| Basic Information | |
|---|---|
| Family ID | F051713 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 143 |
| Average Sequence Length | 42 residues |
| Representative Sequence | ISKVVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| Number of Associated Samples | 62 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 16.08 % |
| % of genes near scaffold ends (potentially truncated) | 69.93 % |
| % of genes from short scaffolds (< 2000 bps) | 72.03 % |
| Associated GOLD sequencing projects | 58 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.406 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Sand → Desert → Soil (62.238 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.238 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (67.133 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF03795 | YCII | 4.20 |
| PF13426 | PAS_9 | 2.10 |
| PF01112 | Asparaginase_2 | 2.10 |
| PF00160 | Pro_isomerase | 2.10 |
| PF01170 | UPF0020 | 2.10 |
| PF03400 | DDE_Tnp_IS1 | 1.40 |
| PF01263 | Aldose_epim | 1.40 |
| PF05860 | TPS | 1.40 |
| PF13440 | Polysacc_synt_3 | 1.40 |
| PF05982 | Sbt_1 | 1.40 |
| PF01266 | DAO | 1.40 |
| PF13474 | SnoaL_3 | 1.40 |
| PF05016 | ParE_toxin | 1.40 |
| PF13847 | Methyltransf_31 | 1.40 |
| PF02518 | HATPase_c | 1.40 |
| PF00989 | PAS | 1.40 |
| PF00072 | Response_reg | 1.40 |
| PF00069 | Pkinase | 0.70 |
| PF00512 | HisKA | 0.70 |
| PF13649 | Methyltransf_25 | 0.70 |
| PF12681 | Glyoxalase_2 | 0.70 |
| PF14534 | DUF4440 | 0.70 |
| PF00990 | GGDEF | 0.70 |
| PF05195 | AMP_N | 0.70 |
| PF04241 | DUF423 | 0.70 |
| PF00248 | Aldo_ket_red | 0.70 |
| PF13517 | FG-GAP_3 | 0.70 |
| PF13840 | ACT_7 | 0.70 |
| PF07885 | Ion_trans_2 | 0.70 |
| PF02743 | dCache_1 | 0.70 |
| PF12704 | MacB_PCD | 0.70 |
| PF00933 | Glyco_hydro_3 | 0.70 |
| PF08241 | Methyltransf_11 | 0.70 |
| PF01510 | Amidase_2 | 0.70 |
| PF07282 | OrfB_Zn_ribbon | 0.70 |
| PF00483 | NTP_transferase | 0.70 |
| PF03787 | RAMPs | 0.70 |
| PF08447 | PAS_3 | 0.70 |
| PF01797 | Y1_Tnp | 0.70 |
| PF03647 | Tmemb_14 | 0.70 |
| PF00325 | Crp | 0.70 |
| PF05685 | Uma2 | 0.70 |
| PF11832 | DUF3352 | 0.70 |
| PF13186 | SPASM | 0.70 |
| PF13191 | AAA_16 | 0.70 |
| PF14252 | DUF4347 | 0.70 |
| PF00196 | GerE | 0.70 |
| PF06480 | FtsH_ext | 0.70 |
| PF02545 | Maf | 0.70 |
| PF13183 | Fer4_8 | 0.70 |
| PF07878 | RHH_5 | 0.70 |
| PF06983 | 3-dmu-9_3-mt | 0.70 |
| PF10014 | 2OG-Fe_Oxy_2 | 0.70 |
| PF13580 | SIS_2 | 0.70 |
| PF07082 | DUF1350 | 0.70 |
| PF02163 | Peptidase_M50 | 0.70 |
| PF13579 | Glyco_trans_4_4 | 0.70 |
| PF00005 | ABC_tran | 0.70 |
| PF00805 | Pentapeptide | 0.70 |
| PF01226 | Form_Nir_trans | 0.70 |
| PF01040 | UbiA | 0.70 |
| PF05746 | DALR_1 | 0.70 |
| PF01339 | CheB_methylest | 0.70 |
| PF00535 | Glycos_transf_2 | 0.70 |
| PF08502 | LeuA_dimer | 0.70 |
| PF00111 | Fer2 | 0.70 |
| PF03814 | KdpA | 0.70 |
| PF00211 | Guanylate_cyc | 0.70 |
| PF03992 | ABM | 0.70 |
| PF00625 | Guanylate_kin | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 4.20 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.80 |
| COG2813 | 16S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmG | Translation, ribosomal structure and biogenesis [J] | 2.10 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 2.10 |
| COG2263 | Predicted RNA methylase | General function prediction only [R] | 2.10 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 2.10 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 2.10 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 2.10 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 2.10 |
| COG1446 | Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamily | Amino acid transport and metabolism [E] | 2.10 |
| COG0286 | Type I restriction-modification system, DNA methylase subunit | Defense mechanisms [V] | 2.10 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 2.10 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 2.10 |
| COG0116 | 23S rRNA G2445 N2-methylase RlmL | Translation, ribosomal structure and biogenesis [J] | 2.10 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 2.10 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 1.40 |
| COG3210 | Large exoprotein involved in heme utilization or adhesion | Intracellular trafficking, secretion, and vesicular transport [U] | 1.40 |
| COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 1.40 |
| COG3329 | Na+-dependent bicarbonate transporter SbtA | Energy production and conversion [C] | 1.40 |
| COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 1.40 |
| COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 1.40 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.70 |
| COG2363 | Uncharacterized membrane protein YgdD, TMEM256/DUF423 family | Function unknown [S] | 0.70 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.70 |
| COG5548 | Uncharacterized membrane protein, UPF0136 family | Function unknown [S] | 0.70 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.70 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.70 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.70 |
| COG1337 | CRISPR-Cas system type III CSM-effector complex subunit Csm3, RAMP superfamily Cas7 group | Defense mechanisms [V] | 0.70 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG0119 | Isopropylmalate/homocitrate/citramalate synthases | Amino acid transport and metabolism [E] | 0.70 |
| COG0194 | Guanylate kinase | Nucleotide transport and metabolism [F] | 0.70 |
| COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.70 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.70 |
| COG0751 | Glycyl-tRNA synthetase, beta subunit | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG1332 | CRISPR-Cas system type III CSM-effector complex subunit Csm5, RAMP superfamily Cas7 group | Defense mechanisms [V] | 0.70 |
| COG1336 | CRISPR-Cas system type III CMR-effector complex subunit Cmr4, RAMP superfamily Cas7 group | Defense mechanisms [V] | 0.70 |
| COG2116 | Formate/nitrite transporter FocA, FNT family | Inorganic ion transport and metabolism [P] | 0.70 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.70 |
| COG1367 | CRISPR-Cas system type III CMR-effector complex subunit Cmr1, RAMP superfamily Cas7 group | Defense mechanisms [V] | 0.70 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.70 |
| COG1567 | CRISPR-Cas system type III CSM-effector complex subunit Csm4, RAMP superfamily Cas5 group | Defense mechanisms [V] | 0.70 |
| COG1604 | CRISPR/Cas system CMR subunit Cmr6, Cas7 group, RAMP superfamily | Defense mechanisms [V] | 0.70 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.70 |
| COG2060 | K+-transporting ATPase, KdpA subunit | Inorganic ion transport and metabolism [P] | 0.70 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.41 % |
| Unclassified | root | N/A | 5.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2119805012|FNTS067_contig01339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → filamentous cyanobacterium Phorm 6 | 1513 | Open in IMG/M |
| 2119805012|FNTS067_GJ87FRN01CRWTO | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 515 | Open in IMG/M |
| 2119805012|FNTS067_GJ87FRN01DJGVV | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 535 | Open in IMG/M |
| 2209111000|2209116621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → Oscillatoria nigro-viridis | 2271 | Open in IMG/M |
| 2209111000|2209193250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 643 | Open in IMG/M |
| 2209111000|2209749910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → Oscillatoria nigro-viridis | 3843 | Open in IMG/M |
| 2209111000|2209901562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 852 | Open in IMG/M |
| 3300000095|LCrCPGB2aDRAFT_c001665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Coleofasciculaceae → Coleofasciculus → Coleofasciculus chthonoplastes | 3690 | Open in IMG/M |
| 3300000095|LCrCPGB2aDRAFT_c009612 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
| 3300000095|LCrCPGB2aDRAFT_c023410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1151 | Open in IMG/M |
| 3300000095|LCrCPGB2aDRAFT_c042955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 803 | Open in IMG/M |
| 3300000095|LCrCPGB2aDRAFT_c057127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → environmental samples → uncultured Microcoleus sp. | 677 | Open in IMG/M |
| 3300000095|LCrCPGB2aDRAFT_c060018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 659 | Open in IMG/M |
| 3300000095|LCrCPGB2aDRAFT_c093183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 509 | Open in IMG/M |
| 3300000436|LCrCPGB2_illDRAFT_1003104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Coleofasciculaceae → Coleofasciculus → Coleofasciculus chthonoplastes | 3085 | Open in IMG/M |
| 3300000436|LCrCPGB2_illDRAFT_1018643 | Not Available | 1382 | Open in IMG/M |
| 3300000436|LCrCPGB2_illDRAFT_1026330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1147 | Open in IMG/M |
| 3300000436|LCrCPGB2_illDRAFT_1029954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → environmental samples → uncultured Microcoleus sp. | 1066 | Open in IMG/M |
| 3300000436|LCrCPGB2_illDRAFT_1034200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → filamentous cyanobacterium Phorm 6 | 984 | Open in IMG/M |
| 3300000831|JGI12271J12027_1021325 | Not Available | 619 | Open in IMG/M |
| 3300000831|JGI12271J12027_1132212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae | 687 | Open in IMG/M |
| 3300005505|Ga0068898_10276669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 1300 | Open in IMG/M |
| 3300005505|Ga0068898_10300835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 2213 | Open in IMG/M |
| 3300005827|Ga0074478_1147767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → Microcoleus vaginatus | 1147 | Open in IMG/M |
| 3300007517|Ga0105045_10068352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → Microcoleus vaginatus | 3159 | Open in IMG/M |
| 3300007517|Ga0105045_10160110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1886 | Open in IMG/M |
| 3300007517|Ga0105045_10363327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1093 | Open in IMG/M |
| 3300007521|Ga0105044_10034447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → Oscillatoria nigro-viridis | 6489 | Open in IMG/M |
| 3300007521|Ga0105044_10044764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → Oscillatoria nigro-viridis | 5507 | Open in IMG/M |
| 3300007799|Ga0105049_10032180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → Microcoleus vaginatus | 5643 | Open in IMG/M |
| 3300007799|Ga0105049_10082122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 3121 | Open in IMG/M |
| 3300009144|Ga0058702_10043908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 1680 | Open in IMG/M |
| 3300012955|Ga0164298_10014218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → Oscillatoria nigro-viridis | 3212 | Open in IMG/M |
| 3300012985|Ga0164308_11527928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → filamentous cyanobacterium Phorm 6 | 614 | Open in IMG/M |
| 3300012989|Ga0164305_10095138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → Oscillatoria nigro-viridis | 1897 | Open in IMG/M |
| 3300014487|Ga0182000_10010257 | Not Available | 2262 | Open in IMG/M |
| 3300014487|Ga0182000_10017948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 1832 | Open in IMG/M |
| 3300014487|Ga0182000_10052643 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300014487|Ga0182000_10425004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 596 | Open in IMG/M |
| 3300018757|Ga0193612_1012764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 1403 | Open in IMG/M |
| 3300018839|Ga0193606_1007979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 2776 | Open in IMG/M |
| 3300018839|Ga0193606_1034859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → Microcoleus vaginatus | 1198 | Open in IMG/M |
| 3300018839|Ga0193606_1141788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 505 | Open in IMG/M |
| 3300018866|Ga0193613_1018285 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
| 3300018866|Ga0193613_1035279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1192 | Open in IMG/M |
| 3300018866|Ga0193613_1105101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 617 | Open in IMG/M |
| 3300018866|Ga0193613_1111319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus | 595 | Open in IMG/M |
| 3300018866|Ga0193613_1117747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 574 | Open in IMG/M |
| 3300018877|Ga0193600_1000505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → Oscillatoria nigro-viridis | 12082 | Open in IMG/M |
| 3300018890|Ga0193595_1061484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 1198 | Open in IMG/M |
| 3300018890|Ga0193595_1102797 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300018890|Ga0193595_1134883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → filamentous cyanobacterium Phorm 6 | 686 | Open in IMG/M |
| 3300018890|Ga0193595_1150935 | Not Available | 631 | Open in IMG/M |
| 3300018890|Ga0193595_1165578 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300018890|Ga0193595_1173364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 566 | Open in IMG/M |
| 3300018890|Ga0193595_1190233 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300018891|Ga0193610_1015973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 2067 | Open in IMG/M |
| 3300018891|Ga0193610_1023441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1719 | Open in IMG/M |
| 3300018891|Ga0193610_1065657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 972 | Open in IMG/M |
| 3300018891|Ga0193610_1091294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → unclassified Oscillatoriales → Oscillatoriales cyanobacterium USR001 | 791 | Open in IMG/M |
| 3300018891|Ga0193610_1111455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 692 | Open in IMG/M |
| 3300018891|Ga0193610_1163858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 525 | Open in IMG/M |
| 3300018892|Ga0193607_1031837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 1713 | Open in IMG/M |
| 3300018892|Ga0193607_1044746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1370 | Open in IMG/M |
| 3300018892|Ga0193607_1047773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 1313 | Open in IMG/M |
| 3300018892|Ga0193607_1055507 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300018892|Ga0193607_1194477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae | 508 | Open in IMG/M |
| 3300018894|Ga0193603_1002852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae | 6860 | Open in IMG/M |
| 3300018894|Ga0193603_1034889 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
| 3300018894|Ga0193603_1110243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 679 | Open in IMG/M |
| 3300018894|Ga0193603_1133052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → filamentous cyanobacterium Phorm 6 | 587 | Open in IMG/M |
| 3300018906|Ga0193609_1006625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4008 | Open in IMG/M |
| 3300018906|Ga0193609_1012521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2877 | Open in IMG/M |
| 3300018910|Ga0193598_1004821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus | 5201 | Open in IMG/M |
| 3300018910|Ga0193598_1059183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 907 | Open in IMG/M |
| 3300018910|Ga0193598_1080958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae | 756 | Open in IMG/M |
| 3300018914|Ga0193594_1000144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 64415 | Open in IMG/M |
| 3300018914|Ga0193594_1015531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → Oscillatoria nigro-viridis | 2236 | Open in IMG/M |
| 3300018914|Ga0193594_1038870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae | 1218 | Open in IMG/M |
| 3300018915|Ga0193591_1039146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1692 | Open in IMG/M |
| 3300018916|Ga0193615_1070527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → Oscillatoria nigro-viridis | 998 | Open in IMG/M |
| 3300018917|Ga0193611_1104420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae | 748 | Open in IMG/M |
| 3300018917|Ga0193611_1133591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 629 | Open in IMG/M |
| 3300018917|Ga0193611_1146368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → filamentous cyanobacterium Phorm 6 | 590 | Open in IMG/M |
| 3300018918|Ga0193616_1008950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 2957 | Open in IMG/M |
| 3300018918|Ga0193616_1026560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1673 | Open in IMG/M |
| 3300018918|Ga0193616_1066807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → Oscillatoria nigro-viridis | 1028 | Open in IMG/M |
| 3300018918|Ga0193616_1140147 | Not Available | 665 | Open in IMG/M |
| 3300018931|Ga0193601_1048292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → Oscillatoria nigro-viridis | 1307 | Open in IMG/M |
| 3300018931|Ga0193601_1061698 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300018931|Ga0193601_1184856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → filamentous cyanobacterium Phorm 6 | 541 | Open in IMG/M |
| 3300018933|Ga0193614_1011419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 2649 | Open in IMG/M |
| 3300018933|Ga0193614_1154617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → Microcoleus vaginatus | 628 | Open in IMG/M |
| 3300018933|Ga0193614_1213831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 514 | Open in IMG/M |
| 3300018946|Ga0193599_1169408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 696 | Open in IMG/M |
| 3300018946|Ga0193599_1214649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 597 | Open in IMG/M |
| 3300018954|Ga0193590_1015439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 2525 | Open in IMG/M |
| 3300018962|Ga0193589_1058910 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300018962|Ga0193589_1068607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1029 | Open in IMG/M |
| 3300018962|Ga0193589_1117963 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300018962|Ga0193589_1145698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 647 | Open in IMG/M |
| 3300018962|Ga0193589_1171974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae | 584 | Open in IMG/M |
| 3300019135|Ga0193602_1037753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1163 | Open in IMG/M |
| 3300019135|Ga0193602_1075749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 786 | Open in IMG/M |
| 3300019142|Ga0193597_1212670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → filamentous cyanobacterium Phorm 6 | 551 | Open in IMG/M |
| 3300019142|Ga0193597_1236351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → environmental samples → uncultured Microcoleus sp. | 511 | Open in IMG/M |
| 3300020195|Ga0163150_10463096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae | 567 | Open in IMG/M |
| 3300020201|Ga0163154_10002864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 24677 | Open in IMG/M |
| 3300020213|Ga0163152_10025527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → Microcoleus vaginatus | 4964 | Open in IMG/M |
| 3300020213|Ga0163152_10106677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1721 | Open in IMG/M |
| 3300020219|Ga0163146_10015252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → Oscillatoria nigro-viridis | 7160 | Open in IMG/M |
| 3300022903|Ga0247774_1002683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 8666 | Open in IMG/M |
| 3300022903|Ga0247774_1005008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 5895 | Open in IMG/M |
| 3300022903|Ga0247774_1011205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3134 | Open in IMG/M |
| 3300027776|Ga0209277_10090520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 1359 | Open in IMG/M |
| 3300027823|Ga0209490_10052338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 3176 | Open in IMG/M |
| 3300027823|Ga0209490_10376865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus | 832 | Open in IMG/M |
| 3300027850|Ga0209591_10258013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 1330 | Open in IMG/M |
| 3300030510|Ga0268243_1027773 | Not Available | 1152 | Open in IMG/M |
| 3300030510|Ga0268243_1045102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 943 | Open in IMG/M |
| 3300032080|Ga0326721_10060825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 1676 | Open in IMG/M |
| 3300032431|Ga0335395_10001785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → Oscillatoria nigro-viridis | 13397 | Open in IMG/M |
| 3300032456|Ga0335394_10054660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 4319 | Open in IMG/M |
| 3300033988|Ga0334909_000158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → Oscillatoria nigro-viridis | 16545 | Open in IMG/M |
| 3300033988|Ga0334909_000434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 10111 | Open in IMG/M |
| 3300033988|Ga0334909_001030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → Microcoleus vaginatus | 5962 | Open in IMG/M |
| 3300033988|Ga0334909_001350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → Oscillatoria nigro-viridis | 4815 | Open in IMG/M |
| 3300033988|Ga0334909_008399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae | 1393 | Open in IMG/M |
| 3300034000|Ga0334918_011679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → environmental samples → uncultured Microcoleus sp. | 1194 | Open in IMG/M |
| 3300034001|Ga0334919_017562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae | 1217 | Open in IMG/M |
| 3300034004|Ga0334926_006259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae | 2619 | Open in IMG/M |
| 3300034005|Ga0334930_001682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3600 | Open in IMG/M |
| 3300034007|Ga0334936_039830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 977 | Open in IMG/M |
| 3300034024|Ga0334927_002703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 6453 | Open in IMG/M |
| 3300034024|Ga0334927_140761 | Not Available | 634 | Open in IMG/M |
| 3300034027|Ga0334949_147354 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300034027|Ga0334949_163247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae | 566 | Open in IMG/M |
| 3300034027|Ga0334949_185569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 523 | Open in IMG/M |
| 3300034136|Ga0334933_024832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae | 864 | Open in IMG/M |
| 3300034140|Ga0334957_031662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 1043 | Open in IMG/M |
| 3300034173|Ga0334925_054979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria | 862 | Open in IMG/M |
| 3300034221|Ga0334937_036297 | Not Available | 1328 | Open in IMG/M |
| 3300034376|Ga0334923_011539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1790 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 62.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 8.39% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 4.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.20% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 4.20% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 3.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Soil | 3.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.10% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.40% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.70% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.70% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2119805012 | Soil microbial communities from sample at FACE Site NTS_067 Nevada Test Site | Environmental | Open in IMG/M |
| 2209111000 | Soil microbial communities from Colorado Plateau, Greene Butte sample - Dark Crust, Colorado Plateau, Green Butte | Environmental | Open in IMG/M |
| 3300000095 | Soil microbial communities from Colorado Plateau, Green Butte sample - Light Crust, Colorado Plateau, Green Butte 2 | Environmental | Open in IMG/M |
| 3300000436 | Soil microbial communities from Colorado Plateau, Greene Butte sample - Light Crust, Colorado Plateau, Green Butte | Environmental | Open in IMG/M |
| 3300000831 | Soil microbial communities from Moab, Utah, sample - Soil Crust Dry out, 3 days (biological replicate B) D5B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005505 | Soil microbial communities from Colorado Plateau and Sonoran desert - Soil Crust after wet up 5A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005827 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBA | Environmental | Open in IMG/M |
| 3300007517 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
| 3300007799 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 | Environmental | Open in IMG/M |
| 3300009144 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.e | Host-Associated | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300018757 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, 42 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300018839 | Soil crust microbial communities from Colorado Plateau, Utah, USA - late stage, 18 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300018866 | Soil crust microbial communities from Colorado Plateau, Utah, USA - late stage, 9hrs v1 | Environmental | Open in IMG/M |
| 3300018877 | Soil crust microbial communities from Colorado Plateau, Utah, USA - late stage, 42 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300018890 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, bundles v1 | Environmental | Open in IMG/M |
| 3300018891 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 18 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300018892 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early-mid stage, bundles v1 | Environmental | Open in IMG/M |
| 3300018894 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, bundles v1 | Environmental | Open in IMG/M |
| 3300018906 | Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 3 min after wetting v1 | Environmental | Open in IMG/M |
| 3300018910 | Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 18 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300018914 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 42 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300018915 | Soil crust microbial communities from Colorado Plateau, Utah, USA - late stage, 0 min after wetting v1 | Environmental | Open in IMG/M |
| 3300018916 | Soil crust microbial communities from Colorado Plateau, Utah, USA - late stage, bundles v1 | Environmental | Open in IMG/M |
| 3300018917 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early-mid stage, 0 min after wetting v1 | Environmental | Open in IMG/M |
| 3300018918 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 0 min after wetting v1 | Environmental | Open in IMG/M |
| 3300018931 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 9 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300018933 | Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 42 hrs v1 | Environmental | Open in IMG/M |
| 3300018946 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, 0 min after wetting v1 | Environmental | Open in IMG/M |
| 3300018954 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 3 min after wetting v1 | Environmental | Open in IMG/M |
| 3300018962 | Soil crust microbial communities from Colorado Plateau, Utah, USA - late stage, 3 min after wetting v1 | Environmental | Open in IMG/M |
| 3300019135 | Soil crust microbial communities from Colorado Plateau, Utah, USA - midlate stage, 18 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300019142 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid late stage, 3 min after wetting v1 | Environmental | Open in IMG/M |
| 3300020195 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IB | Environmental | Open in IMG/M |
| 3300020201 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP9.P1 | Environmental | Open in IMG/M |
| 3300020213 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP8.IB-2 | Environmental | Open in IMG/M |
| 3300020219 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP7.G1 | Environmental | Open in IMG/M |
| 3300022903 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L001-104B-6 | Environmental | Open in IMG/M |
| 3300027776 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027823 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 (SPAdes) | Environmental | Open in IMG/M |
| 3300027850 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032431 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300032456 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly) | Environmental | Open in IMG/M |
| 3300033988 | Soil microbial communities from Mojave Desert, California, United States - 5NOC | Environmental | Open in IMG/M |
| 3300034000 | Biocrust microbial communities from Mojave Desert, California, United States - 14HMC | Environmental | Open in IMG/M |
| 3300034001 | Biocrust microbial communities from Mojave Desert, California, United States - 15HMC | Environmental | Open in IMG/M |
| 3300034004 | Biocrust microbial communities from Mojave Desert, California, United States - 22HNC | Environmental | Open in IMG/M |
| 3300034005 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 26HNS | Environmental | Open in IMG/M |
| 3300034007 | Biocrust microbial communities from Mojave Desert, California, United States - 32SMC | Environmental | Open in IMG/M |
| 3300034024 | Biocrust microbial communities from Mojave Desert, California, United States - 23HNC | Environmental | Open in IMG/M |
| 3300034027 | Biocrust microbial communities from Mojave Desert, California, United States - 45SNC | Environmental | Open in IMG/M |
| 3300034136 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 29HNS | Environmental | Open in IMG/M |
| 3300034140 | Biocrust microbial communities from Mojave Desert, California, United States - 53SNC | Environmental | Open in IMG/M |
| 3300034173 | Biocrust microbial communities from Mojave Desert, California, United States - 21HNC | Environmental | Open in IMG/M |
| 3300034221 | Biocrust microbial communities from Mojave Desert, California, United States - 33SMC | Environmental | Open in IMG/M |
| 3300034376 | Biocrust microbial communities from Mojave Desert, California, United States - 19HNC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FNTS067_02762500 | 2119805012 | Soil | FDKRISKVVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| FNTS067_03451210 | 2119805012 | Soil | MTKNFLMVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| FNTS067_07355760 | 2119805012 | Soil | MWKFALSGIDKRISKVVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| 2209119415 | 2209111000 | Soil | MWKFALSGIDKRISKVVQAPGFIRGINPKSKIENPQ |
| 2209223418 | 2209111000 | Soil | FLMVQAPGFIRGINRKSKIENPQAPAFIRGINLKSKI |
| 2209884764 | 2209111000 | Soil | KISKVVQAPGLIRGINPKSKIENPQAPAFIRGVNLKSKI |
| 2210042019 | 2209111000 | Soil | ISKVVQAPGFIRGINPKSKIENPQAPAFIRGVASKI |
| LCrCPGB2aDRAFT_0016651 | 3300000095 | Soil | MTKRISKVVQAPRFIRGINPKSKIENPQAPAFTRGVNLK |
| LCrCPGB2aDRAFT_0096124 | 3300000095 | Soil | MTNNFLMVQAPGFIRGINPKSKILAPQAPGFIRGVNLKSKI* |
| LCrCPGB2aDRAFT_0234103 | 3300000095 | Soil | VVQAPGFIRGINPKSKIENPQAPAFIRGVHLKSKI* |
| LCrCPGB2aDRAFT_0429553 | 3300000095 | Soil | MTKNFLMVQAPRFIRGINPKSKIENPQAPAFTRGVNLKSKI* |
| LCrCPGB2aDRAFT_0571272 | 3300000095 | Soil | PGFIRGINPKSKIENPQAPAFIRGVASKISNLKSQID* |
| LCrCPGB2aDRAFT_0600182 | 3300000095 | Soil | MTKNFLMVQAPGFIRGINPKSKSENPQAPAFMRGVNLKSKI* |
| LCrCPGB2aDRAFT_0931832 | 3300000095 | Soil | MILHLFYLTKNFKGGQAPAFIRGINPKSKSENPQAPAFIRGVNLKSK |
| LCrCPGB2_illDRAFT_10031041 | 3300000436 | Soil | MTKNFLMVQAPRFIRGINPKSKIENPQAPAFTRGVNLK |
| LCrCPGB2_illDRAFT_10186433 | 3300000436 | Soil | PRISKVVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI* |
| LCrCPGB2_illDRAFT_10263303 | 3300000436 | Soil | VQAPGFIRGINPKSKIENPQAPAFIRGVHLKSKI* |
| LCrCPGB2_illDRAFT_10299542 | 3300000436 | Soil | GFIRGINPKSKIENPQAPAFIRGVASKISNLKSQID* |
| LCrCPGB2_illDRAFT_10342001 | 3300000436 | Soil | SKVVQAPGFIRGINPKSKLENPQAPAFIRGVNLKSKI* |
| JGI12271J12027_10213252 | 3300000831 | Soil | HADFTNSKNQLTKNFLMVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI* |
| JGI12271J12027_11322122 | 3300000831 | Soil | MTKNFLMVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI* |
| Ga0068898_102766694 | 3300005505 | Soil | MVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI* |
| Ga0068898_103008351 | 3300005505 | Soil | NFLMVQAPGFIRGINPKSKIENPQAPAFIRGVASKI* |
| Ga0074478_11477672 | 3300005827 | Sediment (Intertidal) | MNNNFLMVQAPDLSVESIQNPKSLHPQAPGFIRGVNLKSKI* |
| Ga0105045_100683521 | 3300007517 | Freshwater | NFLMVQAPGFIRGINPKSQISNPQAPAFIRGVASKISNLKSQID* |
| Ga0105045_101601101 | 3300007517 | Freshwater | MVQAPGFIRGINPKSQISNPQAPALIRGVNLKSKI |
| Ga0105045_103633271 | 3300007517 | Freshwater | NFLMVQAPGFIRGINPKSQISNPQAPAFIRGVASKISNLKSKID* |
| Ga0105044_100344471 | 3300007521 | Freshwater | LMVQAPGFIRGINPKSQISNPQAPAFIRGVNLKSQISNLKSIDD* |
| Ga0105044_100447647 | 3300007521 | Freshwater | MVQAPGFIRGINPKSQISNPQAPAFIRGVNLKSQISN |
| Ga0105049_100321806 | 3300007799 | Freshwater | TKNFLMVQAPGFIRGINPKSQISNPQAPAFIRGVASKISNLKSQID* |
| Ga0105049_100821221 | 3300007799 | Freshwater | NFLMVQAPGFIRGINPKSQISNPQAPAFIRGVASKI* |
| Ga0058702_100439083 | 3300009144 | Agave | VQAPAFIRGINPKSKIENPQAPAFIRGVNLKSQISNLKSIDFAL* |
| Ga0164298_100142182 | 3300012955 | Soil | MTNNFLMVQAAGLIRGINRKHPKSLHPQAPGFIRGVNLKSKI* |
| Ga0164308_115279282 | 3300012985 | Soil | SNLKLTDSDNRISKVVQAPGFIRGINPKSQIENPQAPAFIRGVNLKSKI* |
| Ga0164305_100951384 | 3300012989 | Soil | TNNFLMVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI* |
| Ga0182000_100102571 | 3300014487 | Soil | TDKRISKVVQAPGFIRGINPKSQIENPQAPAFIRGVNLKSKI* |
| Ga0182000_100179483 | 3300014487 | Soil | MDFLVFLTKNFLMVQAPGFIRGINPKLKIENPQAPAFIRGVNLKSKI* |
| Ga0182000_100526432 | 3300014487 | Soil | MTKNFLMVQAPGFIRGINPKSIFENPQAPAFIRGVNLKSKI* |
| Ga0182000_104250042 | 3300014487 | Soil | MTKNFLMVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSQISNLKSKIDKPP |
| Ga0193612_10127641 | 3300018757 | Soil | RTIARNTPDKRISKVVQAPGFIRGINRKSIFENPQAPAFIRGLNLKSKI |
| Ga0193606_10079794 | 3300018839 | Soil | ISKVVQAPGFIRGINPFSKIENPQAPAFIRGVNLKSKI |
| Ga0193606_10348593 | 3300018839 | Soil | VFCYVLTKNFLMVQAPGFIRGINPKSKIENPQAPAFIRGVN |
| Ga0193606_11417881 | 3300018839 | Soil | VVQAPGFIRGINRKSKIENPQAPAFIRGVNLKSKI |
| Ga0193613_10182852 | 3300018866 | Soil | MWNFALSGIDKRISKVVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| Ga0193613_10352791 | 3300018866 | Soil | TKNFLMVQAPGFIRGINPKSQIENPQAPAFIRGVNLKSKI |
| Ga0193613_11051011 | 3300018866 | Soil | NDKRISKVVQAPGFIRGINPKSKIENPQAPAFIRGVASKI |
| Ga0193613_11113191 | 3300018866 | Soil | NFLMVQAPRFIRGINPKSKIENPQAPAFTRGVNLKSKI |
| Ga0193613_11177471 | 3300018866 | Soil | KVVQAPGFIGGINPKSKIENPQAPAFIRGVNLKSKI |
| Ga0193600_100050511 | 3300018877 | Soil | MWKFALSGIDKRISKVVQAPGFIRGINPKSQIENPQAAAFIRGVNLKSKI |
| Ga0193595_10614841 | 3300018890 | Soil | KELAMTKNFLMVQAPAFIRGINPKSKIENPQAPAFIRGVASKI |
| Ga0193595_11027971 | 3300018890 | Soil | MLQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| Ga0193595_11348831 | 3300018890 | Soil | QNDKRISKVVQAPGFIRGINPKSQIENPQAPAFIRGVNLKSKI |
| Ga0193595_11509351 | 3300018890 | Soil | KISNAMTKNFLMVQAPGFIRGINPKSKIENPQAPAFTRGVNLKSKI |
| Ga0193595_11655782 | 3300018890 | Soil | RISKVVQAPGFIRGINPKSKIENPQAPAFIRGVASKI |
| Ga0193595_11733641 | 3300018890 | Soil | MGHILAKNFLMVQAPGFIRGINPKSKIENPPAPAFIRGVNLK |
| Ga0193595_11902331 | 3300018890 | Soil | KLDRYIVGRGAHFHFSDKRISKVVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| Ga0193610_10159731 | 3300018891 | Soil | VADKRISKVVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| Ga0193610_10234412 | 3300018891 | Soil | TKNFLMVQAPGFIRGINPKSKIENPQAPAFIRGLNLKSKID |
| Ga0193610_10656572 | 3300018891 | Soil | MTNNFLMVQAPDLSVESIQNPKSLHPQAPGFIRGVNLKSKI |
| Ga0193610_10912941 | 3300018891 | Soil | NFLMVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| Ga0193610_11114551 | 3300018891 | Soil | MVQAPGFIRGINPKSKIENPQAAAFIRGVNLKSKI |
| Ga0193610_11638581 | 3300018891 | Soil | MTKNFLMVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSK |
| Ga0193607_10318372 | 3300018892 | Soil | MTNNFLMVQAPDLCVESIPNPKSLDPQAPGFIRGVNLKSKI |
| Ga0193607_10447461 | 3300018892 | Soil | ISKVVQAPGFIRGINPKSIFENPQAPAFIRGVNLKSKI |
| Ga0193607_10477731 | 3300018892 | Soil | LNWAIAPKLQVTKNFLMVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| Ga0193607_10555072 | 3300018892 | Soil | SDKRISKVVQAPGFIRGINPFSKIENPQAPAFIRGVNLKSKI |
| Ga0193607_11944771 | 3300018892 | Soil | MAAAALTNNFLMVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| Ga0193603_10028525 | 3300018894 | Soil | MNYLTYTYLLTKNFLMVQAPGFIRGINPKSKIANPQAPAFIRGVNLKSKI |
| Ga0193603_10348892 | 3300018894 | Soil | ISKVVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| Ga0193603_11102432 | 3300018894 | Soil | FLMVQAPGFIRGINPKSKIKNPQAPAFIRGVNLKSKI |
| Ga0193603_11330522 | 3300018894 | Soil | SQRRLFDKRISKVVQAPGFIRGINPFSQIENPQAPAFIRGVV |
| Ga0193609_10066256 | 3300018906 | Soil | MKKQSTVSDKRISKVVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| Ga0193609_10125213 | 3300018906 | Soil | MVQAPGFIRGINPKLKIENPQAAAFIRGVNLKSKI |
| Ga0193598_10048217 | 3300018910 | Soil | MGHILTKNFLMVQAPGFIRGINPKSKIENPQAPGFIRGVNLKSKI |
| Ga0193598_10591832 | 3300018910 | Soil | MGHILAKNFLMVQAPGFIRGINPKSKIENPQAPAFIRGV |
| Ga0193598_10809581 | 3300018910 | Soil | VGESGIIDKRISKVVQAPGFIRGINPKSKIENPQAPAFIRGI |
| Ga0193594_100014450 | 3300018914 | Soil | MTKNFLMVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKISNLKSIDRDRL |
| Ga0193594_10155315 | 3300018914 | Soil | MWKFALSGIDKRISKVVQAPGFIRGINPKLKIENPQAPAFIRGVNLKSKI |
| Ga0193594_10388701 | 3300018914 | Soil | KNFLMVQAPGFIRGINPKSKIENPQAPAFIRGVNSLIENRKSKI |
| Ga0193591_10391461 | 3300018915 | Soil | MTKNFLMVQAPGFIRGINPKSKIENPQAPAFIRGVNLKS |
| Ga0193615_10705271 | 3300018916 | Soil | MWKFALSGIDKRISKVVQAPGFIRGINPKSKIENPQAPAFIRGVNL |
| Ga0193611_11044201 | 3300018917 | Soil | VQPXLRNSKVVQAPGFIRGINPKSIFENPQAPAFIRGVN |
| Ga0193611_11335911 | 3300018917 | Soil | VAGDKRISKVVEAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| Ga0193611_11463681 | 3300018917 | Soil | RISKVVQAPGFIRGINPKSIFENPQAPTFIRGVASKI |
| Ga0193616_10089506 | 3300018918 | Soil | AAGVLDRIMTKNFLIVQAPGFIRGINPKSKIENPQAPALIRGVNLKSKI |
| Ga0193616_10265603 | 3300018918 | Soil | VVQAPGFIRGINPFSKIENPQAPAFIRGVNLKSKI |
| Ga0193616_10668071 | 3300018918 | Soil | TKNFLMVQAPAFIRGINPKSKIENPQAPAFIRGVASKI |
| Ga0193616_11401472 | 3300018918 | Soil | MVQAPGLIRGINPKSKIENPQAPAFIRGVNLKSKI |
| Ga0193601_10482921 | 3300018931 | Soil | MWKFALSGIDKRISKVVQAPGFIRGINPFSKIENPQAPAFI |
| Ga0193601_10616983 | 3300018931 | Soil | RISKVVQAPGFIRGINPFSKIENPQAPAFIRGVASKI |
| Ga0193601_11848561 | 3300018931 | Soil | LEMEKRISKVVQAPGFIRGINPKSQIENPQAPAFIRGVNLKSKI |
| Ga0193614_10114191 | 3300018933 | Soil | SKVVQAPGFIRGINPKSIFENPQAPAFIRGVNLKSKI |
| Ga0193614_11546172 | 3300018933 | Soil | MDFLVFLTKNFLMVQAPGFIRGINPKLKIENPQAPAFIRGVNLKSKI |
| Ga0193614_12138311 | 3300018933 | Soil | MWNFALSGIDKRISKVVQAPGFIRGINPKSIFENPQAPAFIRGVASKI |
| Ga0193599_11694083 | 3300018946 | Soil | MASADRKFPDKRISKVVQAPGFIRGINPKSKIANPQAPAFIRGVNLKSKI |
| Ga0193599_12146491 | 3300018946 | Soil | ISKVVQAPGFIRGINRKSKIENPQAPAFIRGVNLKSKI |
| Ga0193590_10154391 | 3300018954 | Soil | KMVQAPGFIRGINRKSIFENPQAPAFIRGVNLKSKI |
| Ga0193589_10589102 | 3300018962 | Soil | LEEEIIFIFLTKNFLMVQAPGFIRAINPKSKIENPQAPAFIREVNLKSKI |
| Ga0193589_10686071 | 3300018962 | Soil | VQAPGFIRGINPKSKIENPQAPAFIRGVASKISNLKSKID |
| Ga0193589_11179632 | 3300018962 | Soil | MSYISLTNNFLMVQAPGFIRGINPQSKIENPQAPAFIRG |
| Ga0193589_11456981 | 3300018962 | Soil | VQPXPRNSKVVQAPGFIRGINPFSKIENPQAPAFIRGVNLK |
| Ga0193589_11719741 | 3300018962 | Soil | LLVEGKIALADQEFLMVQAPGFIRGINPKSTIENPQAPAFIRGVNLKSKI |
| Ga0193602_10377531 | 3300019135 | Soil | STLILTKNFLMVQAPGFIRGINRKSKIENPQAPAFIRGVNLKSKI |
| Ga0193602_10757491 | 3300019135 | Soil | LTKNFLMVQAPGFIRGINPKSKIANPQAPAFIRGVNLKSKI |
| Ga0193597_12126702 | 3300019142 | Soil | MKKQSTVSDKRISKVVQAPGFIRGINPKSKIENPQAPAFI |
| Ga0193597_12363511 | 3300019142 | Soil | LDSLERAALTKNFLMVQAPGFIRGINPKSKIENPQAPAFI |
| Ga0163150_104630961 | 3300020195 | Freshwater Microbial Mat | KKSRVTKNFLMVQAPGFIRGINPKSQISNPQAPAFIRGVASKI |
| Ga0163154_100028641 | 3300020201 | Freshwater Microbial Mat | TKNFLMVQAPGFIRGINPKSQISNPQAPAFIRGVASKI |
| Ga0163152_100255275 | 3300020213 | Freshwater Microbial Mat | FLMVQAPGFIRGINPKSQISNPQAPAFIRGVASQISNLKSKID |
| Ga0163152_101066771 | 3300020213 | Freshwater Microbial Mat | MVQAPGFIRGINPKSQISNPQAPAFIRGVASKISNL |
| Ga0163146_100152527 | 3300020219 | Freshwater Microbial Mat | KNFLMVQAPGFIRGINPKSQISNPQAPAFIRGVASKI |
| Ga0247774_100268310 | 3300022903 | Plant Litter | MHPLTLLTDKRISKVVQAPGFIRGINPQSKIENPQAPAFIGGVNLKSKI |
| Ga0247774_10050081 | 3300022903 | Plant Litter | GFIRGINPFSQISNPQAPAFIRGVNLKSQISNLKSIDGDW |
| Ga0247774_10112052 | 3300022903 | Plant Litter | MTKNLLMVQAPEFIRGINPFSKIENPQAAAFIRGVNLKSKI |
| Ga0209277_100905201 | 3300027776 | Wastewater Effluent | MVQAPDLSVESIQNPKSLHPQAPGFIRGVNLKSKI |
| Ga0209490_100523381 | 3300027823 | Freshwater | MVQAPGFIRGINPKSQISNPQAPAFIRGVASKISNLKS |
| Ga0209490_103768652 | 3300027823 | Freshwater | QAPGFIRGINPKSQISNPQAPAFIRGVASKISNLKSQID |
| Ga0209591_102580133 | 3300027850 | Freshwater | KNFLMVQAPGFIRGINPKSQISNPQAPAFIRGVASKISNLKSKID |
| Ga0268243_10277731 | 3300030510 | Soil | LGIFDKRISKVVQAPGFIRGSNPKSHIENPQAPPFIRGVNLKSKI |
| Ga0268243_10451022 | 3300030510 | Soil | MGHILTKNFLMVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| Ga0326721_100608253 | 3300032080 | Soil | MTKNFLMVQAPGFIRGINPKSKIENPQAPAFIPGVNQKSKI |
| Ga0335395_100017851 | 3300032431 | Freshwater | MVQAPGFIRGINPKSQISNPQAPAFIRGVASKISNLKSQID |
| Ga0335394_100546605 | 3300032456 | Freshwater | MVQAPGFIRGINPKSQISNPQAPAFIRGVASKISN |
| Ga0334909_000158_7751_7906 | 3300033988 | Soil | VGGGDPFHFSDKRISKVVQAPGFIRGINPKLKIENPQAPAFIRGVNLKSKI |
| Ga0334909_000434_3327_3467 | 3300033988 | Soil | MDADFDKRISKVVQAPGFIRGINPFSKIENPQAPAFIRGVNLKSKI |
| Ga0334909_001030_488_613 | 3300033988 | Soil | MTKNLLMVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| Ga0334909_001350_4330_4485 | 3300033988 | Soil | MCDRLKEFNLMTKNFLLVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| Ga0334909_008399_380_490 | 3300033988 | Soil | MVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKID |
| Ga0334918_011679_1038_1193 | 3300034000 | Hypolithic Biocrust | RKSYCKKPSFLTKNFLMVQAPGFIRGINPKSKIENPQAPEFIRGVNLKSKI |
| Ga0334919_017562_1045_1182 | 3300034001 | Hypolithic Biocrust | MRSDDKRISKVVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| Ga0334926_006259_378_533 | 3300034004 | Hypolithic Biocrust | LDSAIARKLKVTKNFLMVQAPGFIRGINPKSQIENPQAPGFIRGVNLKSKI |
| Ga0334930_001682_3468_3599 | 3300034005 | Sub-Biocrust Soil | TRPHLTKNFLMVQAPGFIRGINPKSKIENPQAPAFIRGVASKI |
| Ga0334936_039830_862_975 | 3300034007 | Biocrust | SKVVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSQI |
| Ga0334927_002703_3741_3866 | 3300034024 | Hypolithic Biocrust | MTKNLLMVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKM |
| Ga0334927_140761_67_219 | 3300034024 | Hypolithic Biocrust | MWKLALSGIDKRISKVVQAPGFIRGINPKSKIENPQAPALIRGVNLKSKI |
| Ga0334949_147354_455_601 | 3300034027 | Biocrust | AILHPFYLIENFLMVQAPGFIRGINPKSKIENFQAPAFIRGVNLKSKI |
| Ga0334949_163247_1_108 | 3300034027 | Biocrust | VVQAPGFIRGINPKSQIENPQAPAFIRGVNLKSKI |
| Ga0334949_185569_3_131 | 3300034027 | Biocrust | LDKRISKVVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKI |
| Ga0334933_024832_21_161 | 3300034136 | Sub-Biocrust Soil | MSTKVLTKNFLMVQAPGFIRGINPKSQIENPQAPAFIRGVNLKSKI |
| Ga0334957_031662_803_934 | 3300034140 | Biocrust | MVQAPGFIRGINPKSKIENPQAPAFIRGVNLKSKISNLKSKID |
| Ga0334925_054979_1_111 | 3300034173 | Hypolithic Biocrust | GFIRGINPKSKIENPQAPAFIRGVASKIENRKSKID |
| Ga0334937_036297_1213_1326 | 3300034221 | Biocrust | FLTKNFLMVQAPGFIRGINPKSKIENPQAPAFIRGSI |
| Ga0334923_011539_1428_1574 | 3300034376 | Hypolithic Biocrust | VNSFYLYDKRISKVVQAPGFIRGINPKSQIENPQAPAFIRGVNLKSKI |
| ⦗Top⦘ |