.70 |
| PF07498 | Rho_N | 0.70 |
| PF01471 | PG_binding_1 | 0.70 |
| PF03641 | Lysine_decarbox | 0.70 |
| PF00903 | Glyoxalase | 0.70 |
| PF01844 | HNH | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 6.99 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.70 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.70 |
| COG5487 | Uncharacterized membrane protein YtjA, UPF0391 family | Function unknown [S] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.31 % |
| Unclassified | root | N/A | 7.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0859313 | Not Available | 505 | Open in IMG/M |
| 2228664021|ICCgaii200_c1107514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3050 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0587925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 754 | Open in IMG/M |
| 3300000044|ARSoilOldRDRAFT_c013700 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_13748770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
| 3300000550|F24TB_10524005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1990 | Open in IMG/M |
| 3300000550|F24TB_10884875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300000953|JGI11615J12901_10828708 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300000956|JGI10216J12902_106654684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
| 3300000956|JGI10216J12902_111989013 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300004463|Ga0063356_101382291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1035 | Open in IMG/M |
| 3300004463|Ga0063356_105316766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| 3300004479|Ga0062595_102376608 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005340|Ga0070689_100542461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1001 | Open in IMG/M |
| 3300005364|Ga0070673_101074808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 751 | Open in IMG/M |
| 3300005438|Ga0070701_11058447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
| 3300005543|Ga0070672_102050941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
| 3300005577|Ga0068857_102217503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300006853|Ga0075420_100409901 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300009148|Ga0105243_11557869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 686 | Open in IMG/M |
| 3300009156|Ga0111538_11384304 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300009840|Ga0126313_11459161 | Not Available | 568 | Open in IMG/M |
| 3300010040|Ga0126308_10902055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
| 3300010045|Ga0126311_11813559 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010112|Ga0127458_1125194 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300010145|Ga0126321_1375237 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300010166|Ga0126306_10479244 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300010371|Ga0134125_12372281 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300010396|Ga0134126_12976669 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010397|Ga0134124_11507224 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300010999|Ga0138505_100019546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 859 | Open in IMG/M |
| 3300011992|Ga0120146_1019546 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300012360|Ga0137375_10984031 | Not Available | 664 | Open in IMG/M |
| 3300012395|Ga0134044_1284941 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300012500|Ga0157314_1005800 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300012915|Ga0157302_10089751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 950 | Open in IMG/M |
| 3300012955|Ga0164298_11182844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300012977|Ga0134087_10296128 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300013307|Ga0157372_11113941 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300014488|Ga0182001_10330205 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300015077|Ga0173483_10302843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 783 | Open in IMG/M |
| 3300015200|Ga0173480_10827882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
| 3300017997|Ga0184610_1160817 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300018027|Ga0184605_10119907 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300018028|Ga0184608_10159801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 975 | Open in IMG/M |
| 3300018031|Ga0184634_10197682 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300018053|Ga0184626_10398712 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300018054|Ga0184621_10087965 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300018074|Ga0184640_10164159 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300018075|Ga0184632_10075792 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300018075|Ga0184632_10264726 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300018076|Ga0184609_10256222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 818 | Open in IMG/M |
| 3300018081|Ga0184625_10560937 | Not Available | 566 | Open in IMG/M |
| 3300018082|Ga0184639_10629323 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300018469|Ga0190270_13153886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300019255|Ga0184643_1420600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
| 3300019269|Ga0184644_1401714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300019867|Ga0193704_1000667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 6405 | Open in IMG/M |
| 3300019867|Ga0193704_1071767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 648 | Open in IMG/M |
| 3300019869|Ga0193705_1008358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2255 | Open in IMG/M |
| 3300019869|Ga0193705_1025224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1287 | Open in IMG/M |
| 3300019869|Ga0193705_1030630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1156 | Open in IMG/M |
| 3300019885|Ga0193747_1056996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 969 | Open in IMG/M |
| 3300020070|Ga0206356_11749941 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300020077|Ga0206351_10173249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
| 3300020080|Ga0206350_10254183 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300020082|Ga0206353_11923474 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300022195|Ga0222625_1053463 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300022534|Ga0224452_1047628 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300022694|Ga0222623_10116323 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300022756|Ga0222622_10003828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6582 | Open in IMG/M |
| 3300022756|Ga0222622_10229818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1246 | Open in IMG/M |
| 3300022756|Ga0222622_10308870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1090 | Open in IMG/M |
| 3300022893|Ga0247787_1037171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 695 | Open in IMG/M |
| 3300025920|Ga0207649_10688667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 792 | Open in IMG/M |
| 3300025921|Ga0207652_11506568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300025926|Ga0207659_11763312 | Not Available | 526 | Open in IMG/M |
| 3300025937|Ga0207669_10097566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1933 | Open in IMG/M |
| 3300025942|Ga0207689_10543621 | Not Available | 975 | Open in IMG/M |
| 3300028608|Ga0247819_11050390 | Not Available | 518 | Open in IMG/M |
| 3300028710|Ga0307322_10015803 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300028710|Ga0307322_10031877 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300028710|Ga0307322_10089647 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300028711|Ga0307293_10119094 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300028711|Ga0307293_10168130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 698 | Open in IMG/M |
| 3300028712|Ga0307285_10009323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2080 | Open in IMG/M |
| 3300028715|Ga0307313_10037971 | All Organisms → Viruses → Predicted Viral | 1382 | Open in IMG/M |
| 3300028715|Ga0307313_10044536 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300028716|Ga0307311_10269054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300028718|Ga0307307_10022037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1767 | Open in IMG/M |
| 3300028718|Ga0307307_10062270 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300028720|Ga0307317_10011341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2660 | Open in IMG/M |
| 3300028720|Ga0307317_10020895 | All Organisms → cellular organisms → Bacteria | 2001 | Open in IMG/M |
| 3300028721|Ga0307315_10268401 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300028722|Ga0307319_10031867 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300028744|Ga0307318_10058380 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
| 3300028755|Ga0307316_10004019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4545 | Open in IMG/M |
| 3300028771|Ga0307320_10147327 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300028771|Ga0307320_10268835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 674 | Open in IMG/M |
| 3300028784|Ga0307282_10098865 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300028784|Ga0307282_10106775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1304 | Open in IMG/M |
| 3300028787|Ga0307323_10004744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4413 | Open in IMG/M |
| 3300028793|Ga0307299_10267295 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300028810|Ga0307294_10010847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2260 | Open in IMG/M |
| 3300028810|Ga0307294_10076476 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300028814|Ga0307302_10120076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1262 | Open in IMG/M |
| 3300028814|Ga0307302_10147538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1138 | Open in IMG/M |
| 3300028824|Ga0307310_10091922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1337 | Open in IMG/M |
| 3300028824|Ga0307310_10229904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 884 | Open in IMG/M |
| 3300028828|Ga0307312_10002668 | All Organisms → cellular organisms → Bacteria | 9360 | Open in IMG/M |
| 3300028828|Ga0307312_10017692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4028 | Open in IMG/M |
| 3300028828|Ga0307312_10249794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1147 | Open in IMG/M |
| 3300028828|Ga0307312_10779646 | Not Available | 633 | Open in IMG/M |
| 3300028880|Ga0307300_10235242 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300028881|Ga0307277_10106085 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300030830|Ga0308205_1002858 | All Organisms → Viruses → Predicted Viral | 1426 | Open in IMG/M |
| 3300030830|Ga0308205_1026907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 688 | Open in IMG/M |
| 3300030830|Ga0308205_1052992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
| 3300030902|Ga0308202_1006042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1526 | Open in IMG/M |
| 3300030902|Ga0308202_1089209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300030903|Ga0308206_1002680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2016 | Open in IMG/M |
| 3300030903|Ga0308206_1017335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1172 | Open in IMG/M |
| 3300030903|Ga0308206_1031468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 966 | Open in IMG/M |
| 3300030903|Ga0308206_1057113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
| 3300030903|Ga0308206_1098809 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300030903|Ga0308206_1139172 | Not Available | 576 | Open in IMG/M |
| 3300030903|Ga0308206_1185199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300030905|Ga0308200_1159638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300030988|Ga0308183_1177044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300031058|Ga0308189_10486123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300031089|Ga0102748_11704141 | Not Available | 586 | Open in IMG/M |
| 3300031091|Ga0308201_10071284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 932 | Open in IMG/M |
| 3300031091|Ga0308201_10175485 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300031091|Ga0308201_10229819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300031092|Ga0308204_10006124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1953 | Open in IMG/M |
| 3300031092|Ga0308204_10056327 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300031092|Ga0308204_10063339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 934 | Open in IMG/M |
| 3300031092|Ga0308204_10170348 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300031092|Ga0308204_10351440 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300031852|Ga0307410_10826768 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300033550|Ga0247829_11034748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300033550|Ga0247829_11301278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 48.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 8.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.50% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.10% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.10% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.10% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.40% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.40% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.40% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.70% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.70% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.70% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.70% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.70% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.70% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.70% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old | Host-Associated | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010112 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300011992 | Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031089 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 2B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_08593132 | 2228664021 | Soil | LGDVRAWTLVTAVAAAYIISRGLAKSGSRYSGGEDPLNRSNR |
| ICCgaii200_11075147 | 2228664021 | Soil | DVRAWTLVAAVATGYIISRGLAKSGTKYTGGEDPVNRDS |
| ICChiseqgaiiDRAFT_05879252 | 3300000033 | Soil | NDVRAWTLVAAVATGYIISRGLAKSGTKYTGGEDPVNRDS* |
| ARSoilOldRDRAFT_0137001 | 3300000044 | Arabidopsis Rhizosphere | TLVAAVAIGYMLSRGLAKSGTKYVGDEDPLNRNDH* |
| ICChiseqgaiiFebDRAFT_137487702 | 3300000363 | Soil | AAISDTLGDVRAWTLVSAVVVGYMLSRGLAKSGSRYLGGEDPVGRDDR* |
| F24TB_105240051 | 3300000550 | Soil | RAWTLVAAVAIGYMISRGLAKSGTKYAGGEDSLNQNNR* |
| F24TB_108848752 | 3300000550 | Soil | SLGDVRAWTLVTAVVVGYMISRGLAKSGSRYFGGDDPLRRDDR* |
| JGI11615J12901_108287082 | 3300000953 | Soil | SDSLNDVRAWTLVAAVATGYIISRGLAKSGTKYTGGEDPVNRDS* |
| JGI10216J12902_1066546842 | 3300000956 | Soil | VSDSLDDVRAWTLVAAVSIGYIVSRGLAKSGSRYVGSEDPTNRDDR* |
| JGI10216J12902_1119890132 | 3300000956 | Soil | WTLVAVVAVGYMISRGLAKSGTKHVGGEDTLTRNN* |
| Ga0063356_1013822911 | 3300004463 | Arabidopsis Thaliana Rhizosphere | SLGDVRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRNN* |
| Ga0063356_1053167661 | 3300004463 | Arabidopsis Thaliana Rhizosphere | SLGDVRAWTLVAAVAIGYMISRGLAKAGTKYVGGEDPLNRNN* |
| Ga0062595_1023766081 | 3300004479 | Soil | VRAWTLVAAVAIGYMVSRGLAKSGTKYAGSEDPLNRDNR* |
| Ga0070689_1005424611 | 3300005340 | Switchgrass Rhizosphere | TWVSDTLNDVRGWTLVAAVAIGYMLSRGLAKSGSRYLGGEDALNR* |
| Ga0070673_1010748082 | 3300005364 | Switchgrass Rhizosphere | ATWVSDTLNDVRGWTLVAAVAIGYMLSRGLAKSGSRYLGGEDALNR* |
| Ga0070701_110584472 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | SDSLGDVRAWTLVTIVAAAYIISRGLAKAGSRYSGGEDPLNR* |
| Ga0070672_1020509411 | 3300005543 | Miscanthus Rhizosphere | IAAAVSDSLGDVRAWTLVTIVAAAYIISRGLAKAGSRYSGGEDPLNR* |
| Ga0068857_1022175031 | 3300005577 | Corn Rhizosphere | AWTLVAAVAAAYIISRGLAKSGSRYSGGEDPLNRNDR* |
| Ga0075420_1004099011 | 3300006853 | Populus Rhizosphere | WTLVAAVSIGYIISRGLAKSGSEYFGDEDPLNRDDR* |
| Ga0105243_115578691 | 3300009148 | Miscanthus Rhizosphere | TLVAAIGIGYMISRGLAKAGTKYAGGEDPLNNNR* |
| Ga0111538_113843041 | 3300009156 | Populus Rhizosphere | RAWTLVTAVVVGYMISRGLAKAGSRHFGGDDPLRRDPR* |
| Ga0126313_114591612 | 3300009840 | Serpentine Soil | DSLNDVRAWTLVAAVAIGYMISRGLAKSGTKYAGSEDPLNRDNR* |
| Ga0126308_109020551 | 3300010040 | Serpentine Soil | DSLNDVRAWTLVAAVAIGYMLSRGLAKSGSKYVGGEDPLNRNDR* |
| Ga0126311_118135591 | 3300010045 | Serpentine Soil | IASAVSDSLNDVRAWTLVAAVVIGYMVSRGLAKSGTKHVGDPSN* |
| Ga0127458_11251942 | 3300010112 | Grasslands Soil | AWTLVAAVGIGYMISRGLAKSGTKYVGEDPLTQDNR* |
| Ga0126321_13752371 | 3300010145 | Soil | LVAAVSIGYIVSRGLAKSGSKYFGSEDPVNSDDR* |
| Ga0126306_104792443 | 3300010166 | Serpentine Soil | WVSDSLDDVRAWTLVAAVSIGYMISRGLAKSGTKYAGGEDPLNRDNR* |
| Ga0134125_123722812 | 3300010371 | Terrestrial Soil | GDVRAWTLVAAVGIGYMISRGLAKSGTKYAGGEDPLNQVNR* |
| Ga0134126_129766691 | 3300010396 | Terrestrial Soil | TLVAAVAIGYMVSRGLAKSGSRYAGGEDLLNRNDH* |
| Ga0134124_115072241 | 3300010397 | Terrestrial Soil | AVSDSLNDVRAWTLVAAIGIGYMISRGLAKSGTKYAGSEDPLNRNDR* |
| Ga0138505_1000195461 | 3300010999 | Soil | SDSLDDIRAWTLVAAVSIGYMISRGLAKSGTKYVGSENN* |
| Ga0120146_10195462 | 3300011992 | Permafrost | SAVSDSLGDVRAWTLVAAIGIGYMISRGLAKAGTRYVGGEDPLNRENH* |
| Ga0137375_109840312 | 3300012360 | Vadose Zone Soil | ASAVSDSLGDVRAWTLVAAIAIGYMLSRGLAKSGTKYAGGEDPLNQNSR* |
| Ga0134044_12849413 | 3300012395 | Grasslands Soil | ASAVSDSLGDVRAWTLVAAVGIGYMISRGLAKSGTKHAGGEDPLNQNNR* |
| Ga0157314_10058001 | 3300012500 | Arabidopsis Rhizosphere | RAWTLVAAVAIGYMLSRGLAKSGTKYVGDEDPLNRNDH* |
| Ga0157302_100897513 | 3300012915 | Soil | SAYSDSLGDVRAWTLVAAIGIGYMISRGLAKAGTKYAGGEDPLNNNR* |
| Ga0164298_111828441 | 3300012955 | Soil | AVSDSLGDVRDWTLVAAVGIGYIISRGLAKSGTRYAGGEDPFRHNNG* |
| Ga0134087_102961283 | 3300012977 | Grasslands Soil | TLVAAVSIGYMLSRGLAKSGTKYAGAEDLLNRDNR* |
| Ga0157372_111139413 | 3300013307 | Corn Rhizosphere | SAVSDSFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRNDR* |
| Ga0182001_103302051 | 3300014488 | Soil | DSLNDVRAWTLVAAVAIGYMISRGLAKSGSKYAGSEDPLNRDNR* |
| Ga0173483_103028432 | 3300015077 | Soil | AWTLVAAVAIGYMISRGLAKSGTKYAGGEDPLASNDR* |
| Ga0173480_108278822 | 3300015200 | Soil | GDIRAWTLVAVVAVGYMISRGLAKSGTKYVGGEDPLNRNN* |
| Ga0184610_11608172 | 3300017997 | Groundwater Sediment | LNDVRAWTLIAAVAIGYMISRGLAKSGTKYAGGEDPLNRNNH |
| Ga0184605_101199071 | 3300018027 | Groundwater Sediment | DVRAWTLVAAVSIGYIISRGLAKSGSRYVGGEDPLNRDDR |
| Ga0184608_101598013 | 3300018028 | Groundwater Sediment | AVSDSLGDVRAWTLVAAVGIGYMISRGLAKSGTKYTGGEDSLNQNNR |
| Ga0184634_101976822 | 3300018031 | Groundwater Sediment | WVSDSLNDVRAWTLVAAVAIGYMISRGLAKSGTKYVGGDDPLNRNDR |
| Ga0184626_103987122 | 3300018053 | Groundwater Sediment | DVRAWTLVAAVSIGYIISRGLAKSGSKYFGDEDPLNRDDR |
| Ga0184621_100879653 | 3300018054 | Groundwater Sediment | SDTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRSNH |
| Ga0184640_101641593 | 3300018074 | Groundwater Sediment | WTLVAAVSIGYMISRGLAKSGSRYVGGEDPLNCDDR |
| Ga0184632_100757923 | 3300018075 | Groundwater Sediment | WTLVAAVGIGYMISRGLAKSGTKYAGGEDSLNHNNR |
| Ga0184632_102647261 | 3300018075 | Groundwater Sediment | GDVRAWTLVAAVAIGYMISRGLAKSGTKYAGEEPLNQNNR |
| Ga0184609_102562221 | 3300018076 | Groundwater Sediment | DSLNDVRAWTLVAAVAIGYIISRGLAKSGSKYFGSEDPANRDSH |
| Ga0184625_105609371 | 3300018081 | Groundwater Sediment | GDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLSRNDH |
| Ga0184639_106293231 | 3300018082 | Groundwater Sediment | WTLVAAASIGYMISRGVAKSGSRYVGGEDPLNRDDR |
| Ga0190270_131538862 | 3300018469 | Soil | SDSLNDVRAWTLVAAVSIGYMISRGLAKSGSRDNA |
| Ga0184643_14206001 | 3300019255 | Groundwater Sediment | DSLGDVRAWTLVAAVAIGYMISRGLAKSGTRYVGGEDR |
| Ga0184644_14017141 | 3300019269 | Groundwater Sediment | DDVRAWTLVAAVAIGYMLSRGLAKSGSKYFGHEDLLNRTP |
| Ga0193704_10006671 | 3300019867 | Soil | VSDTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLSRNDR |
| Ga0193704_10717671 | 3300019867 | Soil | RRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPANRDN |
| Ga0193705_10083586 | 3300019869 | Soil | SDTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRN |
| Ga0193705_10252243 | 3300019869 | Soil | GDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPVNRNDH |
| Ga0193705_10306302 | 3300019869 | Soil | SFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLKRDDH |
| Ga0193747_10569963 | 3300019885 | Soil | SDSLNDVRAWTLIAAVAIGYMISRGLAKSGTKYAGGEDPLNRNNH |
| Ga0206356_117499412 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | RAWTLVAAVAIGYMISRGLAKSGTKYAGGEDPLNQGNR |
| Ga0206351_101732492 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | SDSLNDVRAWTLVAAVGIGYMISRGLAKSGSKYAGGEDPLKQNDR |
| Ga0206350_102541833 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | DSLGDVRAWTLVAAVAIGYMISRGLAKSGTKYAGGEDPLNQNNR |
| Ga0206353_119234741 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | SDSLGDVRAWTLVAAVAIGYMISRGLAKSGTKYAGGEDPLNQGNR |
| Ga0222625_10534631 | 3300022195 | Groundwater Sediment | WVSDSLNDVRAWTLVAAVAIGYMISRGLAKSGTQYAGSEDPLDRDNR |
| Ga0224452_10476281 | 3300022534 | Groundwater Sediment | TLVAAVGIGYMISRGLAKSGTKYTGGEDSLNHDDR |
| Ga0222623_101163233 | 3300022694 | Groundwater Sediment | VSDTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRSNH |
| Ga0222622_100038281 | 3300022756 | Groundwater Sediment | RRAWTLVAAVAIGYMISRGLAKSGTKYVDGEDSRNDH |
| Ga0222622_102298183 | 3300022756 | Groundwater Sediment | ASAVSDTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPVNRNDH |
| Ga0222622_103088703 | 3300022756 | Groundwater Sediment | TFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRN |
| Ga0247787_10371711 | 3300022893 | Soil | ATAVSDSLNDVRAWTLVAAVAIGYIVSRGLAKSGTKYTGAEDPLNRNGN |
| Ga0207649_106886671 | 3300025920 | Corn Rhizosphere | LGDVRAWTLVTVVAAAYIISRGLAKAGSRYSGGEDPLTR |
| Ga0207652_115065681 | 3300025921 | Corn Rhizosphere | AVSDSLNDVRAWTLVAAVGIGYMVSRGLAKSGSRYAGGEDPLNSDR |
| Ga0207659_117633122 | 3300025926 | Miscanthus Rhizosphere | AAAVSDSLGDVRAWTLVTVVAAAYIISRGLAKAGSRYSGGEDPLTR |
| Ga0207669_100975662 | 3300025937 | Miscanthus Rhizosphere | RAWTLVTIVAAAYILSRGLAKAGSRYTGSDDPLNRNDR |
| Ga0207689_105436211 | 3300025942 | Miscanthus Rhizosphere | DSLGDVRAWTLVTVVAAAYIISRGLAKAGSRYSGGEDPLNR |
| Ga0247819_110503902 | 3300028608 | Soil | TLVTAVVVGYVISRGLAKSGSRYLGGDDPLRRDER |
| Ga0307322_100158031 | 3300028710 | Soil | RRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLSRNDH |
| Ga0307322_100318773 | 3300028710 | Soil | RRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRNDH |
| Ga0307322_100896471 | 3300028710 | Soil | WVSDSLDDVRAWTLVAAVSIGYMISRGLAKSGTKYAGSEDPLNRDNR |
| Ga0307293_101190941 | 3300028711 | Soil | TFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLSRNDR |
| Ga0307293_101681303 | 3300028711 | Soil | TFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRNDH |
| Ga0307285_100093235 | 3300028712 | Soil | YSDSLDDVRARTLVAAIGIGYMISRGLAKSGTKYAGGEDPLNNR |
| Ga0307313_100379714 | 3300028715 | Soil | DTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRN |
| Ga0307313_100445363 | 3300028715 | Soil | AWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLSRNDR |
| Ga0307311_102690543 | 3300028716 | Soil | ASAVSDSFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPANRDN |
| Ga0307307_100220374 | 3300028718 | Soil | VSDSLSDVRAWTLVAAVGIGYMISRGLAKSGTKYTGGEDSLNQNNR |
| Ga0307307_100622701 | 3300028718 | Soil | FGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLSRNDR |
| Ga0307317_100113411 | 3300028720 | Soil | DRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRN |
| Ga0307317_100208954 | 3300028720 | Soil | GDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLSRNDR |
| Ga0307315_102684012 | 3300028721 | Soil | LNDVRAWTLVAAVAIGYMISRGLAKSGSRYAGGEDPLKRDDR |
| Ga0307319_100318671 | 3300028722 | Soil | VSDSLDDVRAWTLVAAVSIGYIISRGLAKSGSKYVGGEDPLNRNDR |
| Ga0307318_100583801 | 3300028744 | Soil | AWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRN |
| Ga0307316_100040199 | 3300028755 | Soil | FGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRN |
| Ga0307320_101473273 | 3300028771 | Soil | SLNDVRAWTLVAAVAIGYMVSRGLAKSGTKYAGGEDPLNRNN |
| Ga0307320_102688352 | 3300028771 | Soil | DVRAWTLVAAVAIGYMISRGLAKSGTKYPGGEPRNQNNR |
| Ga0307282_100988651 | 3300028784 | Soil | SFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLSRNDH |
| Ga0307282_101067753 | 3300028784 | Soil | RAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPVNRNDH |
| Ga0307323_100047441 | 3300028787 | Soil | GDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRN |
| Ga0307299_102672951 | 3300028793 | Soil | WTLVAAVAIGYMISRGLAKSGTKYAGGEDPLSRSNH |
| Ga0307294_100108471 | 3300028810 | Soil | VSDTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRN |
| Ga0307294_100764763 | 3300028810 | Soil | FGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPANRDN |
| Ga0307302_101200761 | 3300028814 | Soil | IASAVSDTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPVNRNDH |
| Ga0307302_101475381 | 3300028814 | Soil | AVSDSFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPANRDN |
| Ga0307310_100919223 | 3300028824 | Soil | ASAVSDTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRNDH |
| Ga0307310_102299043 | 3300028824 | Soil | RAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPVNNR |
| Ga0307312_1000266810 | 3300028828 | Soil | IASAVSDTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNH |
| Ga0307312_100176928 | 3300028828 | Soil | IASAVSDTFGDRRAWTLVAAVAIGYMISRGLAKSGAKYVGGEDPLNRN |
| Ga0307312_102497943 | 3300028828 | Soil | RRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPVNNR |
| Ga0307312_107796461 | 3300028828 | Soil | DTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGSEDPVNRDNH |
| Ga0307300_102352421 | 3300028880 | Soil | DDVRAWTLVAAVAIGYMISRGLAKSGTKYAGGEDPLNRDNR |
| Ga0307277_101060851 | 3300028881 | Soil | WTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRSNH |
| Ga0308205_10028581 | 3300030830 | Soil | SDSLNDVRAWTLVAAVAIGYMISRGLAKSGTKYAGSEDPLNRDNR |
| Ga0308205_10269073 | 3300030830 | Soil | DTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRNDH |
| Ga0308205_10529922 | 3300030830 | Soil | RAWTLVAAVGIGYMISRGLAKSGTKYTGGEDSLNQNNR |
| Ga0308202_10049111 | 3300030902 | Soil | LIASAVSDTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRNDH |
| Ga0308202_10060421 | 3300030902 | Soil | VSDTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYAGGEDPVNNR |
| Ga0308202_10892092 | 3300030902 | Soil | DRRAWTLVAAVAIGYMISRGLAKSGTNYVGGEDPANRDN |
| Ga0308206_10026804 | 3300030903 | Soil | SAVSDSLGDVRAWTLVAAVAIGYMLSRGLAKSGTKYVGDEEPLDRADR |
| Ga0308206_10173353 | 3300030903 | Soil | SDTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPVNRNDH |
| Ga0308206_10314683 | 3300030903 | Soil | DSLGDVRAWTLVAAVGIGYMISRGLAKSGTKYTGGEDSLNQNNR |
| Ga0308206_10571131 | 3300030903 | Soil | DVRAWTLVAAVAIGYMISRGLAKSGTKYVGTEDPLNRTSH |
| Ga0308206_10988091 | 3300030903 | Soil | AWTLVAAVGIGYMISRGLAKSGTKYTGGEDSLNHDDR |
| Ga0308206_11391721 | 3300030903 | Soil | TFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRSNH |
| Ga0308206_11851991 | 3300030903 | Soil | DSLGDVRAWTLVAAVAIGYMISRGLAKSGTKHVGGDDTNRNN |
| Ga0308200_11596383 | 3300030905 | Soil | AWTLVAAVAIGYMISRGLAKSGTKYVGGEDPANRDN |
| Ga0308183_11770442 | 3300030988 | Soil | GDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPANRDN |
| Ga0308189_104861231 | 3300031058 | Soil | AVSDTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPVNNR |
| Ga0102748_117041412 | 3300031089 | Soil | AWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRSNH |
| Ga0308201_100712841 | 3300031091 | Soil | IASAVSDTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYVGGEDPLNRN |
| Ga0308201_101754851 | 3300031091 | Soil | WVSDSLDDVRAWTLVAAVAIGYMISRGLAKSGTKYVGSEDPLNRDNR |
| Ga0308201_102298192 | 3300031091 | Soil | ASAVSDSLDDVRAWTLVAAIGIGYMISRGLAKSGTKYAGGDDPLNNR |
| Ga0308204_100061241 | 3300031092 | Soil | DVRAWTLVAAVAIGYIISRGLAKSGSKYVGGEDPLNRN |
| Ga0308204_100563273 | 3300031092 | Soil | WTLVAAVAIGYMISRGLAKSGTKYPAEAPLDQNNR |
| Ga0308204_100633391 | 3300031092 | Soil | ASAVSDSLGDVRAWTLVAAVGIGYMISRGLAKSGTKYTGGEDSLNNR |
| Ga0308204_101703482 | 3300031092 | Soil | SLNDVRAWTLVAAVAIGYMISRGLAKSGSRYAGGEDPLKRDDR |
| Ga0308204_103514402 | 3300031092 | Soil | SDTFGDRRAWTLVAAVAIGYMISRGLAKSGTKYAGGEDPLNRND |
| Ga0307410_108267681 | 3300031852 | Rhizosphere | DVRAWTLVAAVSIGYMISRGLAKSGTKYAGSEDPLNRDN |
| Ga0247829_110347481 | 3300033550 | Soil | AWTLVAAVGIGYMISRGLAKSGSKYADGEDPLNNR |
| Ga0247829_113012782 | 3300033550 | Soil | DSLGDVRAWTLVAAIGIGYMISRGLAKAGTKYAGGEDPLNNNR |
| ⦗Top⦘ |