Metagenome Family F051647

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F051647
Family Type	Metagenome
Number of Sequences	143
Average Sequence Length	42 residues
Representative Sequence	VTRVDGDSGHGGANFVGDGVSVTAVSKMTKQERIKHHSIETKL
Number of Associated Samples	67
Number of Associated Scaffolds	143

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	63.12 %
% of genes near scaffold ends (potentially truncated)	44.76 %
% of genes from short scaffolds (< 2000 bps)	98.60 %
Associated GOLD sequencing projects	67
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (98.601 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (93.007 % of family members)
Environment Ontology (ENVO)	Unclassified (93.007 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (93.007 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 29.58% β-sheet: 5.63% Coil/Unstructured: 64.79%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.32
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 143 Family Scaffolds
PF08284	RVP_2	0.70

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
All Organisms	root	All Organisms	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
cellular organisms	root	All Organisms → cellular organisms	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Rottboelliinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Rottboelliinae	0.70 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	0.70 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	0.70 %
Coix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Rottboelliinae → Coix	0.70 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Coix lacryma-jobi	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Rottboelliinae → Coix → Coix lacryma-jobi	0.70 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.70 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005364\|Ga0070673_101380400	Not Available	663	Open in IMG/M
3300005459\|Ga0068867_100934214	Not Available	782	Open in IMG/M
3300009148\|Ga0105243_11556999	Not Available	686	Open in IMG/M
3300009148\|Ga0105243_12192565	Not Available	589	Open in IMG/M
3300009176\|Ga0105242_12537246	Not Available	561	Open in IMG/M
3300013297\|Ga0157378_11777300	Not Available	664	Open in IMG/M
3300014745\|Ga0157377_11011066	Not Available	630	Open in IMG/M
3300014969\|Ga0157376_11389588	Not Available	733	Open in IMG/M
3300015267\|Ga0182122_1017593	Not Available	740	Open in IMG/M
3300015267\|Ga0182122_1048001	Not Available	565	Open in IMG/M
3300015268\|Ga0182154_1013357	Not Available	798	Open in IMG/M
3300015268\|Ga0182154_1068160	Not Available	514	Open in IMG/M
3300015269\|Ga0182113_1012771	Not Available	905	Open in IMG/M
3300015269\|Ga0182113_1014147	Not Available	879	Open in IMG/M
3300015269\|Ga0182113_1061659	Not Available	579	Open in IMG/M
3300015274\|Ga0182188_1013936	Not Available	740	Open in IMG/M
3300015274\|Ga0182188_1017879	Not Available	695	Open in IMG/M
3300015274\|Ga0182188_1046244	Not Available	546	Open in IMG/M
3300015275\|Ga0182172_1015823	Not Available	779	Open in IMG/M
3300015276\|Ga0182170_1033551	Not Available	640	Open in IMG/M
3300015277\|Ga0182128_1023525	Not Available	710	Open in IMG/M
3300015279\|Ga0182174_1038664	Not Available	636	Open in IMG/M
3300015279\|Ga0182174_1064112	Not Available	550	Open in IMG/M
3300015281\|Ga0182160_1013596	Not Available	835	Open in IMG/M
3300015283\|Ga0182156_1038290	Not Available	642	Open in IMG/M
3300015285\|Ga0182186_1022265	Not Available	735	Open in IMG/M
3300015285\|Ga0182186_1067336	Not Available	535	Open in IMG/M
3300015286\|Ga0182176_1057266	Not Available	572	Open in IMG/M
3300015287\|Ga0182171_1012030	Not Available	878	Open in IMG/M
3300015287\|Ga0182171_1016910	Not Available	801	Open in IMG/M
3300015287\|Ga0182171_1037582	Not Available	646	Open in IMG/M
3300015287\|Ga0182171_1061672	Not Available	561	Open in IMG/M
3300015289\|Ga0182138_1079423	Not Available	521	Open in IMG/M
3300015292\|Ga0182141_1074262	Not Available	541	Open in IMG/M
3300015292\|Ga0182141_1081446	Not Available	526	Open in IMG/M
3300015294\|Ga0182126_1058960	Not Available	583	Open in IMG/M
3300015295\|Ga0182175_1007250	Not Available	1055	Open in IMG/M
3300015295\|Ga0182175_1037603	Not Available	670	Open in IMG/M
3300015296\|Ga0182157_1033357	Not Available	703	Open in IMG/M
3300015296\|Ga0182157_1081289	Not Available	542	Open in IMG/M
3300015298\|Ga0182106_1068467	Not Available	571	Open in IMG/M
3300015299\|Ga0182107_1019634	Not Available	821	Open in IMG/M
3300015300\|Ga0182108_1036154	Not Available	697	Open in IMG/M
3300015300\|Ga0182108_1078252	Not Available	554	Open in IMG/M
3300015300\|Ga0182108_1102619	Not Available	509	Open in IMG/M
3300015303\|Ga0182123_1048978	Not Available	617	Open in IMG/M
3300015304\|Ga0182112_1025666	Not Available	763	Open in IMG/M
3300015304\|Ga0182112_1035726	Not Available	694	Open in IMG/M
3300015304\|Ga0182112_1084942	Not Available	539	Open in IMG/M
3300015305\|Ga0182158_1033481	Not Available	704	Open in IMG/M
3300015305\|Ga0182158_1056003	Not Available	608	Open in IMG/M
3300015305\|Ga0182158_1058604	Not Available	600	Open in IMG/M
3300015308\|Ga0182142_1045223	Not Available	668	Open in IMG/M
3300015308\|Ga0182142_1045774	Not Available	666	Open in IMG/M
3300015308\|Ga0182142_1089648	Not Available	544	Open in IMG/M
3300015314\|Ga0182140_1014856	Not Available	916	Open in IMG/M
3300015321\|Ga0182127_1029295	Not Available	782	Open in IMG/M
3300015322\|Ga0182110_1027800	Not Available	792	Open in IMG/M
3300015322\|Ga0182110_1044701	Not Available	689	Open in IMG/M
3300015323\|Ga0182129_1051737	Not Available	642	Open in IMG/M
3300015323\|Ga0182129_1086896	Not Available	550	Open in IMG/M
3300015323\|Ga0182129_1087531	Not Available	549	Open in IMG/M
3300015341\|Ga0182187_1054881	Not Available	792	Open in IMG/M
3300015341\|Ga0182187_1130367	Not Available	588	Open in IMG/M
3300015341\|Ga0182187_1176677	Not Available	526	Open in IMG/M
3300015342\|Ga0182109_1130014	Not Available	618	Open in IMG/M
3300015343\|Ga0182155_1127518	Not Available	621	Open in IMG/M
3300015343\|Ga0182155_1161279	Not Available	570	Open in IMG/M
3300015343\|Ga0182155_1210571	Not Available	515	Open in IMG/M
3300015344\|Ga0182189_1009131	Not Available	1483	Open in IMG/M
3300015344\|Ga0182189_1168528	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	566	Open in IMG/M
3300015346\|Ga0182139_1027971	Not Available	1108	Open in IMG/M
3300015346\|Ga0182139_1121604	Not Available	659	Open in IMG/M
3300015346\|Ga0182139_1141459	Not Available	623	Open in IMG/M
3300015346\|Ga0182139_1164702	Not Available	588	Open in IMG/M
3300015347\|Ga0182177_1153488	Not Available	606	Open in IMG/M
3300015347\|Ga0182177_1169219	Not Available	584	Open in IMG/M
3300015347\|Ga0182177_1194595	Not Available	553	Open in IMG/M
3300015351\|Ga0182161_1048689	Not Available	969	Open in IMG/M
3300015351\|Ga0182161_1098149	Not Available	746	Open in IMG/M
3300015351\|Ga0182161_1109789	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Rottboelliinae → Coix → Coix lacryma-jobi	715	Open in IMG/M
3300015351\|Ga0182161_1217243	Not Available	547	Open in IMG/M
3300015351\|Ga0182161_1256861	Not Available	510	Open in IMG/M
3300015355\|Ga0182159_1164436	Not Available	698	Open in IMG/M
3300015355\|Ga0182159_1354474	Not Available	500	Open in IMG/M
3300015361\|Ga0182145_1068899	Not Available	712	Open in IMG/M
3300017404\|Ga0182203_1084606	Not Available	624	Open in IMG/M
3300017404\|Ga0182203_1115107	Not Available	566	Open in IMG/M
3300017404\|Ga0182203_1125856	Not Available	549	Open in IMG/M
3300017407\|Ga0182220_1049771	Not Available	626	Open in IMG/M
3300017409\|Ga0182204_1013906	Not Available	947	Open in IMG/M
3300017409\|Ga0182204_1084975	Not Available	560	Open in IMG/M
3300017410\|Ga0182207_1088374	Not Available	636	Open in IMG/M
3300017411\|Ga0182208_1064754	Not Available	625	Open in IMG/M
3300017411\|Ga0182208_1068736	Not Available	613	Open in IMG/M
3300017413\|Ga0182222_1073011	Not Available	558	Open in IMG/M
3300017413\|Ga0182222_1082222	Not Available	541	Open in IMG/M
3300017413\|Ga0182222_1091030	Not Available	526	Open in IMG/M
3300017415\|Ga0182202_1073829	Not Available	617	Open in IMG/M
3300017415\|Ga0182202_1081098	Not Available	599	Open in IMG/M
3300017415\|Ga0182202_1103860	Not Available	554	Open in IMG/M
3300017424\|Ga0182219_1044295	Not Available	718	Open in IMG/M
3300017424\|Ga0182219_1067795	Not Available	631	Open in IMG/M
3300017424\|Ga0182219_1093816	Not Available	571	Open in IMG/M
3300017424\|Ga0182219_1101608	Not Available	557	Open in IMG/M
3300017425\|Ga0182224_1019513	Not Available	969	Open in IMG/M
3300017425\|Ga0182224_1026972	Not Available	882	Open in IMG/M
3300017425\|Ga0182224_1032815	Not Available	832	Open in IMG/M
3300017427\|Ga0182190_1091422	Not Available	617	Open in IMG/M
3300017430\|Ga0182192_1103322	Not Available	602	Open in IMG/M
3300017430\|Ga0182192_1113057	Not Available	584	Open in IMG/M
3300017433\|Ga0182206_1035356	Not Available	806	Open in IMG/M
3300017433\|Ga0182206_1070306	Not Available	653	Open in IMG/M
3300017436\|Ga0182209_1030085	Not Available	871	Open in IMG/M
3300017436\|Ga0182209_1045780	Not Available	768	Open in IMG/M
3300017436\|Ga0182209_1088545	Not Available	626	Open in IMG/M
3300017436\|Ga0182209_1125750	Not Available	559	Open in IMG/M
3300017436\|Ga0182209_1142949	Not Available	536	Open in IMG/M
3300017438\|Ga0182191_1051848	Not Available	764	Open in IMG/M
3300017438\|Ga0182191_1173195	Not Available	512	Open in IMG/M
3300017442\|Ga0182221_1073060	Not Available	654	Open in IMG/M
3300017442\|Ga0182221_1074507	Not Available	650	Open in IMG/M
3300017442\|Ga0182221_1085861	Not Available	623	Open in IMG/M
3300017442\|Ga0182221_1096312	Not Available	601	Open in IMG/M
3300017681\|Ga0182226_1103802	Not Available	538	Open in IMG/M
3300017683\|Ga0182218_1031250	Not Available	814	Open in IMG/M
3300017683\|Ga0182218_1064969	Not Available	656	Open in IMG/M
3300017683\|Ga0182218_1102061	Not Available	571	Open in IMG/M
3300017683\|Ga0182218_1149577	Not Available	507	Open in IMG/M
3300017684\|Ga0182225_1083440	Not Available	596	Open in IMG/M
3300017684\|Ga0182225_1118376	Not Available	536	Open in IMG/M
3300017685\|Ga0182227_1074898	Not Available	630	Open in IMG/M
3300017685\|Ga0182227_1075495	Not Available	628	Open in IMG/M
3300017685\|Ga0182227_1108381	Not Available	547	Open in IMG/M
3300017685\|Ga0182227_1116422	Not Available	533	Open in IMG/M
3300017686\|Ga0182205_1036374	Not Available	837	Open in IMG/M
3300017686\|Ga0182205_1172010	Not Available	501	Open in IMG/M
3300017690\|Ga0182223_1049348	Not Available	649	Open in IMG/M
3300017690\|Ga0182223_1086860	Not Available	556	Open in IMG/M
3300025942\|Ga0207689_10580964	Not Available	942	Open in IMG/M
3300025942\|Ga0207689_11725766	Not Available	518	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	93.01%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.90%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.10%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	93.01%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.20%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.10%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.70%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	93.01%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.20%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.10%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.70%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	93.01%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.10%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.10%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.10%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.70%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070673_1013804001	3300005364	Switchgrass Rhizosphere	VTRVDGDSAHGGEDFVGDVVPATAVGKMTKQERNKDHSIKTKL*
Ga0068867_1009342142	3300005459	Miscanthus Rhizosphere	GTTVTRVDGDSAHGGEDFVGDVVSVTAVGKMTKQERNKDHSIKTKL*
Ga0105243_115569991	3300009148	Miscanthus Rhizosphere	VTRVDGDSGHGGADFVGDGVPATAVGKMTKQEWIKHHS
Ga0105243_121925651	3300009148	Miscanthus Rhizosphere	VTWVDGDRAHGGEDFIGDVVPATTVGKMTKQERNKDHGIK
Ga0105242_125372461	3300009176	Miscanthus Rhizosphere	RGATVTRVDGDSGHDGANVVGDGVSVTAVSKTTKQERIKHHSIETKL*
Ga0157378_117773001	3300013297	Miscanthus Rhizosphere	VTRVDGDSGHGGANFVSDGVSVTAVSKMTKQERIKHHSVETKL*
Ga0157377_110110661	3300014745	Miscanthus Rhizosphere	MRVDGDSGHGGANFVGDGVPVTVVSKTTKQERIKHHSVETKL*
Ga0157376_113895881	3300014969	Miscanthus Rhizosphere	VTWVDGDSAHGGEDFVGDVVPATAVGKMTKQERNKDHSIKTKL*
Ga0182122_10175931	3300015267	Miscanthus Phyllosphere	TWVDGESGHGRANFVGDGVSMTAVSKTTKQEWIKHHSVETKL*
Ga0182122_10480011	3300015267	Miscanthus Phyllosphere	VTRFDSDSDHGRADLIDDGVPATAVGKMTKQEQIKHYS
Ga0182154_10133572	3300015268	Miscanthus Phyllosphere	TRVDGDNGHGGANFVGDGVSVTAVSKTTKKERIKHHSIEMKL*
Ga0182154_10681601	3300015268	Miscanthus Phyllosphere	HGGANFINDGVPATAVGKMTKQEWIKYHSIETKL*
Ga0182113_10127711	3300015269	Miscanthus Phyllosphere	MVMRVDGDSGHGGADFVDDGVSVTVVGKLTKQEWIKHHII*
Ga0182113_10141472	3300015269	Miscanthus Phyllosphere	VTRFNNDSDHGGADFVGDGVPVTTVGKTTKEEWIKYHIIETKL*
Ga0182113_10616592	3300015269	Miscanthus Phyllosphere	VTRVDGDNGHGGADFVDDGVLASAVGKMTKQEWIKHHSIEMKL*
Ga0182188_10139361	3300015274	Miscanthus Phyllosphere	VTRVDGDSGHGGANFVGDGVLVTTVSKTTKQEQIKHHSVETKL*
Ga0182188_10178791	3300015274	Miscanthus Phyllosphere	MMTRVDGDSGHGGADFIDDGVTATTVGKTTKQQGIKHHGIETKP*
Ga0182188_10462441	3300015274	Miscanthus Phyllosphere	VTRVDGDSGHGGADFVDDGVLATVVGKTIKQEWIKYHSIETNL*
Ga0182172_10158232	3300015275	Miscanthus Phyllosphere	DSGHGGANFVGDGVSVTAVSKTTKQERIKHHSVKTKL*
Ga0182170_10335511	3300015276	Miscanthus Phyllosphere	VTRFDGGSDHGGADFVNDGVPMTAVGKMTKQEQIKHHRI*
Ga0182128_10235251	3300015277	Miscanthus Phyllosphere	VTRVDGDSGHGGANFVGDGVSVTAVSKMTKQERIKHHSIETKL*
Ga0182174_10386641	3300015279	Miscanthus Phyllosphere	MTRVDGDSGHGGANFVGDGVPATVVGKTTKQERIKHHSIETKL*
Ga0182174_10641121	3300015279	Miscanthus Phyllosphere	DSGHEGANFVDDGVSVTAVSKTTKQERIKHHSVETKL*
Ga0182160_10135961	3300015281	Miscanthus Phyllosphere	MVTRVDGDSGHGGADFVGDGVPVTTVSKTTKQEWIKHHSIEMKL*
Ga0182156_10382901	3300015283	Miscanthus Phyllosphere	MVTRVDGDSGHGGADFVGDGVPATAVGKMTKQEWIKHHSIEMKL*
Ga0182186_10222651	3300015285	Miscanthus Phyllosphere	MVTRVDGDSGHGGANFVGDGVSVTAMSKTTKQERIKHHSIETKL*
Ga0182186_10673361	3300015285	Miscanthus Phyllosphere	VTRVDGDSGHGGANFVVVGVLVTAVSKMTKQERIKHHSVETKL*
Ga0182176_10572662	3300015286	Miscanthus Phyllosphere	MVTRFDGDSDHGGADFVDDSVPATAVGKMTKQEQIKHHRI*
Ga0182171_10120301	3300015287	Miscanthus Phyllosphere	DSDHGGVDLVDDGVPATAVDKTTKQEWIKHYSIETKL*
Ga0182171_10169102	3300015287	Miscanthus Phyllosphere	NKTGRATVTRVDDDSSHGGANFVGDGVLVTAVSKTTKQERIKHHSVETKL*
Ga0182171_10375821	3300015287	Miscanthus Phyllosphere	ATVTRVDGDSAHGGEDFVGDVVPATAVGKITKQERNKDHSIKTKL*
Ga0182171_10616721	3300015287	Miscanthus Phyllosphere	ETGGATVTRVDGDRAHDGEDFIGDVVPATAVGKMTKQ*
Ga0182138_10794232	3300015289	Miscanthus Phyllosphere	MVTRVDGDSDHGGANFIGDGVSVTTVSKTTKQERIKHHSIETKL*
Ga0182141_10742621	3300015292	Miscanthus Phyllosphere	VTRVDDGANFIGDRVSVTAVSKTTKQERIKHHSVE
Ga0182141_10814462	3300015292	Miscanthus Phyllosphere	MVTRVDGDSAHGGEDFVDDVVPATAAGKMTKQERNKDHSIKTKL*
Ga0182126_10589601	3300015294	Miscanthus Phyllosphere	VTRVDGDSAHGGEDFVGDVVPATAVGKMTKEEWIKYHSIETML*
Ga0182175_10072502	3300015295	Miscanthus Phyllosphere	MVTRVDGDSGHGRADFIDDGAPMTAVGKMTKQEWIKHHNI*
Ga0182175_10376031	3300015295	Miscanthus Phyllosphere	VTWVDGDSGHGGADFVGDGVSVTAVSKTTKQEWIKHHIIETKL*
Ga0182157_10333571	3300015296	Miscanthus Phyllosphere	VTRVDGDSGHGGANFVGDGVSVTAVSKTTKQERIKHHSVETKL*
Ga0182157_10812891	3300015296	Miscanthus Phyllosphere	MVTLFDGDCDHGEVDLVDDGVPVTAVGKLTKKEWIKHHSI*
Ga0182106_10684671	3300015298	Miscanthus Phyllosphere	MRVDGDSGHGGANFVVVGVLVTAVSKMTKQERIKHHSIETKL*
Ga0182107_10196341	3300015299	Miscanthus Phyllosphere	GATVMRVDGDSGHGGANFVGDGVSMTAVSKTTKQERIKHHSVETKL*
Ga0182108_10361541	3300015300	Miscanthus Phyllosphere	ATSETGEATVTRFDGDNDHDGADFVDDGVPASVVGKTTKQEWIKHHSIETKL*
Ga0182108_10782521	3300015300	Miscanthus Phyllosphere	VTRVDGDSGHGGADFVDDGVLVTAEGKLTKQEWIKHHSN*
Ga0182108_11026191	3300015300	Miscanthus Phyllosphere	VTRVDDDSGHGGANFVGDRVSVTAMSKTTKEERINHYSVETK
Ga0182123_10489782	3300015303	Miscanthus Phyllosphere	VDGDSDHGGADFVGDGVPAIVVGKMTKQEWIKHHSIETKL*
Ga0182112_10256661	3300015304	Miscanthus Phyllosphere	SAHGGEDFVGDVVPATTVGKMTKQERNKDHSIKTKL*
Ga0182112_10357261	3300015304	Miscanthus Phyllosphere	VTRFNGDSDHGGADFVDDGVPATAVGKTTKQEWIKH
Ga0182112_10822421	3300015304	Miscanthus Phyllosphere	TQVDSDSAHGGEDFVGDVVPVTVVGKMTKQERNKDHSIKMKL*
Ga0182112_10849421	3300015304	Miscanthus Phyllosphere	MTRVDGDSGHGEAEIVGEGVPVTAVGKMTKQEWIKHHSI*
Ga0182158_10334812	3300015305	Miscanthus Phyllosphere	MRVDGDSGHGGAAFVGEGVPVTAVSKTTKQGRFKHHSIEMKL*
Ga0182158_10560031	3300015305	Miscanthus Phyllosphere	RVDGDRAHGGEDFVGDVVPATAVGKMTKQERNKDHSIKTKL*
Ga0182158_10586041	3300015305	Miscanthus Phyllosphere	TSETREAMVTRFDGDSDHGGADLVDDGVPVTAVGKMTKQEWIKHYSIETKL*
Ga0182142_10452231	3300015308	Miscanthus Phyllosphere	DGDSAHGGEDFVGDVVPATAVGKMTKQGRNKDHSIKTKL*
Ga0182142_10457741	3300015308	Miscanthus Phyllosphere	RVDGDSGHGGANFVDDGVLMTAVGKMTKQEWIKHHSI*
Ga0182142_10896481	3300015308	Miscanthus Phyllosphere	GATVTRVDGDSGHGGANFIGDGVLVTTVNKTTKQERIKHHSVETKL*
Ga0182140_10148561	3300015314	Miscanthus Phyllosphere	MRVDGDSGHGGANFVSDGVSVAAVSKTTKQERIKHRSIDTKL*
Ga0182127_10292952	3300015321	Miscanthus Phyllosphere	VTRVDGDSGHGGANFVGDGVSVTAVSKTTKQERIKHHSVEMKL*
Ga0182110_10278001	3300015322	Miscanthus Phyllosphere	VTRVDGDSGHGGANFVGDGVSVTAVSKTTKQEQIKHHSVEMKL*
Ga0182110_10447012	3300015322	Miscanthus Phyllosphere	MRVDGDSGHGGANFVVVGVLVTAVSKMTKQERIKHHSVETKL*
Ga0182129_10517372	3300015323	Miscanthus Phyllosphere	DGDSAHGGEDFIGDVVPATAVGKMTKQGRNKDHSIKTKL*
Ga0182129_10868962	3300015323	Miscanthus Phyllosphere	MVTRVDGDSGHEGANFVDDGVSVTAVSKTTKQERIKHHSVETKL*
Ga0182129_10875311	3300015323	Miscanthus Phyllosphere	VTRVDRDSGHGGADFVDDGVLVTAEGKLTKQEWIKHHSIKTKL*
Ga0182187_10548811	3300015341	Miscanthus Phyllosphere	VTWVDGDGGHSGADFVDDGVPVTAVGKTTKEEWIKYH
Ga0182187_11303671	3300015341	Miscanthus Phyllosphere	VTWGDDDSGHGGANFVGDGVSVTAVSKTTKQERIKHYRIETKP*
Ga0182187_11766771	3300015341	Miscanthus Phyllosphere	MTRVDGDSGHGEAEIVGEGVPATAVGKTTKQQWIKYHSIETKL*
Ga0182109_11300141	3300015342	Miscanthus Phyllosphere	GGATVTRVDGDSAHGGEDFVGDVVPATAVGKMTKQERNKDHSIKTKL*
Ga0182155_11275181	3300015343	Miscanthus Phyllosphere	VTRVDGDSGHGAANFVGNGVSVTAVSKTTKQERIKHHSVETKL*
Ga0182155_11612792	3300015343	Miscanthus Phyllosphere	MVTRVDGDSGHGGADFVGDGVPATAVGKTTKQEWIKHHSIETKL*
Ga0182155_12105712	3300015343	Miscanthus Phyllosphere	VTRVDGDSGHGGADFVDDGVPVTAVGKLTKKEWIKHHSI*
Ga0182189_10091312	3300015344	Miscanthus Phyllosphere	MVTRVDGDSGHGGANFVDDGVSVTAVSKTIKQVRIKHHYVKTKL*
Ga0182189_11685281	3300015344	Miscanthus Phyllosphere	VTRVDGDSGHGGADFIGDGVPGTAVSKTTKQERFKHHSIEMKL*
Ga0182139_10279712	3300015346	Miscanthus Phyllosphere	MRVDGDSGHGGADIIDDGVSATAVGKMTKQEWIKHHIIETKL*
Ga0182139_11216041	3300015346	Miscanthus Phyllosphere	MVTRVDGDSGHGGEDFVGDVVPATAVGKMTKQERNKDHIIKMKL*
Ga0182139_11414591	3300015346	Miscanthus Phyllosphere	MTRVDGDSGHGGANFVGDGVSVTAVSKTTKQEQIK
Ga0182139_11647021	3300015346	Miscanthus Phyllosphere	MVTRVDGDSGHDGADFVDDGVPMTVVGKITKQEWIKQNNI*
Ga0182177_11534881	3300015347	Miscanthus Phyllosphere	VTQVDSDSGHGGADFVDDGVPATAVGKTTKQEWIKHHSIEMKL*
Ga0182177_11692191	3300015347	Miscanthus Phyllosphere	ETGGVTVTRVDGDNGHGGANFVGDGVSVTAVSKTTKQERIKHHNVETKL*
Ga0182177_11945951	3300015347	Miscanthus Phyllosphere	MVTRFDGDSDHGGADLVDDGVSVTVVGKTTKQEWIKHYSMKMKL*
Ga0182161_10486891	3300015351	Miscanthus Phyllosphere	VTRVDDDSGHGGANFVGDRVSVTAMSKTTKEERINHHSVETKL*
Ga0182161_10981491	3300015351	Miscanthus Phyllosphere	NKTGGATVTRVDGDSGHGGANFIGDGVSVTAVSKTTKQEQIKHHSVEMKL*
Ga0182161_11097891	3300015351	Miscanthus Phyllosphere	GEATVMRFDGDSDHGGADFVDDGVSVTAVGKMTKQ*
Ga0182161_12172432	3300015351	Miscanthus Phyllosphere	VTRVDGDSGHGGADFVDNGVSVTAVGKLTKQEWIKQNNI*
Ga0182161_12568612	3300015351	Miscanthus Phyllosphere	MVTRVDGDSGHGGADFVDDGVPATTVGKITKQEWIKHHSIEMKL*
Ga0182159_11644361	3300015355	Miscanthus Phyllosphere	MVTRVDGDSGHGGADFVGDGVSVTAVSKTTKQERIKHHSIETKL*
Ga0182159_13544742	3300015355	Miscanthus Phyllosphere	GHGGADFIGDGVPVIAVSKTTKQERIKHHSIETKL*
Ga0182145_10688992	3300015361	Miscanthus Phyllosphere	VTWVDGDSGHGGVDFVGDGVPATIVGKTTKQEWIKHHSIEMKL*
Ga0182203_10846062	3300017404	Miscanthus Phyllosphere	VTRVDGDSGHGGANFIGDGVSVTAVSKTTKQERIKHHSVETKL
Ga0182203_11151071	3300017404	Miscanthus Phyllosphere	VTRVDGDSGHGGADFVDDGVPVTAVGKLTKKEWIKHHSI
Ga0182203_11258561	3300017404	Miscanthus Phyllosphere	ATVTRVDGDSGHGAANFVGDGVSVTAVSKTTKQERIKHHSVKTKL
Ga0182220_10497711	3300017407	Miscanthus Phyllosphere	VTRVDGDSVHGGADFVGDGVPVIAVSKMTKQERIKHHSVETKL
Ga0182204_10139062	3300017409	Miscanthus Phyllosphere	VTRVDGDSGHGGADFIDDGVPVTAVGKLTKKEWIKHHSI
Ga0182204_10849752	3300017409	Miscanthus Phyllosphere	MVTRVDGDSGHGGANFVDDGVSVTAVSKTIKQVRIKHHYVKTKL
Ga0182207_10883741	3300017410	Miscanthus Phyllosphere	MRVDGDSGHGGADFVDDGVLAAAVGKTTKHEWIKHHSI
Ga0182208_10647541	3300017411	Miscanthus Phyllosphere	MRVDGDSGHGRANFVGDGVSVTAVSKTTKQEWIKHHSVETKL
Ga0182208_10687361	3300017411	Miscanthus Phyllosphere	DSGHGRANFVGDGVSVTAVSKTTKQEWIKHHSIETKL
Ga0182222_10730111	3300017413	Miscanthus Phyllosphere	MRVDGDSGHGGADFVDNGVSVTAVGKMTKQEWIKHHSI
Ga0182222_10822221	3300017413	Miscanthus Phyllosphere	MVTRVDGDSGHGGANFVGDGVSVTAVSKMTKPERIKHHSVETKL
Ga0182222_10910301	3300017413	Miscanthus Phyllosphere	VTRVDGDSGHGGADFVGDGVLVIAVSKMTKQERIKHHSVETKL
Ga0182202_10738292	3300017415	Miscanthus Phyllosphere	DSGHGGANFIGDRVSVTAVSKTTKQEWIKHHSVKTKL
Ga0182202_10810981	3300017415	Miscanthus Phyllosphere	VKRVDGDSGHGGADFVGDGVSVTAVGKTTKQEWIKHHSIETKL
Ga0182202_11038601	3300017415	Miscanthus Phyllosphere	VTRVDGDSGHGGADFVDDGVPATAVGKTTKQEWIKHHSIEMKL
Ga0182219_10442953	3300017424	Miscanthus Phyllosphere	TRVDGDSAHGGEDFVGDVVPATAVGKMTKQERNKDHSIKTKL
Ga0182219_10677951	3300017424	Miscanthus Phyllosphere	NETGGTTVTRVDGDSAHGGEDFVGDVVPTTAVGKMTKQERNKDHSIKTKL
Ga0182219_10938161	3300017424	Miscanthus Phyllosphere	VDGDSGHGGADFVDDGVPVTAVGKLTKKEWIKHHSI
Ga0182219_11016081	3300017424	Miscanthus Phyllosphere	AKNETGGTTVTRVDGDSAHGGEDFVGDVVPATAVGKMTKQERNKDHNIKTKL
Ga0182224_10195132	3300017425	Miscanthus Phyllosphere	VTRVDDDSGHGGANFVGDGVSVTAVSKTTKQEWIKHHSVEMKL
Ga0182224_10269721	3300017425	Miscanthus Phyllosphere	VTRVDGDSAHGGEDFVGDVVPATAVGKMTKQERNKDHSIKTKL
Ga0182224_10328152	3300017425	Miscanthus Phyllosphere	VTRVDGDCGHGRADFVDDGVPVTVVGKTTKQEWIKHHSI
Ga0182190_10914221	3300017427	Miscanthus Phyllosphere	NETGGTTVTRVDGDSAHGGEDFVGDVVPATAVGKMTKQEQNKDHSIKTKL
Ga0182192_11033221	3300017430	Miscanthus Phyllosphere	VTRFDSDSDHGRADLIDDGVPATAVGKMTKQEQIK
Ga0182192_11130572	3300017430	Miscanthus Phyllosphere	ETGEATVTRVDGDSDHGGADFIGDGVSTTAVGKTTKQEWIKHHNIETKL
Ga0182206_10353561	3300017433	Miscanthus Phyllosphere	GTTVTRVDGDCAHGGEDFVGDVVPVTVVGKMTKQERNKDHSIKTKL
Ga0182206_10703061	3300017433	Miscanthus Phyllosphere	VTRVDGDSGHGGADFIGDGVPVIAVSKTTKQERIKHHSVEMKL
Ga0182209_10300851	3300017436	Miscanthus Phyllosphere	MVTRVDGDSSHGGAGFVDDGVPVTAVGKMTKQEWIKHYSIKTKP
Ga0182209_10457801	3300017436	Miscanthus Phyllosphere	TMVTRFDGDSDHGGADFVDDSVPATAVGKMTKQEQIKHHRI
Ga0182209_10885451	3300017436	Miscanthus Phyllosphere	SAHGGEDFVGDVVPATTVGKMTKQERNKDHSIKAKL
Ga0182209_11257501	3300017436	Miscanthus Phyllosphere	VTRFDDDSDHGGANFVGDGDSVTAVSKTTKQERIKHHSVKMKL
Ga0182209_11429491	3300017436	Miscanthus Phyllosphere	VTRVDGDSAHGGEDFVGDVVPATAVGKMTKQERNKDHSVKTKL
Ga0182191_10518482	3300017438	Miscanthus Phyllosphere	GDSAHGGEDFVGDVVPATAVGEMTKQGRNKDHSIKMKL
Ga0182191_11731952	3300017438	Miscanthus Phyllosphere	VTRVDGGSGHDGADFVDDGVPATAVGKTTKQEWIKHHSI
Ga0182221_10730602	3300017442	Miscanthus Phyllosphere	MTRVDGDSGHGEAEIVGEGVPETAVGKTTKQQRIKYHSIEAKP
Ga0182221_10745071	3300017442	Miscanthus Phyllosphere	VTRVDGDSGHGGADFVGDGVPTTAVGKMTKQEWIKHYSIETKL
Ga0182221_10830281	3300017442	Miscanthus Phyllosphere	RWVDVHSGHGEAEIVGEGVPATDVGKMTKQQRIKYHSIETKP
Ga0182221_10858611	3300017442	Miscanthus Phyllosphere	MTWVDGDSGHGGADFVGDGVLVTVVSKMTKKERIKHHSVETKL
Ga0182221_10963121	3300017442	Miscanthus Phyllosphere	VTRVDGDSGHGGADFIDDGVPSTAVGKTTKKEWIKHHSIETKL
Ga0182226_11038021	3300017681	Miscanthus Phyllosphere	VTWVDGDSEHGGADFVGDGVPMTAVSKMTKQEWIKHHSVETKL
Ga0182218_10312502	3300017683	Miscanthus Phyllosphere	MVTRFDGDSDHGGADFVDDSVPATAVGKMTKQEQIKHHRIETKL
Ga0182218_10649692	3300017683	Miscanthus Phyllosphere	GDCAHGGEDFVGDVVSATAVGKMIKQERNKDHSIKTKL
Ga0182218_11020611	3300017683	Miscanthus Phyllosphere	ATSETGEATVTRFDGDSDHGGADFVDDGVLATAVGKMTKQEWIKHHNIETKL
Ga0182218_11495771	3300017683	Miscanthus Phyllosphere	VTRVDDDSGHGGANFVGDGDSVTAVSKMTKQERIKHH
Ga0182225_10834402	3300017684	Miscanthus Phyllosphere	VTWVDGESGHGRANFVGDGVSMTAVSKTTKQEWIKHHSVETKL
Ga0182225_11183761	3300017684	Miscanthus Phyllosphere	VTRFDGDSDHGGADFVDDGVPATTMGKTTKQERIK
Ga0182227_10748981	3300017685	Miscanthus Phyllosphere	VTRVDGDSGHGGADFIDDGVPATAVGKMSKQERNKHYSIEMKL
Ga0182227_10754952	3300017685	Miscanthus Phyllosphere	VTWVDGDSGHGGADFVDDGVPVTVVGKTTKQEWIKHHSI
Ga0182227_11083812	3300017685	Miscanthus Phyllosphere	TGGATMTRVDGDSGHGGANFVGDGVSVSAVSKTTKQERINYHSVETKL
Ga0182227_11164221	3300017685	Miscanthus Phyllosphere	DSGHGGANFVGDGVSVTAVSKMTKQERIKHHSVETKL
Ga0182205_10363742	3300017686	Miscanthus Phyllosphere	MVTRVDGDSSHGGANFVGDGVSVTAMSKTTKEERINHHSVETKL
Ga0182205_11720101	3300017686	Miscanthus Phyllosphere	GGTTVTRVDGDSAHGGEDFIGNVVPPTAVGKMTKQERNKDHSIKTKL
Ga0182223_10493481	3300017690	Miscanthus Phyllosphere	VTRFDGDSDHDGADFVDDGVPTTVVGKMTKQEQIKHHRIEMKL
Ga0182223_10868601	3300017690	Miscanthus Phyllosphere	TRFDGDSDHGGADFVDDGVPVTVVGKTTKQEWIKHHSI
Ga0207689_105809641	3300025942	Miscanthus Rhizosphere	MVTRVDGDSGHGGANFVGDGVSVTAVSKTTKQERIKHHSVETKL
Ga0207689_117257661	3300025942	Miscanthus Rhizosphere	VTRVDGDSGHSGADFVDDGVLATAVGKMTKQEWIKHHSIEMKL

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F051647

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences