| Basic Information | |
|---|---|
| Family ID | F051570 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSFFDTLKKGFGFVLLSMGVSRPAPKPKPETKPAPKAGSSE |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.31 % |
| % of genes near scaffold ends (potentially truncated) | 17.36 % |
| % of genes from short scaffolds (< 2000 bps) | 55.56 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.028 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (18.750 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.833 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (44.444 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 21.74% β-sheet: 0.00% Coil/Unstructured: 78.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF13442 | Cytochrome_CBB3 | 39.58 |
| PF00664 | ABC_membrane | 18.75 |
| PF08502 | LeuA_dimer | 3.47 |
| PF05683 | Fumerase_C | 2.08 |
| PF03544 | TonB_C | 1.39 |
| PF10518 | TAT_signal | 1.39 |
| PF00216 | Bac_DNA_binding | 0.69 |
| PF08530 | PepX_C | 0.69 |
| PF09604 | Potass_KdpF | 0.69 |
| PF02517 | Rce1-like | 0.69 |
| PF05192 | MutS_III | 0.69 |
| PF12543 | DUF3738 | 0.69 |
| PF16499 | Melibiase_2 | 0.69 |
| PF13744 | HTH_37 | 0.69 |
| PF09335 | SNARE_assoc | 0.69 |
| PF07007 | LprI | 0.69 |
| PF16576 | HlyD_D23 | 0.69 |
| PF07859 | Abhydrolase_3 | 0.69 |
| PF10632 | Obsolete Pfam Family | 0.69 |
| PF12680 | SnoaL_2 | 0.69 |
| PF01116 | F_bP_aldolase | 0.69 |
| PF00488 | MutS_V | 0.69 |
| PF12802 | MarR_2 | 0.69 |
| PF05368 | NmrA | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG0119 | Isopropylmalate/homocitrate/citramalate synthases | Amino acid transport and metabolism [E] | 3.47 |
| COG1838 | Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain | Energy production and conversion [C] | 2.08 |
| COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 1.39 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.39 |
| COG0191 | Fructose/tagatose bisphosphate aldolase | Carbohydrate transport and metabolism [G] | 0.69 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.69 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.69 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.69 |
| COG1193 | dsDNA-specific endonuclease/ATPase MutS2 | Replication, recombination and repair [L] | 0.69 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.69 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.69 |
| COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 0.69 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.03 % |
| Unclassified | root | N/A | 15.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10000650 | All Organisms → cellular organisms → Bacteria | 26632 | Open in IMG/M |
| 3300001398|JGI20207J14881_1019353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum | 1706 | Open in IMG/M |
| 3300001401|JGI20189J14885_1005383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2310 | Open in IMG/M |
| 3300005541|Ga0070733_10517841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 798 | Open in IMG/M |
| 3300005602|Ga0070762_11172146 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300009518|Ga0116128_1010760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3283 | Open in IMG/M |
| 3300009518|Ga0116128_1031059 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
| 3300009519|Ga0116108_1050549 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300009549|Ga0116137_1014628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3081 | Open in IMG/M |
| 3300009623|Ga0116133_1011238 | All Organisms → cellular organisms → Bacteria | 2215 | Open in IMG/M |
| 3300009623|Ga0116133_1060013 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300009632|Ga0116102_1178965 | Not Available | 575 | Open in IMG/M |
| 3300009635|Ga0116117_1028112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1399 | Open in IMG/M |
| 3300009643|Ga0116110_1062116 | Not Available | 1318 | Open in IMG/M |
| 3300009644|Ga0116121_1207223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 624 | Open in IMG/M |
| 3300009645|Ga0116106_1021512 | All Organisms → cellular organisms → Bacteria | 2261 | Open in IMG/M |
| 3300009665|Ga0116135_1365242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 580 | Open in IMG/M |
| 3300010339|Ga0074046_10003941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 12223 | Open in IMG/M |
| 3300010341|Ga0074045_10027650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4329 | Open in IMG/M |
| 3300010379|Ga0136449_101236056 | Not Available | 1172 | Open in IMG/M |
| 3300010379|Ga0136449_101280690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa | 1145 | Open in IMG/M |
| 3300014151|Ga0181539_1012446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5446 | Open in IMG/M |
| 3300014152|Ga0181533_1002827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 19677 | Open in IMG/M |
| 3300014153|Ga0181527_1292241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 645 | Open in IMG/M |
| 3300014156|Ga0181518_10061046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 2211 | Open in IMG/M |
| 3300014158|Ga0181521_10032885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3905 | Open in IMG/M |
| 3300014158|Ga0181521_10372790 | Not Available | 710 | Open in IMG/M |
| 3300014160|Ga0181517_10005017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 11851 | Open in IMG/M |
| 3300014160|Ga0181517_10018638 | All Organisms → cellular organisms → Bacteria | 4887 | Open in IMG/M |
| 3300014160|Ga0181517_10042442 | All Organisms → cellular organisms → Bacteria | 2857 | Open in IMG/M |
| 3300014160|Ga0181517_10133552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 1410 | Open in IMG/M |
| 3300014161|Ga0181529_10288200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 921 | Open in IMG/M |
| 3300014161|Ga0181529_10337747 | Not Available | 830 | Open in IMG/M |
| 3300014169|Ga0181531_10031111 | All Organisms → cellular organisms → Bacteria | 3080 | Open in IMG/M |
| 3300014169|Ga0181531_10225911 | Not Available | 1139 | Open in IMG/M |
| 3300014169|Ga0181531_10814874 | Not Available | 582 | Open in IMG/M |
| 3300014200|Ga0181526_10484708 | Not Available | 783 | Open in IMG/M |
| 3300014201|Ga0181537_10027244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 3965 | Open in IMG/M |
| 3300014201|Ga0181537_10096480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2010 | Open in IMG/M |
| 3300014201|Ga0181537_10280071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1145 | Open in IMG/M |
| 3300014491|Ga0182014_10005227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14523 | Open in IMG/M |
| 3300014491|Ga0182014_10005555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 13961 | Open in IMG/M |
| 3300014491|Ga0182014_10007747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11167 | Open in IMG/M |
| 3300014491|Ga0182014_10019304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 5882 | Open in IMG/M |
| 3300014498|Ga0182019_10068428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2099 | Open in IMG/M |
| 3300014501|Ga0182024_10009795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 19717 | Open in IMG/M |
| 3300014501|Ga0182024_10238485 | All Organisms → cellular organisms → Bacteria | 2449 | Open in IMG/M |
| 3300014501|Ga0182024_11647676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 725 | Open in IMG/M |
| 3300014838|Ga0182030_10001741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 45369 | Open in IMG/M |
| 3300014839|Ga0182027_10968509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus roseus | 874 | Open in IMG/M |
| 3300014839|Ga0182027_11406870 | Not Available | 690 | Open in IMG/M |
| 3300016700|Ga0181513_1160940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 827 | Open in IMG/M |
| 3300016730|Ga0181515_1104289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 754 | Open in IMG/M |
| 3300016750|Ga0181505_10438007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 781 | Open in IMG/M |
| 3300017929|Ga0187849_1218042 | Not Available | 738 | Open in IMG/M |
| 3300017931|Ga0187877_1015393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 4398 | Open in IMG/M |
| 3300017935|Ga0187848_10045177 | All Organisms → cellular organisms → Bacteria | 2145 | Open in IMG/M |
| 3300017935|Ga0187848_10251276 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300017938|Ga0187854_10165074 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300017940|Ga0187853_10113572 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300017948|Ga0187847_10006048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 8568 | Open in IMG/M |
| 3300017948|Ga0187847_10095496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1643 | Open in IMG/M |
| 3300017970|Ga0187783_10051188 | All Organisms → cellular organisms → Bacteria | 3047 | Open in IMG/M |
| 3300017972|Ga0187781_10004326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10599 | Open in IMG/M |
| 3300017988|Ga0181520_10011403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 11684 | Open in IMG/M |
| 3300017988|Ga0181520_10029466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5820 | Open in IMG/M |
| 3300017988|Ga0181520_10093081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 2614 | Open in IMG/M |
| 3300017988|Ga0181520_10264504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1307 | Open in IMG/M |
| 3300017988|Ga0181520_10964627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 566 | Open in IMG/M |
| 3300017996|Ga0187891_1147003 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300018004|Ga0187865_1084964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 1185 | Open in IMG/M |
| 3300018005|Ga0187878_1316140 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300018014|Ga0187860_1237999 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300018016|Ga0187880_1050634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2222 | Open in IMG/M |
| 3300018020|Ga0187861_10205831 | Not Available | 877 | Open in IMG/M |
| 3300018021|Ga0187882_1233682 | Not Available | 715 | Open in IMG/M |
| 3300018034|Ga0187863_10048550 | All Organisms → cellular organisms → Bacteria | 2435 | Open in IMG/M |
| 3300018038|Ga0187855_10016142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 4937 | Open in IMG/M |
| 3300018042|Ga0187871_10314417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 866 | Open in IMG/M |
| 3300018043|Ga0187887_10218991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1130 | Open in IMG/M |
| 3300018043|Ga0187887_10285129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 976 | Open in IMG/M |
| 3300018046|Ga0187851_10006338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9232 | Open in IMG/M |
| 3300018046|Ga0187851_10168379 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300018046|Ga0187851_10751348 | Not Available | 549 | Open in IMG/M |
| 3300018062|Ga0187784_10721881 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300018086|Ga0187769_10072950 | All Organisms → cellular organisms → Bacteria | 2424 | Open in IMG/M |
| 3300019082|Ga0187852_1005322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 8273 | Open in IMG/M |
| 3300021181|Ga0210388_11336987 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300021432|Ga0210384_10324390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1387 | Open in IMG/M |
| 3300022524|Ga0224534_1058004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 772 | Open in IMG/M |
| 3300023068|Ga0224554_1000276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 45497 | Open in IMG/M |
| 3300023088|Ga0224555_1029048 | All Organisms → cellular organisms → Bacteria | 2388 | Open in IMG/M |
| 3300023090|Ga0224558_1080807 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300023090|Ga0224558_1196164 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300025473|Ga0208190_1006505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3117 | Open in IMG/M |
| 3300025574|Ga0208717_1008774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 3023 | Open in IMG/M |
| 3300025664|Ga0208849_1000293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 48680 | Open in IMG/M |
| 3300027567|Ga0209115_1092549 | Not Available | 687 | Open in IMG/M |
| 3300027625|Ga0208044_1010556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3565 | Open in IMG/M |
| 3300027867|Ga0209167_10394342 | Not Available | 754 | Open in IMG/M |
| 3300027905|Ga0209415_10028301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8213 | Open in IMG/M |
| 3300028082|Ga0255352_1035161 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300029889|Ga0246001_1070211 | Not Available | 689 | Open in IMG/M |
| 3300031235|Ga0265330_10003451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8255 | Open in IMG/M |
| 3300031525|Ga0302326_13365738 | Not Available | 535 | Open in IMG/M |
| 3300031708|Ga0310686_104647489 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300031708|Ga0310686_104896566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 15272 | Open in IMG/M |
| 3300031708|Ga0310686_113246693 | Not Available | 1450 | Open in IMG/M |
| 3300031708|Ga0310686_117645826 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300032770|Ga0335085_10000213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 181624 | Open in IMG/M |
| 3300032783|Ga0335079_11318751 | Not Available | 720 | Open in IMG/M |
| 3300032805|Ga0335078_10092068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 4395 | Open in IMG/M |
| 3300032805|Ga0335078_10646490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 1323 | Open in IMG/M |
| 3300032805|Ga0335078_10956813 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300032805|Ga0335078_12110952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 598 | Open in IMG/M |
| 3300032805|Ga0335078_12606691 | Not Available | 518 | Open in IMG/M |
| 3300032893|Ga0335069_10015063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10814 | Open in IMG/M |
| 3300032895|Ga0335074_10059637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 5211 | Open in IMG/M |
| 3300032895|Ga0335074_10744842 | Not Available | 930 | Open in IMG/M |
| 3300032896|Ga0335075_10914305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 802 | Open in IMG/M |
| 3300032898|Ga0335072_10370071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1556 | Open in IMG/M |
| 3300033134|Ga0335073_10102109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3705 | Open in IMG/M |
| 3300033134|Ga0335073_10680675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1129 | Open in IMG/M |
| 3300033134|Ga0335073_11214376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 755 | Open in IMG/M |
| 3300033402|Ga0326728_10005157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 37415 | Open in IMG/M |
| 3300033402|Ga0326728_10008307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 25894 | Open in IMG/M |
| 3300033402|Ga0326728_10009142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 24031 | Open in IMG/M |
| 3300033402|Ga0326728_10022027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11887 | Open in IMG/M |
| 3300033402|Ga0326728_10028173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 9757 | Open in IMG/M |
| 3300033402|Ga0326728_10047080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 6451 | Open in IMG/M |
| 3300033402|Ga0326728_10138502 | All Organisms → cellular organisms → Bacteria | 2698 | Open in IMG/M |
| 3300033402|Ga0326728_10190651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2094 | Open in IMG/M |
| 3300033402|Ga0326728_10651940 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300033402|Ga0326728_10751319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 720 | Open in IMG/M |
| 3300033405|Ga0326727_10183704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 2344 | Open in IMG/M |
| 3300033405|Ga0326727_10492792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 1071 | Open in IMG/M |
| 3300033405|Ga0326727_10701690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 808 | Open in IMG/M |
| 3300033405|Ga0326727_10821692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 712 | Open in IMG/M |
| 3300033977|Ga0314861_0379136 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300033983|Ga0371488_0183197 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300034091|Ga0326724_0125974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 1628 | Open in IMG/M |
| 3300034091|Ga0326724_0131020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1585 | Open in IMG/M |
| 3300034091|Ga0326724_0619503 | Not Available | 536 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 18.75% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 16.67% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 12.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 9.03% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 4.17% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.47% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 3.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.78% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.78% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.78% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.08% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.08% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.39% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.39% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.69% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.69% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.69% |
| Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001398 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 | Environmental | Open in IMG/M |
| 3300001401 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016700 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300022524 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24 | Environmental | Open in IMG/M |
| 3300023068 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24 | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025574 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow (SPAdes) | Environmental | Open in IMG/M |
| 3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028082 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T0 | Environmental | Open in IMG/M |
| 3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_1000065011 | 3300000567 | Peatlands Soil | MSVLDLLKKGFGYFLLSMGVSRPIPKPKPAQKPAPKDEPGR* |
| JGI20207J14881_10193532 | 3300001398 | Arctic Peat Soil | MNIIDLLRKGFGYVLLSMGVSRPATRLKSKPKAKSAPDPESDSPSN* |
| JGI20189J14885_10053832 | 3300001401 | Arctic Peat Soil | MNIIDLLRKGFGYVLLSMGVSRPAARPKSKSEVKAAPDPESDSPSI* |
| Ga0070733_105178412 | 3300005541 | Surface Soil | MSFLEMLKKGLGYVLLSMGVSRPAAKAKPEAKPASKP* |
| Ga0070762_111721461 | 3300005602 | Soil | MSVLDWLRKGFGYVLLSMGVSRPESRPTPSAKPSSEPAPKPKAD* |
| Ga0116128_10107602 | 3300009518 | Peatland | MSLTDLIRKGFGYVLLSMGVSRPAPKPKPESKPESKPESGGQSK* |
| Ga0116128_10310593 | 3300009518 | Peatland | LQNGKDAMSFFDVLKKGLGYVLLSMGVSRPAPKPKQETKPAPKVGTGE* |
| Ga0116108_10505491 | 3300009519 | Peatland | NGKEWEEFMSLVDWLRKGFGYVLLSMGVSRPAPKPKPAAKPAPKSESGGQSN* |
| Ga0116137_10146284 | 3300009549 | Peatland | MSLADLLRKGFGYLLLSMGVSRPVPKPKAETKPAPPKAAPGG* |
| Ga0116133_10112382 | 3300009623 | Peatland | MSLVDWLRKGFGYVLLSMGVSRPAPKPKPAAKPAPKSESGGQSN* |
| Ga0116133_10600132 | 3300009623 | Peatland | MKVMDWLRKGFGYVLLSMGVSRPAPKPRPASKPASKSESGGQSN* |
| Ga0116102_11789651 | 3300009632 | Peatland | MSFLDTLKKGFGFVLLSMGVSRPAPKPKPETKPAAKAGAGE* |
| Ga0116117_10281121 | 3300009635 | Peatland | MKVMDWLRKGFGYVLLSMGVSRPAPKPRPASKPASKSESGGQS |
| Ga0116110_10621161 | 3300009643 | Peatland | MSFLDTLKKGFGFVLLSMGVSRPAPKPKTETKPAPKAGPGE* |
| Ga0116121_12072232 | 3300009644 | Peatland | MSFFDTLKKGFGYVLLSMGVSRPTAKPKPETKPAPKTRPGE* |
| Ga0116106_10215122 | 3300009645 | Peatland | MSFLDTLKKGFGFVLLSMGVSRPTPKPKPETKPAAKAGSGE* |
| Ga0116135_13652422 | 3300009665 | Peatland | MSFFDVLKKGLGYVLLSMGVSRPAPKPKQETKPAPKVGT |
| Ga0074046_100039414 | 3300010339 | Bog Forest Soil | MSLVDTLKKGFGFVLLSMGVSRPTPKPKPETKPAAKAGSGE* |
| Ga0074045_100276503 | 3300010341 | Bog Forest Soil | MRLIEWMRKGFGYVLLSMGVSRPAPKPKPEAKPGPKSNTGE* |
| Ga0136449_1012360562 | 3300010379 | Peatlands Soil | MSVLDLLRKGFGYFLLSMGVSRPAPKPETKPVSKPERRE* |
| Ga0136449_1012806902 | 3300010379 | Peatlands Soil | MRLIDWLRKAFGYVLLSMGVSRPTPKPKPQAKPAPKHGADE* |
| Ga0181539_10124464 | 3300014151 | Bog | MSFFDQLKKGFGYVLLSMGVSRPTAKPKPETKPAPKTRPGE* |
| Ga0181533_10028276 | 3300014152 | Bog | MSFFDTLKKGFGFVLLSMGVSRPAPKPKIETKPAPKAGPGE* |
| Ga0181527_12922412 | 3300014153 | Bog | MSFYDLLKKGFGYVLLSMGVSRPAPKPRPETKPLPKTRSGE* |
| Ga0181518_100610462 | 3300014156 | Bog | MSFFDALKKGFGFVLLSMGVSRPTPKPKPETKPAAKAGSGE* |
| Ga0181521_100328853 | 3300014158 | Bog | MSLVDALKKGLGFVLLSMGVSRPTPKPKPETKPEAKAGAGE* |
| Ga0181521_103727901 | 3300014158 | Bog | MSFFDVLKKGFGFVLLSMGVSRPAPKSKPESKPAPKGGSGE* |
| Ga0181517_100050178 | 3300014160 | Bog | MSVFDLLKKGFGFVLLSMGVSRPAPKPKAETKAAPKASSGAGPP* |
| Ga0181517_100186385 | 3300014160 | Bog | MRILELLKKGFGFVLLSMGVSRPAPKPKPESKPAPKAESGE* |
| Ga0181517_100424422 | 3300014160 | Bog | MSFIDTLKKGFGFVLLSMGVSRPTPKPKPAARPAPKAGSGE* |
| Ga0181517_101335522 | 3300014160 | Bog | MSFFDALKKGFGFVLLSMGVSRPTPKPKPGTKPAAKAGSGE* |
| Ga0181529_102882002 | 3300014161 | Bog | MKVFDLLRKGFGYVLLSMGVSRPAPKPKAETKPAPKPESGA* |
| Ga0181529_103377471 | 3300014161 | Bog | MRILELLKKGFGFVLLSFGVSRPKPKAKPETRAAPKAESGE* |
| Ga0181531_100311111 | 3300014169 | Bog | SVGLMDTLKKGFGFVLLSFGVSRPAPKPKPETKPAPKADPGSRQS* |
| Ga0181531_102259111 | 3300014169 | Bog | MDTLKKGFGFVLLSFGVSRPAPKPKPETKPAPKADP |
| Ga0181531_108148741 | 3300014169 | Bog | MDTLKKGFGFVLLSMGVSRPAPKPKPETKPGPKAGSAK* |
| Ga0181526_104847081 | 3300014200 | Bog | MKVFNLLRKGFGYVLLSMGVSRPAPKAKVEAKPAPKPEGGT* |
| Ga0181537_100272443 | 3300014201 | Bog | MDTLKKGFGFVLLSFGVSRPAPKPKPETKPAPKADPGSRQS* |
| Ga0181537_100964803 | 3300014201 | Bog | MKVLDLVRKGFGYVLLSMGVSRPAPKPKAEAKPTPKPEPGA* |
| Ga0181537_102800713 | 3300014201 | Bog | MDALKKGFGFVLLSMGVSRPAPKPKPETKPETKAGSAK* |
| Ga0182014_100052274 | 3300014491 | Bog | MSLSDLIRKGFGYVLLSMGVSRPAPKPKPETKPAPKARSTR* |
| Ga0182014_100055554 | 3300014491 | Bog | MSLVDTLKKGFGFVLLSMGVSRPIPKPKPETKPAAKAGSGE* |
| Ga0182014_100077477 | 3300014491 | Bog | MRILDLLKKGFGYVLLSMGVSRPTAKPKPESKPAPKSGAGE* |
| Ga0182014_100193045 | 3300014491 | Bog | MSFFDTLKKGFGFVLLSMGVSRPTPKPKPETKPAAKAGSGE* |
| Ga0182019_100684282 | 3300014498 | Fen | MSFFDTLKKGFGFVLLSMGVSRPAPKPKTETRPAPKAGPGE* |
| Ga0182024_100097954 | 3300014501 | Permafrost | MSFINTLKKGFGFVLLSMGVSRPAPKPKPAAKPMPKS* |
| Ga0182024_102384854 | 3300014501 | Permafrost | MDTLKKGLGFVLLSFGVSRPAPKPKPETKPAAKAGSGE* |
| Ga0182024_116476762 | 3300014501 | Permafrost | MKVFDLVRKGFGYVLLSMGVSRPAPKPKAEAKPSPKSEPGA* |
| Ga0182030_1000174111 | 3300014838 | Bog | MSLSDLIRKGFGYVLLSMGVSRPAPRPKPESKPEPKSDSGGQSK* |
| Ga0182027_109685091 | 3300014839 | Fen | AAQERKGSGTMSFFDTLKKGFGFVLLSMGVSRPTPKPKPETRPAAKAGPGE* |
| Ga0182027_114068702 | 3300014839 | Fen | MSVLDLLRKGFGYLLLSMGVSRPTPKQGAKPAPKPNRGA* |
| Ga0181513_11609401 | 3300016700 | Peatland | MRILELLKKGFGFVLLSMGVSRPAPKPKPESKPAPKAESGE |
| Ga0181515_11042892 | 3300016730 | Peatland | MSLVDALKKGLGFVLLSMGVSRPTPKPKPETKPEAKAGAGE |
| Ga0181505_104380072 | 3300016750 | Peatland | GSGAMSLVDALKKGLGFVLLSMGVSRPTPKPKPETKPEAKAGAGE |
| Ga0187849_12180422 | 3300017929 | Peatland | MSFLDTLKKGFGFVLLSMGVSRPAPKPKPETKPAAKAGAGE |
| Ga0187877_10153932 | 3300017931 | Peatland | MSLTDLIRKGFGYVLLSMGVSRPAPKPKPESKPESKPESGGQSK |
| Ga0187848_100451773 | 3300017935 | Peatland | MSFLDTLKKGFGFVLLSMGVSRPAPKPKTETKPAPKAGPGE |
| Ga0187848_102512762 | 3300017935 | Peatland | KEREAFMILADWLRKGFGYVLLSMGVSRPAPKLKPQSKPESKPGSGSQSN |
| Ga0187854_101650742 | 3300017938 | Peatland | MSFLDTLKKGFGFVLLSMGVSRPTPKPKPETKPAAKAGSGE |
| Ga0187853_101135721 | 3300017940 | Peatland | MSFFDALKKGFGFVLLSMGVSRPTPKPKPGTKPAAKAGSGE |
| Ga0187808_102988902 | 3300017942 | Freshwater Sediment | MKLLNLLRKGFGYVLLSMGVSRPAPKSKPQAPPVNPKHEG |
| Ga0187847_100060482 | 3300017948 | Peatland | LQNGKDAMSFFDVLKKGLGYVLLSMGVSRPAPKPKQETKPAPKVGTGE |
| Ga0187847_100954962 | 3300017948 | Peatland | MKVMDWLRKGFGYVLLSMGVSRPAPKPRPASKPASKSESGGQSN |
| Ga0187783_100511885 | 3300017970 | Tropical Peatland | MSLVDWLRKGFGYVLLTMGVSRPEPKAKTEPKPAPKPGSGE |
| Ga0187781_100043269 | 3300017972 | Tropical Peatland | MSIMNWLRKGFGYVLLSMGVSRPAPKPMPKPGSKSGGCA |
| Ga0181520_100114038 | 3300017988 | Bog | MSVFDLLKKGFGFVLLSMGVSRPAPKPKAETKAAPKASSGAGPP |
| Ga0181520_100294662 | 3300017988 | Bog | MKVLDLVRKGFGYVLLSMGVSRPAPKPKAEAKPTPKPEPGA |
| Ga0181520_100930812 | 3300017988 | Bog | MKVFDLLRKGFGYVLLSMGVSRPAPKPKAETKPAPKPESGA |
| Ga0181520_102645042 | 3300017988 | Bog | MKVFNLLRKGFGYVLLSMGVSRPAPKAKVEAKPAPKPEGGT |
| Ga0181520_109646272 | 3300017988 | Bog | MRILELLKKGFGFVLLSMGVSRPAPKPKPVAKPSAKAESGP |
| Ga0187891_11470032 | 3300017996 | Peatland | MSFFDTLKKGFGYVLLSMGVSRPTAKPKPETKPAPKTRPGE |
| Ga0187865_10849643 | 3300018004 | Peatland | MSLTDLIRKGFGYVLLSMGVSRPAPKPKPESKPESKPESGGQS |
| Ga0187878_13161402 | 3300018005 | Peatland | DFIRKGFGYVLLSMGVSRPAPKPRPASKPAPKSESGGQSN |
| Ga0187860_12379992 | 3300018014 | Peatland | DTLKKGFGYVLLSMGVSRPTAKPKPETKPAPKTRPGE |
| Ga0187880_10506343 | 3300018016 | Peatland | MSLADLLRKGFGYLLLSMGVSRPVPKPKAETKPAPPKAAPGG |
| Ga0187861_102058311 | 3300018020 | Peatland | KGSGTVSFFDTLKKGFGFVLLSMGVSRPAPKPRPETKPAPKAGPGK |
| Ga0187882_12336822 | 3300018021 | Peatland | MNVIDWLRKGFGYVLLSMGVSRPAPKPRPQSKPESPY |
| Ga0187863_100485503 | 3300018034 | Peatland | VNCELRTVVMSLMDWLRKGFGYVLLSMGVSRPAPKPKTETKPAPKAGTGE |
| Ga0187855_100161424 | 3300018038 | Peatland | MNLLDTLKKGFGFVLLSMGVSRPAPKPKPESKPAPKAGSGG |
| Ga0187871_103144172 | 3300018042 | Peatland | MSFLDTLKKGLGFVLLSFGVSRPKPKPKPETKSAAKADE |
| Ga0187887_102189913 | 3300018043 | Peatland | MSLVDWLRKGFGYVLLSMGVSRPAPKPRPASKPASKSESG |
| Ga0187887_102851292 | 3300018043 | Peatland | MSFLDTLKKGFGFVLLSFGVSRPKPKPKPETKPAAKADE |
| Ga0187851_100063383 | 3300018046 | Peatland | MSLMDWLRKGFGYVLLSMGVSRPAPKPKTETKPAPKAGTGE |
| Ga0187851_101683793 | 3300018046 | Peatland | MRILELLKKGFGFVLLSFGVSRPKPKAKPETRAAPKAESGE |
| Ga0187851_107513482 | 3300018046 | Peatland | ERKGSGTMSFLDTLKKGFGFVLLSMGVSRPTPKPKPETKPAAKAGSGE |
| Ga0187784_107218811 | 3300018062 | Tropical Peatland | MSVLELLRKGFGYLLLSIGVSRPLPKQGPKPAPKPNRGA |
| Ga0187769_100729502 | 3300018086 | Tropical Peatland | MSIVDWLRKGFGYVLLSMGVSRPGAKPKPEAKPAPKPGDGA |
| Ga0187852_10053223 | 3300019082 | Peatland | MSFFDALKKGFGYVLLSMGVSRPTAKPKPETKPAQKTGPGK |
| Ga0210388_113369872 | 3300021181 | Soil | MSFLDTLKKGFGFVLLSMGVSRPTPKPNAEAKPAPKAQSGE |
| Ga0210384_103243901 | 3300021432 | Soil | DALKKGFGFVLLSMGVSRPAPKPKPETKPAPKAGTGE |
| Ga0224534_10580042 | 3300022524 | Soil | MNAMDLLRKGFGFVLLSMGVSRPAPRPKPESKPEPKSDSGGQSK |
| Ga0224554_100027611 | 3300023068 | Soil | MSLSDLIRKGFGYVLLSMGVSRPAPRPKPESKPEPKSDSGGQSK |
| Ga0224555_10290482 | 3300023088 | Soil | MSFFDTLKKGFGFVLLSMGVSRPTPKPKPETKPAAKAGSGE |
| Ga0224558_10808072 | 3300023090 | Soil | MSLSDFIRKGFGYVLLSMGVSRPAPRPKPASKPEPKSESGGKSK |
| Ga0224558_11961641 | 3300023090 | Soil | MNAMDLLRKGFGFVLLSMGVSRPAPRPKPESKPEPKSESGGQSK |
| Ga0208190_10065052 | 3300025473 | Peatland | MSLVDWLRKGFGYVLLSMGVSRPAPKPKPAAKPAPKSESGGQSN |
| Ga0208717_10087742 | 3300025574 | Arctic Peat Soil | MNIIDLLRKGFGYVLLSMGVSRPATRLKSKPKAKSAPDPESDSPSN |
| Ga0208849_100029315 | 3300025664 | Arctic Peat Soil | MNIIDLLRKGFGYVLLSMGVSRPAARPKSKSEVKAAPDPESDSPSI |
| Ga0209115_10925492 | 3300027567 | Forest Soil | MGFLDTLRKGFGYVLLSMGVSRPAAKPKPASEPKPEPDSANRP |
| Ga0208044_10105564 | 3300027625 | Peatlands Soil | MSVLDLLKKGFGYFLLSMGVSRPIPKPKPAQKPAPKDEPGR |
| Ga0209167_103943422 | 3300027867 | Surface Soil | MSFLEMLKKGLGYVLLSMGVSRPAAKAKPEAKPASKP |
| Ga0209415_100283012 | 3300027905 | Peatlands Soil | MRLIDWLRKAFGYVLLSMGVSRPTPKPKPQAKPAPKHGADE |
| Ga0255352_10351611 | 3300028082 | Soil | VDTLKKGFGFVLLSMGVSRPIPKPKPETKPAAKAGSGE |
| Ga0246001_10702111 | 3300029889 | Peat | MSFFDTLKKGFGFVLLSMGVSRPTPKPKPGTKPAAKAGSGE |
| Ga0265330_100034515 | 3300031235 | Rhizosphere | MNVMDWLRKGFGFVLLSMGVSRPAPKPKLVAQPAPKPGGGSPGDRGDQTK |
| Ga0302326_133657381 | 3300031525 | Palsa | MKFFDLLGKGFGYVLMSMGVSRPTPKPEPASANAPKPKPGA |
| Ga0310686_1046474892 | 3300031708 | Soil | MSMMDLLRKGFGYVLLSMGVSRPRPKTEPAAKPAPKPKAGS |
| Ga0310686_10489656612 | 3300031708 | Soil | MGLLDLLKKGFGYVLLSMGVSRPQPKAKPAPESKPETGPESKSESRPDPGLNP |
| Ga0310686_1132466932 | 3300031708 | Soil | MSFLDTLKKGFGFVLLSVGVSRPTQKAKPETKPAPKAGSGE |
| Ga0310686_1176458262 | 3300031708 | Soil | MSVIDLLRKGFGYVLLSMGVSRPAARPKSKPEAKPAPDPKSDSPSN |
| Ga0335085_1000021352 | 3300032770 | Soil | MKLVEQLKKGFGFVLLSMGVSRPVPKPKTAEKPAPMDKPGQ |
| Ga0335079_113187512 | 3300032783 | Soil | MSLIDQLKKGFGYLLLSMGVSRPAPKPKPAEKPAPKQ |
| Ga0335078_100920682 | 3300032805 | Soil | MSFLATLKKGFGFVLLSMGVSRPTPKPKTETKPPAKSGSGE |
| Ga0335078_106464903 | 3300032805 | Soil | MSVLDLFRKGFGYVLLSMGVSRPAPQPKPKEKPEPKTGRNS |
| Ga0335078_109568131 | 3300032805 | Soil | MSLLDLLKKGFGYVLLSMGVSRPQPKPKPDAKPEPKSGAGA |
| Ga0335078_121109522 | 3300032805 | Soil | MSLIDTLKKGLGFVLLSFGVSRPAPKPKPQAKPAPKK |
| Ga0335078_126066912 | 3300032805 | Soil | MSVMDWLRKGFGYVLLTMGVSRPAPKPKPTPKSGARE |
| Ga0335069_100150638 | 3300032893 | Soil | MSLIDWLRKGFGYVLLSMGVSRPAPKTKVESKPGPDRAK |
| Ga0335074_100596375 | 3300032895 | Soil | MSFIDTLKKGFGFVLLSFGVSRPAPKPKPQTKPAPKAEPGE |
| Ga0335074_107448421 | 3300032895 | Soil | MSVFDLLKKGFGYVLLSMGVSRPTPKPKPARKPAAKDEPSQ |
| Ga0335075_109143051 | 3300032896 | Soil | MSVLDLLKKGFGYVLLSMGVSRPAPKPQAETKPAPKNGPSSIG |
| Ga0335072_103700713 | 3300032898 | Soil | MSVLDLLKKGFGYVLLSMGVSRPTPKQKPVAKPEPKETSTK |
| Ga0335073_101021091 | 3300033134 | Soil | MSVFDWLRKGFGYVLLSMGVSRPAPKPRPATSSSDPASDN |
| Ga0335073_106806751 | 3300033134 | Soil | MSVLDLLKKGFGYVLLSMGVSRPTPKPQAETKPAPKNGPSSIG |
| Ga0335073_112143762 | 3300033134 | Soil | MGVLDFLRKGLGYVLLSMGVSRPAPKAKPEEKPAPKSGSGA |
| Ga0326728_100051575 | 3300033402 | Peat Soil | MSFFDVLKKGLGFVLLSMGVSRPAPKPKPETKPAPKAGPSE |
| Ga0326728_1000830723 | 3300033402 | Peat Soil | MRIFDLLKKGFGYVLLSMGVSRPTAKPKPETKPAPKTGPG |
| Ga0326728_1000914221 | 3300033402 | Peat Soil | MSFFDLLKKGFGYVLLSMGVSRPTAKPKPETKPAPKTGPGE |
| Ga0326728_1002202713 | 3300033402 | Peat Soil | MSFFDVLKKGFGFVLLSMGVSRPTPKPKPEAKPAPRAGSGE |
| Ga0326728_100281734 | 3300033402 | Peat Soil | MSFFDTLKKGFGFVLLSMGVSRPAPKPKPETKPAPKAGSSE |
| Ga0326728_100470803 | 3300033402 | Peat Soil | MSFFDTLKKGFGFLLLSMGVSRPTPKPKSETTPAPKAESGSGPH |
| Ga0326728_101385022 | 3300033402 | Peat Soil | MSFFDVLKKGFGFVLLSMGVSRPAPKPKPKTKPAPKAGFGE |
| Ga0326728_101906512 | 3300033402 | Peat Soil | MSVMDWLRKGFGYLLLSMGVSRPGTKPAPKPKSEAKPAPKADSSK |
| Ga0326728_106519401 | 3300033402 | Peat Soil | RDAMSFFDALKKGFGFVLLSMGVSRPTPKPKPAAKPAPEAGSGE |
| Ga0326728_107513192 | 3300033402 | Peat Soil | MSFFDVLKKGFGFVLLSMGVSRPAPKPKPETKPAPRAGFGE |
| Ga0326727_101837042 | 3300033405 | Peat Soil | MSFFDALKKGFGFVLLSMGVSRPTPKPKPAAKPAPEAGSGE |
| Ga0326727_104927921 | 3300033405 | Peat Soil | MSFYDLLKKGFGYVLLSMGVSRPAPKPRPETKPAAKTGSGE |
| Ga0326727_107016902 | 3300033405 | Peat Soil | MSFFDVLKKGFGFVLLSMGVSRPAPKPKPETKPAPKAGFGE |
| Ga0326727_108216922 | 3300033405 | Peat Soil | MSFIEALKKGFGYVLLSMGVSRPAPRPKQETKPAPKTGSSQ |
| Ga0314861_0379136_298_417 | 3300033977 | Peatland | MSVLDLLRKGFGFLLLSMGVSRPAPKTGTKPAPKLDRGA |
| Ga0371488_0183197_3_119 | 3300033983 | Peat Soil | FDLLKKGFGYVLLSMGVSRPTAKPKPETKPAPKTGPGE |
| Ga0326724_0125974_3_122 | 3300034091 | Peat Soil | MSFFDTLKKGFGFVLLSMGVSRPAPKPKPETKPAPKAGSS |
| Ga0326724_0131020_1130_1252 | 3300034091 | Peat Soil | MSFFDLLKKGFGYVLLSMGVSRPTAKPKPETKPAPKTGPG |
| Ga0326724_0619503_147_281 | 3300034091 | Peat Soil | MSFFETLKKGFGFLLLSMGVSRPAPKPKSETTPAPKAESGSGPH |
| ⦗Top⦘ |