| Basic Information | |
|---|---|
| Family ID | F051704 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 143 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MHDHENIVLATGSGITEMQLMWILMGLMAIHHIWMWWKMKKKDCNCK |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 33.57 % |
| % of genes near scaffold ends (potentially truncated) | 23.78 % |
| % of genes from short scaffolds (< 2000 bps) | 67.13 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.238 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (25.874 % of family members) |
| Environment Ontology (ENVO) | Unclassified (73.427 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (76.923 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.00% β-sheet: 0.00% Coil/Unstructured: 64.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF01464 | SLT | 5.59 |
| PF01521 | Fe-S_biosyn | 4.20 |
| PF00296 | Bac_luciferase | 2.80 |
| PF02945 | Endonuclease_7 | 2.10 |
| PF13704 | Glyco_tranf_2_4 | 2.10 |
| PF01844 | HNH | 2.10 |
| PF11397 | GlcNAc | 2.10 |
| PF00534 | Glycos_transf_1 | 1.40 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.40 |
| PF00476 | DNA_pol_A | 0.70 |
| PF02867 | Ribonuc_red_lgC | 0.70 |
| PF01391 | Collagen | 0.70 |
| PF02467 | Whib | 0.70 |
| PF00366 | Ribosomal_S17 | 0.70 |
| PF07719 | TPR_2 | 0.70 |
| PF06067 | DUF932 | 0.70 |
| PF14279 | HNH_5 | 0.70 |
| PF13385 | Laminin_G_3 | 0.70 |
| PF00535 | Glycos_transf_2 | 0.70 |
| PF13578 | Methyltransf_24 | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 4.20 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 4.20 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.80 |
| COG0186 | Ribosomal protein S17 | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.70 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.24 % |
| All Organisms | root | All Organisms | 37.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035265000|ErSWdraf_F5BXKTZ02H9SH9 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 2199352004|2199791100 | Not Available | 519 | Open in IMG/M |
| 3300001274|B570J13895_1001815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2908 | Open in IMG/M |
| 3300001282|B570J14230_10213895 | Not Available | 528 | Open in IMG/M |
| 3300002303|B570J29644_1006753 | Not Available | 743 | Open in IMG/M |
| 3300002835|B570J40625_100000179 | Not Available | 98877 | Open in IMG/M |
| 3300002835|B570J40625_100012581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 15157 | Open in IMG/M |
| 3300002835|B570J40625_100130892 | Not Available | 2940 | Open in IMG/M |
| 3300003413|JGI25922J50271_10103194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300003430|JGI25921J50272_10024934 | Not Available | 1552 | Open in IMG/M |
| 3300004112|Ga0065166_10265023 | Not Available | 694 | Open in IMG/M |
| 3300004112|Ga0065166_10423553 | Not Available | 558 | Open in IMG/M |
| 3300004124|Ga0066178_10189982 | Not Available | 587 | Open in IMG/M |
| 3300004793|Ga0007760_10497448 | Not Available | 522 | Open in IMG/M |
| 3300005517|Ga0070374_10069119 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
| 3300005581|Ga0049081_10198356 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300005662|Ga0078894_10004878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10301 | Open in IMG/M |
| 3300005662|Ga0078894_10068972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3048 | Open in IMG/M |
| 3300005662|Ga0078894_10142173 | Not Available | 2149 | Open in IMG/M |
| 3300005662|Ga0078894_10154476 | All Organisms → Viruses → Predicted Viral | 2063 | Open in IMG/M |
| 3300005662|Ga0078894_10519419 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
| 3300005662|Ga0078894_10883109 | Not Available | 777 | Open in IMG/M |
| 3300005662|Ga0078894_10912236 | Not Available | 761 | Open in IMG/M |
| 3300005662|Ga0078894_11082583 | Not Available | 685 | Open in IMG/M |
| 3300005662|Ga0078894_11153713 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300005662|Ga0078894_11265055 | Not Available | 622 | Open in IMG/M |
| 3300005662|Ga0078894_11311268 | Not Available | 608 | Open in IMG/M |
| 3300005662|Ga0078894_11332345 | Not Available | 602 | Open in IMG/M |
| 3300005662|Ga0078894_11363973 | Not Available | 594 | Open in IMG/M |
| 3300005662|Ga0078894_11442909 | Not Available | 573 | Open in IMG/M |
| 3300007545|Ga0102873_1059783 | Not Available | 1162 | Open in IMG/M |
| 3300007549|Ga0102879_1016207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2524 | Open in IMG/M |
| 3300007559|Ga0102828_1105162 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 689 | Open in IMG/M |
| 3300007600|Ga0102920_1069105 | Not Available | 1112 | Open in IMG/M |
| 3300007974|Ga0105747_1171977 | Not Available | 706 | Open in IMG/M |
| 3300008055|Ga0108970_10255070 | Not Available | 513 | Open in IMG/M |
| 3300008110|Ga0114343_1080617 | Not Available | 1170 | Open in IMG/M |
| 3300008113|Ga0114346_1029786 | Not Available | 2866 | Open in IMG/M |
| 3300008113|Ga0114346_1038755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2453 | Open in IMG/M |
| 3300008114|Ga0114347_1013426 | Not Available | 8933 | Open in IMG/M |
| 3300008120|Ga0114355_1110958 | Not Available | 1054 | Open in IMG/M |
| 3300008261|Ga0114336_1054242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2058 | Open in IMG/M |
| 3300009152|Ga0114980_10001888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14942 | Open in IMG/M |
| 3300009158|Ga0114977_10014707 | All Organisms → cellular organisms → Bacteria | 4938 | Open in IMG/M |
| 3300009159|Ga0114978_10095417 | Not Available | 1970 | Open in IMG/M |
| 3300009183|Ga0114974_10194621 | Not Available | 1241 | Open in IMG/M |
| 3300009183|Ga0114974_10738107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300009194|Ga0114983_1097641 | Not Available | 649 | Open in IMG/M |
| 3300009233|Ga0103856_10036511 | Not Available | 851 | Open in IMG/M |
| 3300009419|Ga0114982_1002213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8668 | Open in IMG/M |
| 3300009419|Ga0114982_1154933 | Not Available | 707 | Open in IMG/M |
| 3300012663|Ga0157203_1011631 | Not Available | 1430 | Open in IMG/M |
| 3300013004|Ga0164293_10180806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1540 | Open in IMG/M |
| 3300013004|Ga0164293_10916624 | Not Available | 550 | Open in IMG/M |
| 3300013005|Ga0164292_10031813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4247 | Open in IMG/M |
| 3300013087|Ga0163212_1094196 | Not Available | 966 | Open in IMG/M |
| (restricted) 3300013122|Ga0172374_1233314 | Not Available | 660 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10227095 | Not Available | 934 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10053348 | Not Available | 3189 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10118359 | All Organisms → Viruses → Predicted Viral | 1819 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10127955 | Not Available | 1722 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10029687 | Not Available | 5313 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10455913 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 786 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10740996 | Not Available | 577 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10016975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8657 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10019516 | Not Available | 7889 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10261411 | Not Available | 1259 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10262659 | Not Available | 1280 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10039339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3930 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10137696 | Not Available | 1652 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10511770 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 670 | Open in IMG/M |
| 3300017788|Ga0169931_10315333 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1216 | Open in IMG/M |
| 3300017788|Ga0169931_10537183 | Not Available | 812 | Open in IMG/M |
| 3300017788|Ga0169931_10890937 | Not Available | 562 | Open in IMG/M |
| 3300020074|Ga0194113_10204537 | Not Available | 1576 | Open in IMG/M |
| 3300020083|Ga0194111_10638360 | Not Available | 662 | Open in IMG/M |
| 3300020109|Ga0194112_10173512 | All Organisms → Viruses → Predicted Viral | 1787 | Open in IMG/M |
| 3300020141|Ga0211732_1330230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3816 | Open in IMG/M |
| 3300020151|Ga0211736_10063566 | Not Available | 2066 | Open in IMG/M |
| 3300020151|Ga0211736_10249378 | Not Available | 1585 | Open in IMG/M |
| 3300020151|Ga0211736_10543365 | Not Available | 1811 | Open in IMG/M |
| 3300020159|Ga0211734_10698648 | Not Available | 1023 | Open in IMG/M |
| 3300020161|Ga0211726_10270972 | Not Available | 874 | Open in IMG/M |
| 3300020161|Ga0211726_10635085 | Not Available | 1137 | Open in IMG/M |
| 3300020161|Ga0211726_10793230 | Not Available | 1322 | Open in IMG/M |
| 3300020172|Ga0211729_10881404 | Not Available | 833 | Open in IMG/M |
| 3300020179|Ga0194134_10006454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10507 | Open in IMG/M |
| 3300020179|Ga0194134_10267005 | Not Available | 692 | Open in IMG/M |
| 3300020183|Ga0194115_10017541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5831 | Open in IMG/M |
| 3300020183|Ga0194115_10083850 | Not Available | 1836 | Open in IMG/M |
| 3300020193|Ga0194131_10100508 | Not Available | 1573 | Open in IMG/M |
| 3300020220|Ga0194119_10890338 | Not Available | 519 | Open in IMG/M |
| 3300020498|Ga0208050_1000665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5231 | Open in IMG/M |
| 3300020519|Ga0208223_1002152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4068 | Open in IMG/M |
| 3300020519|Ga0208223_1023944 | Not Available | 822 | Open in IMG/M |
| 3300020560|Ga0208852_1000106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 21261 | Open in IMG/M |
| 3300020563|Ga0208082_1001543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6575 | Open in IMG/M |
| 3300020572|Ga0207909_1046923 | Not Available | 682 | Open in IMG/M |
| 3300022752|Ga0214917_10004393 | Not Available | 15688 | Open in IMG/M |
| 3300022752|Ga0214917_10050378 | All Organisms → Viruses → Predicted Viral | 2824 | Open in IMG/M |
| 3300024306|Ga0255148_1012351 | Not Available | 1699 | Open in IMG/M |
| 3300024343|Ga0244777_10000910 | Not Available | 22200 | Open in IMG/M |
| 3300024346|Ga0244775_11320618 | Not Available | 557 | Open in IMG/M |
| 3300024355|Ga0255157_1056419 | Not Available | 633 | Open in IMG/M |
| 3300026570|Ga0255274_1159188 | Not Available | 566 | Open in IMG/M |
| 3300027127|Ga0255071_1014362 | Not Available | 1279 | Open in IMG/M |
| 3300027127|Ga0255071_1052726 | Not Available | 587 | Open in IMG/M |
| 3300027141|Ga0255076_1085830 | Not Available | 511 | Open in IMG/M |
| 3300027142|Ga0255065_1011049 | Not Available | 1876 | Open in IMG/M |
| 3300027396|Ga0255146_1050046 | Not Available | 877 | Open in IMG/M |
| 3300027601|Ga0255079_1107977 | Not Available | 545 | Open in IMG/M |
| 3300027608|Ga0208974_1158871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300027689|Ga0209551_1020583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2239 | Open in IMG/M |
| 3300027710|Ga0209599_10000195 | Not Available | 42819 | Open in IMG/M |
| 3300027710|Ga0209599_10002315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7959 | Open in IMG/M |
| 3300027710|Ga0209599_10097215 | Not Available | 775 | Open in IMG/M |
| 3300027734|Ga0209087_1000099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 53198 | Open in IMG/M |
| 3300027759|Ga0209296_1000347 | Not Available | 39454 | Open in IMG/M |
| 3300027769|Ga0209770_10020235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 2936 | Open in IMG/M |
| 3300027769|Ga0209770_10104615 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300027782|Ga0209500_10280758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Patiencevirus → Patiencevirus patience | 713 | Open in IMG/M |
| 3300027797|Ga0209107_10301897 | Not Available | 753 | Open in IMG/M |
| 3300027892|Ga0209550_10042675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3737 | Open in IMG/M |
| 3300027892|Ga0209550_10211504 | All Organisms → Viruses → Predicted Viral | 1313 | Open in IMG/M |
| 3300027892|Ga0209550_10343695 | Not Available | 943 | Open in IMG/M |
| 3300031758|Ga0315907_10022311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 5848 | Open in IMG/M |
| 3300031784|Ga0315899_10414616 | Not Available | 1308 | Open in IMG/M |
| 3300031857|Ga0315909_10205295 | All Organisms → Viruses → Predicted Viral | 1557 | Open in IMG/M |
| 3300032093|Ga0315902_10041924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5362 | Open in IMG/M |
| 3300032093|Ga0315902_10904034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300033816|Ga0334980_0023570 | All Organisms → Viruses → Predicted Viral | 2638 | Open in IMG/M |
| 3300034013|Ga0334991_0022210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3681 | Open in IMG/M |
| 3300034022|Ga0335005_0084096 | Not Available | 2096 | Open in IMG/M |
| 3300034066|Ga0335019_0652388 | Not Available | 610 | Open in IMG/M |
| 3300034071|Ga0335028_0404651 | Not Available | 779 | Open in IMG/M |
| 3300034101|Ga0335027_0026437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4873 | Open in IMG/M |
| 3300034101|Ga0335027_0129615 | Not Available | 1880 | Open in IMG/M |
| 3300034102|Ga0335029_0732684 | Not Available | 531 | Open in IMG/M |
| 3300034106|Ga0335036_0431322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
| 3300034122|Ga0335060_0521941 | Not Available | 609 | Open in IMG/M |
| 3300034200|Ga0335065_0038646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3346 | Open in IMG/M |
| 3300034200|Ga0335065_0268954 | Not Available | 1086 | Open in IMG/M |
| 3300034272|Ga0335049_0696471 | Not Available | 616 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 25.87% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 9.09% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.29% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 6.29% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.59% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.20% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 4.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.50% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.50% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.70% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.70% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.70% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.70% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.70% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
| 2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300001274 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002303 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020563 | Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024355 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300026570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027127 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027601 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ErSWdraft_12511000 | 2035265000 | Freshwater | LTTGGGISEMTVMWILMGLMAAHHVWMWWKMRKKEKCDC |
| 2199952439 | 2199352004 | Freshwater | MHDHENIVLTTGSGITEMQLMWIVMGLMAIHHTWM |
| B570J13895_10018151 | 3300001274 | Freshwater | MHDHENIVLTTGSGITEMQLMWIIMGAMAIHHTWMWWKMRQKKCTCKNK* |
| B570J14230_102138952 | 3300001282 | Freshwater | MHDHNNITLATGSGITEMQLMWFIMGVMAIHHTWMWWKMRSKKCTCKK* |
| B570J29644_10067531 | 3300002303 | Freshwater | NNITLATGSGITEMQLMWIIMGAMAIHHTWMWWKMRSKKCTCKK* |
| B570J40625_10000017987 | 3300002835 | Freshwater | MHDHENIVLTTGSGITEMQLMWIIMGAMAIHHIWMWWKMKKKNCNCK* |
| B570J40625_10001258120 | 3300002835 | Freshwater | MHDHNNITLATGSGITEMQLMWLIMGVMAIHHTWMWWKMRSKRCTCKK* |
| B570J40625_1001308922 | 3300002835 | Freshwater | MHDHENIVLATGSGITEMQLMWILMGLMAIHHIWMWWKMKKKDCNCK* |
| JGI25922J50271_101031942 | 3300003413 | Freshwater Lake | MHDHETMVLATGGGISEMTVMWILMGLMAAHHVWMWWKMRKKEKCDC* |
| JGI25921J50272_100249343 | 3300003430 | Freshwater Lake | MXDHENIVLXTGSGITEMQXMWIVMGLMAIHHTWMWWKMRQKKCTCKRR* |
| Ga0065166_102650231 | 3300004112 | Freshwater Lake | MHDHENIVIATGGGISEMTLMWIIMGAMALHHIWMWWKMKSKKCECKK* |
| Ga0065166_104235532 | 3300004112 | Freshwater Lake | MHDHENIVLATGSGITEMQLMWILMGAMAIHHIWMWWKMKKKNC |
| Ga0066178_101899822 | 3300004124 | Freshwater Lake | MHDHENIVLATGSGITEMQLMWIVMGLMAIHHIWMWRKMKKKNCNCK* |
| Ga0007760_104974481 | 3300004793 | Freshwater Lake | MHDHENIVLATGSGITEMQLMWIIMGAMAIHHIWMWWKMKKKDCN |
| Ga0070374_100691193 | 3300005517 | Freshwater Lake | MHDHENIVLATGSGITEMQLMWIVMGAMAIHHIWMWWKMKKKDCNCK* |
| Ga0049081_101983562 | 3300005581 | Freshwater Lentic | MHDHEKMILTTGGGISEMTVMWILMGLMAAHHVWMWWKMRKKEKCDC* |
| Ga0078894_1000487815 | 3300005662 | Freshwater Lake | MHDHENMVLATGGGVSEMTVMWILMGLMAAHHVWMWWKMKKKEKCDC* |
| Ga0078894_100689727 | 3300005662 | Freshwater Lake | MHDHENIVLATGSGISEMTLMWILMGLMAVHHIWMWWKMKKKNCNCK* |
| Ga0078894_101421736 | 3300005662 | Freshwater Lake | MHDHETITLATGSGITEMQVMWILMAIMAGHHLWMWFQMVPKNANAKNKILLTFTKI* |
| Ga0078894_101544764 | 3300005662 | Freshwater Lake | MHDHENIVLATGSGINEMTLMWILMGLMAAHHIWMWWKMKKKNCKCK* |
| Ga0078894_105194192 | 3300005662 | Freshwater Lake | MHDHENMVLTTGGGISEMTVMWILMGLMAAHHAWMWWKMRKKEKCDC* |
| Ga0078894_108831093 | 3300005662 | Freshwater Lake | MHDHENIVLATGLGITEMQLMWIVMGIMAAHHIWMWWKMKKKKCKCGK* |
| Ga0078894_109122362 | 3300005662 | Freshwater Lake | LATGSGITEMQLMWILMGVMAIHHIWMWWKMKKKNCNCK* |
| Ga0078894_110825832 | 3300005662 | Freshwater Lake | MHDHENIVLATGSGITEMQLMWIVMGVMAIHHIWMWWKMKKKDCNCK* |
| Ga0078894_111537131 | 3300005662 | Freshwater Lake | MHDHENMILTTGDGISEMTVMWILMGLMAAHHVWMWWKMRKKEKCDC* |
| Ga0078894_112650552 | 3300005662 | Freshwater Lake | MHDHENIVLSTGSGITEMQLMWILMGAMAIHHIWMWWKMKKKNCNCK* |
| Ga0078894_113112682 | 3300005662 | Freshwater Lake | MHDHENIVLATGSGITEMQLMWIVMGLMAIHHTWMWWKMRQKKCTCKRR* |
| Ga0078894_113323452 | 3300005662 | Freshwater Lake | MHDHENIVLATGSGITEMQLMWILMGAMAIHHIWMWWKMKKKNCNCK* |
| Ga0078894_113639732 | 3300005662 | Freshwater Lake | MHDHENIVLATGSGITEMQLMWIAMGLMAIHHIWMWWKMKKKNCNCK* |
| Ga0078894_114429092 | 3300005662 | Freshwater Lake | MHDHENIVLATGSGITEMQLMWIVMGLMAIHHIWMWWKMKKKNCNCK* |
| Ga0102873_10597831 | 3300007545 | Estuarine | MHDHENIVLATGSGITEMQLMWIIMGAMAIHHIWMWWKMKKKNCNCK* |
| Ga0102879_10162072 | 3300007549 | Estuarine | MHDHENIVLATGSGITEMQLMWIIMGAMAIHHIWMWWKMKKKDCNCK* |
| Ga0102828_11051622 | 3300007559 | Estuarine | MNDHKNIVLDTGSVITEMELMWIFIGAIIIHDTWMWWKMKKKDCNCK* |
| Ga0102920_10691051 | 3300007600 | Estuarine | NIVLATGSGITEMQLMWIIMGAMAIHHIWMWWKMKKKNCNCK* |
| Ga0105747_11719772 | 3300007974 | Estuary Water | MHDHENIVLATGSGITEMQLMWIVMGLMAIHHTWMWWKMRQKKCTCKRK* |
| Ga0108970_102550702 | 3300008055 | Estuary | IVLATGSGITEMQLMWIIMGAMAIHHIWMWWKMKKKNCKCK* |
| Ga0114343_10806171 | 3300008110 | Freshwater, Plankton | MHDHENIVLATGSGITEMQLMWILMGVMAIHHIWMWWKMKKKNCNCK* |
| Ga0114346_10297865 | 3300008113 | Freshwater, Plankton | MHDHETITLATGSGITEMQVMWILMAIMAGHHLWMWFQMRSKKCKCKK* |
| Ga0114346_10387553 | 3300008113 | Freshwater, Plankton | MHDHNNITLATGSGITEMQLMWFIMGVMAIHHTWMWWKMRSKRCTCKK* |
| Ga0114347_101342610 | 3300008114 | Freshwater, Plankton | MHDHNNINLTTGGGITEMQLMWVVMGIMAVHHLWMWLDMRKMKKKEKCDC* |
| Ga0114355_11109582 | 3300008120 | Freshwater, Plankton | MHDHQDIILSTGNPITEMQLMWIIMGAMAIHHIWMWWKMKKRDCNCK* |
| Ga0114336_10542422 | 3300008261 | Freshwater, Plankton | MHDHENITLATGPGMSEMDIMWIVMAIMAGHHLWMWFKMRSKKCKCKK* |
| Ga0114980_100018887 | 3300009152 | Freshwater Lake | MHDHEQMLLTTGGGITEMQLMWIIMGLMAIHHAWMWWKMRKNKCGCK* |
| Ga0114977_100147074 | 3300009158 | Freshwater Lake | MHDHENMILTIGGGISEMTVMWILMGLMSAHHAWMWWKMRKKEKCDC* |
| Ga0114978_100954175 | 3300009159 | Freshwater Lake | MHDHEKMTLVSGSGITEMQLMWIIMGAMAIHHIWMWWKMKKRNCNCK* |
| Ga0114974_101946213 | 3300009183 | Freshwater Lake | MVLATGSGITEMQLMWIIMGAMAIHHIWMWWKMKKKDCNCK* |
| Ga0114974_107381071 | 3300009183 | Freshwater Lake | HEQMILTTGGGITEMQLMWIVMGLMAIHHAWMWWKMSKKKCGCK* |
| Ga0114983_10976412 | 3300009194 | Deep Subsurface | MHDHENIVLATGSGITEMQVMWILMGLMAAHHIWMWWKMKKKDCNCK* |
| Ga0103856_100365113 | 3300009233 | River Water | MNHENMNMSTGISQMTLMWIIMGLMAAHHIYMWWKMKKKNCNCNK* |
| Ga0114982_100221315 | 3300009419 | Deep Subsurface | MHDHENIVLATGSGITEMQLMWIIMGAMAIHHIWMWWNMKKKNCNCK* |
| Ga0114982_11549331 | 3300009419 | Deep Subsurface | MHDHENIVLVTGSGITEMQLMWIVMGAMAIHHIWMWWKMKKKDCNCK* |
| Ga0157203_10116312 | 3300012663 | Freshwater | MHDHETMTLVSGSGITEMQLMWILMGLMAIHHIWMWRKMRRRKCTCKRK* |
| Ga0164293_101808061 | 3300013004 | Freshwater | MHDHNNITLATGSGITEMQLMWFIMGVMAIHHTWMWWKMR |
| Ga0164293_109166241 | 3300013004 | Freshwater | ENIVLTTGSGITEMQLMWIVMGLMAIHHIWMWWKMKKRDCNCK* |
| Ga0164292_100318137 | 3300013005 | Freshwater | MHDHENIVLATGSGITEMQVMWILMGLMAIHHVWMWRKMKQKKCTCKRR* |
| Ga0163212_10941961 | 3300013087 | Freshwater | MDLAVGVGITEMQLMWILMGLMAAHHAWMWWKMRKKKNCDCD* |
| (restricted) Ga0172374_12333143 | 3300013122 | Freshwater | MHDHHNMNLELGAGITEMQLMWILMGLMAIHHAWMWWKMRSKKCSCKK* |
| (restricted) Ga0172368_102270951 | 3300013123 | Freshwater | MHDHHNMNLELGAGITEMQLMWILMGLMAIHHTWMWWKMRKKCSCKE* |
| (restricted) Ga0172367_100533482 | 3300013126 | Freshwater | MHDHNNMNLAVGITEMQLMWILMGLMAIHHTWMWWKMRKKKNCDCE* |
| (restricted) Ga0172367_101183591 | 3300013126 | Freshwater | MHDHHNMNLELGAGITEMHLMWILMGIMAIHHTWMWWKMRKKCNC |
| (restricted) Ga0172367_101279551 | 3300013126 | Freshwater | MYNIYMHDHHNMNIELGAGITEMQLMWILMGLMAIHHTWMWWKMRKKCSCKK* |
| (restricted) Ga0172373_100296871 | 3300013131 | Freshwater | MHDHHNMNLELGAGITEMQLMWILMGLMAIHHTWMWWKMRSKKCDCKK* |
| (restricted) Ga0172373_104559131 | 3300013131 | Freshwater | MHDHHNMNLELGAGITEMQLMWILMGLMAIHHTWMWWKMR |
| (restricted) Ga0172373_107409961 | 3300013131 | Freshwater | MHDHHNMNLELGAGITEMQLMWILMGLMAIHHAWMWWKMRSKKCDCKK* |
| (restricted) Ga0172372_100169759 | 3300013132 | Freshwater | MYNIYMHDHHNMNIELGAGITEMQLMWILMGLMTIHHTWMWWKMRSKKCSCKK* |
| (restricted) Ga0172372_100195167 | 3300013132 | Freshwater | MHDHDNMNIELGAGITEMQLMWILMGIMAIHHAWMWWKMRSKK* |
| (restricted) Ga0172372_102614111 | 3300013132 | Freshwater | MHDHHNMNLELGAGITEMQLMWILMGLMAIHHTWMWWKMRSKKCNCKN* |
| (restricted) Ga0172375_102626594 | 3300013137 | Freshwater | DHHNMNIELGAGITEMQLMWILMGIMAIHHTWMWWKMRKKCNCKK* |
| (restricted) Ga0172376_100393398 | 3300014720 | Freshwater | MHDHHNMNLELGAGITEMQLMWILMGLMAIHHTWMWWKMRSKKCKCKN* |
| (restricted) Ga0172376_101376963 | 3300014720 | Freshwater | MNLAVGITEMQLMWILMGLMAIHHTWMWWKMRKKKNCDCE* |
| (restricted) Ga0172376_105117702 | 3300014720 | Freshwater | MHDHHNMNLELGAGITEMQLMWILMGLMAIHHTWMWWKMRKKCNCKK* |
| Ga0169931_103153332 | 3300017788 | Freshwater | MHDHHNMNLELGAGITEMQLMWILMGLMAIHHTWMWWKMRKKCNCKK |
| Ga0169931_105371831 | 3300017788 | Freshwater | MHDHHNMNLELGAGITEMQLMWILMGLMAIHHTWMWWKMRSKKCDCKK |
| Ga0169931_108909371 | 3300017788 | Freshwater | KPLYNRSMHDHHNMNLEIGAGITEMQLMWILMGLMAIHHTWMWWKMRKKCSCKK |
| Ga0194113_102045372 | 3300020074 | Freshwater Lake | MHDHHNIDLAIGITEMQLMWTLMGLMAVHHAWMWWKMRKKKNCDCD |
| Ga0194111_106383601 | 3300020083 | Freshwater Lake | MHDHHNMDLAVGITEMQLMWILMGLMAAHHAWMWWKMRKKKNCDCD |
| Ga0194112_101735121 | 3300020109 | Freshwater Lake | MHDHHNMDLAVGITEMQLMWILMGLMAAHHAWMWWK |
| Ga0211732_13302302 | 3300020141 | Freshwater | MHDHENIVLATGLGITEMQVMWILMGIMAMHHIWMWWRMKKKDCKCK |
| Ga0211736_100635662 | 3300020151 | Freshwater | MHDHENIVLATGSGITEMQLMWIVMGLMAIHHVWMWWKMKKKDCKCK |
| Ga0211736_102493782 | 3300020151 | Freshwater | MHDHDNVVLATGSGITEMQLMWIIMGLMAIHHIWMWRKMKKKDCKCK |
| Ga0211736_105433653 | 3300020151 | Freshwater | MHDHENIVLATGSGITEMQLMWIAMGAMAIHHIWMWWKMKKKNCSCK |
| Ga0211734_106986483 | 3300020159 | Freshwater | MHDHENIVLATGSGITEMQLMWILMGLMAIHHAWMWWKMKKKDCKCK |
| Ga0211726_102709722 | 3300020161 | Freshwater | MHDHENIVLATGSGITEMQLMWILMSLMAIHHAWMWWKMK |
| Ga0211726_106350851 | 3300020161 | Freshwater | MHDHENIVLTTGSGITEMQLMWIVMGIMAIHHTWMWWKMRQRKCTCKRK |
| Ga0211726_107932304 | 3300020161 | Freshwater | MHDHDNVVLATGSGITEMQLMWIIMGLMAIHHIWMWRKMKKK |
| Ga0211729_108814041 | 3300020172 | Freshwater | MHDHDNITLATGSGITEMQLMWIIMGLMAIHHTWMWWKMRSKKCNCKK |
| Ga0194134_100064546 | 3300020179 | Freshwater Lake | MHDHHNMNLVLGITEMQLMWILMGLMAIHHIWMWWKMRSKK |
| Ga0194134_102670051 | 3300020179 | Freshwater Lake | RYVHDHHNMNSELVAGITEMQLMWILMGLMAIHHTWMWWKMRKKCNCKK |
| Ga0194115_100175411 | 3300020183 | Freshwater Lake | MHDHHNMNSELVAGITEMQLMWILMGLMAIHHTWMWWKMRKKCNCKK |
| Ga0194115_100838505 | 3300020183 | Freshwater Lake | LVAGITEMQLMWILMGLMAIHHAWMWWKMRKKCNCKK |
| Ga0194131_101005081 | 3300020193 | Freshwater Lake | MHDHHNIDLAIGITEMQLMWILMGLMAAHHAWMWWKMRKKKNCDCD |
| Ga0194119_108903381 | 3300020220 | Freshwater Lake | MNLEIGAGITEMQLMWILMGLMAAHHAWMWWKMRKKKNCDCD |
| Ga0208050_100066510 | 3300020498 | Freshwater | MHDHNNITLATGSGITEMQLMWFIMGVMAIHHTWMWWKMRSKKCTCKK |
| Ga0208223_10021521 | 3300020519 | Freshwater | MHDHNNITLATGSGITEMQLMWIIMGAMAIHHTWMWWKMRSKKCTCKK |
| Ga0208223_10239443 | 3300020519 | Freshwater | MHDHENIVLSTGSGITEMQLMWIVMGLMAIHHVWMWWKMKKKDCNCK |
| Ga0208852_100010648 | 3300020560 | Freshwater | MHDHENIVLTTGSGITEMQLMWIIMGAMAIHHIWMWWKMKKKNCNCK |
| Ga0208082_10015438 | 3300020563 | Freshwater | MHDHENIVLTTGSGITEMQLMWIVMGLMAIHHTWMWWKMRQKKCTCKNK |
| Ga0207909_10469233 | 3300020572 | Freshwater | LTTGSGITEMQLMWIIMGAMAIHHIWMWWKMKKKNCNCK |
| Ga0214917_1000439314 | 3300022752 | Freshwater | MHNHENMVLTTGNGISEMTVMWILMGLMATHHIWMWWKMKKKEKCDC |
| Ga0214917_100503782 | 3300022752 | Freshwater | MHDHNSHQSLDFSGITEMQLMWILMIVMASHHAWMWWKMRKKKDCDCRH |
| Ga0255148_10123511 | 3300024306 | Freshwater | MNLTVGSGITEMELMWILMGLMAAHHIWMWWNMRKKKCDCKH |
| Ga0244777_1000091029 | 3300024343 | Estuarine | MHDHENIVLATGSGITEMQLMWIIMGAMAIHHIWMWWKMKKKNCNCK |
| Ga0244775_113206181 | 3300024346 | Estuarine | MHDHENIVLATGSGITEMQLMWIVMGLMAIHHTWMWWKMRQKKCTC |
| Ga0255157_10564191 | 3300024355 | Freshwater | MHDHNNMNLTVGSGITEMELMWILMGLMAAHHIWMWWNMRKKKCDCKH |
| Ga0255274_11591881 | 3300026570 | Freshwater | VGSGITEMELMWILMGLMAAHHIWMWWNMRKKKCDCKH |
| Ga0255071_10143621 | 3300027127 | Freshwater | MHDHENIVLATGSGITEMQLMWIIMGAMAIHHIWMWWKMKKKDCNCK |
| Ga0255071_10527262 | 3300027127 | Freshwater | MHDHENIVLATGSGITEMQLMWIVMGLMAIHHTWMWWKMRQKKCT |
| Ga0255076_10858301 | 3300027141 | Freshwater | MHDHENIVLATGSGITEMQLMWIVMGLMAIHHTWMWW |
| Ga0255065_10110495 | 3300027142 | Freshwater | MHDHENIVLATGSGITEMQLMWIIMGAMAIHHIWMWWKMKKKD |
| Ga0255146_10500461 | 3300027396 | Freshwater | MHDHNNMNLTLGSGITEMQLMWILMGLMAAHHIWMWWNMRKKKCDCKHR |
| Ga0255079_11079772 | 3300027601 | Freshwater | MHDHENIVLATGSGITEMQLMWIVMGLMAIHHTWMWWKMRQKKCTCKRK |
| Ga0208974_11588712 | 3300027608 | Freshwater Lentic | MHDHNNINLTTGGGITEMQLMWVVMGIMVVHHLWMWLDMRKMKKKEKCDC |
| Ga0209551_10205835 | 3300027689 | Freshwater Lake | MHDHENIVLATGSGITEMQLMWIAMGLMAIHHIWMWWKMKKKNCNCK |
| Ga0209599_100001958 | 3300027710 | Deep Subsurface | MHDHENIVLATGSGITEMQLMWIIMGAMAIHHIWMWWNMKKKNCNCK |
| Ga0209599_1000231521 | 3300027710 | Deep Subsurface | MHDHENIVLATGSGITEMQVMWILMGLMAAHHIWMWWKMKKKDCNCK |
| Ga0209599_100972152 | 3300027710 | Deep Subsurface | MHDHENIVLVTGSGITEMQLMWIVMGAMAIHHIWMWWKMKKKDCNCK |
| Ga0209087_100009960 | 3300027734 | Freshwater Lake | MHDHEQMLLTTGGGITEMQLMWIIMGLMAIHHAWMWWKMRKNKCGCK |
| Ga0209296_100034745 | 3300027759 | Freshwater Lake | MHDHEKMTLVSGSGITEMQLMWIIMGAMAIHHIWMWWKMKKRNCNCK |
| Ga0209770_100202352 | 3300027769 | Freshwater Lake | MHDHENMVLATGGGVSEMTVMWILMGLMAAHHVWMWWKMKKKEKCDC |
| Ga0209770_101046152 | 3300027769 | Freshwater Lake | MHDHETMVLATGGGISEMTVMWILMGLMAAHHVWMWWKMRKKEKCDC |
| Ga0209500_102807581 | 3300027782 | Freshwater Lake | MHDHQDIILSTGNPITEMQLMWIIMGAMAIHHIWMWWKMKKRDCNCK |
| Ga0209107_103018971 | 3300027797 | Freshwater And Sediment | MHDHENVVLATGSGITEMQLMWIVMGAMAIHHIWMWWKMKKKDCNCK |
| Ga0209550_100426758 | 3300027892 | Freshwater Lake | MHDHENIVLATGSGITEMQLMWIVMGAMAIHHIWMWWKMKKKDCNCK |
| Ga0209550_102115042 | 3300027892 | Freshwater Lake | MHDHENIVLATGSGINEMTLMWILMGLMAAHHIWMWWKMKKKKCKCK |
| Ga0209550_103436954 | 3300027892 | Freshwater Lake | MHDHENIVLTTGSGITEMQLMWIVMGLMAIHHIWMWWKMKKKDCNCK |
| Ga0315907_100223117 | 3300031758 | Freshwater | MHDHNNINLTTGGGITEMQLMWVVMGIMAVHHLWMWLDMRKMKKKEKCDC |
| Ga0315899_104146165 | 3300031784 | Freshwater | PMHDHNTMNLELGAGITEMQLMWILMGLMAIHHTWMWWKMRRKKNCDCRH |
| Ga0315909_102052952 | 3300031857 | Freshwater | MHDHESMVLATGGGISEMTVMWILMGLMAAHHVWMWWKMKKKEKCDC |
| Ga0315902_100419243 | 3300032093 | Freshwater | MHDHNNITLATGSGITEMQLMWFIMGVMAIHHTWMWWKMRSKRCTCKK |
| Ga0315902_109040342 | 3300032093 | Freshwater | INLITGGGITEMQLMWVVMGIMAVHHLWMWLDMRKMKKKEKCDC |
| Ga0334980_0023570_590_742 | 3300033816 | Freshwater | MHDHNNINLTIGGGITEMQLMWVVMGIMAVHHFWMWLDMRKMKKKEKCDC |
| Ga0334991_0022210_948_1091 | 3300034013 | Freshwater | MHDHENIVLATGSGITEMQVMWILMGLMAVHHIWMWWKMKKKDCNCK |
| Ga0335005_0084096_584_727 | 3300034022 | Freshwater | MHDHENIVLATGSGITEMQLMWIVMGLMAIHHVWMWWKMKKKDCNCK |
| Ga0335019_0652388_437_580 | 3300034066 | Freshwater | MHDHENIVLATGSGITEMQLMWIAMGLMAIHHVWMWWKMKKKDCNCK |
| Ga0335028_0404651_1_120 | 3300034071 | Freshwater | LTTGSGITEMQLMWIVMGAMAIHHIWMWWKMKKKNCNCK |
| Ga0335027_0026437_901_1044 | 3300034101 | Freshwater | MHDHNNITLATGSGITEMQLMWFIMGVMAIHHTWMWWKMKKKNCNCK |
| Ga0335027_0129615_739_888 | 3300034101 | Freshwater | MHDHENIVLTTGSGITEMQLMWIVMGLMAIHHTWMWWKMRQKKCTCKRR |
| Ga0335029_0732684_22_165 | 3300034102 | Freshwater | MHDHENIVLATGSGITEMQLMWIAMGLMAIHHIWMWWKMKKKDCDCK |
| Ga0335036_0431322_117_260 | 3300034106 | Freshwater | MHDHENMVLTTGGGISEMTVMWILMGLMAAHHAWMWWKMRKKEKCDC |
| Ga0335060_0521941_466_609 | 3300034122 | Freshwater | MHDHENIVLTTGSGITEMQLMWIVMGLMAIHHIWMWWKMKKRDCNCK |
| Ga0335065_0038646_531_674 | 3300034200 | Freshwater | MHDHENIVLTTGSGITEMQLMWIVMGLMAIHHIWMWRKMKKKDCNCK |
| Ga0335065_0268954_271_414 | 3300034200 | Freshwater | MHDHENIVLATGSGITEMQLMWILMGLMAIHHIWMWWKMKKKDCNCK |
| Ga0335049_0696471_232_378 | 3300034272 | Freshwater | MHDHENIVIATGGGISEMTLMWIIMGAMALHHIWMWWKMKSKKCECKK |
| ⦗Top⦘ |