| Basic Information | |
|---|---|
| Family ID | F051519 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VMPAVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASDAA |
| Number of Associated Samples | 128 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.86 % |
| % of genes near scaffold ends (potentially truncated) | 76.39 % |
| % of genes from short scaffolds (< 2000 bps) | 90.97 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.639 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.611 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.611 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.528 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF03061 | 4HBT | 9.72 |
| PF00440 | TetR_N | 4.17 |
| PF01638 | HxlR | 4.17 |
| PF01402 | RHH_1 | 3.47 |
| PF00005 | ABC_tran | 3.47 |
| PF13434 | Lys_Orn_oxgnase | 3.47 |
| PF08327 | AHSA1 | 2.78 |
| PF02653 | BPD_transp_2 | 2.78 |
| PF04149 | DUF397 | 2.08 |
| PF12146 | Hydrolase_4 | 2.08 |
| PF00753 | Lactamase_B | 2.08 |
| PF02861 | Clp_N | 2.08 |
| PF02657 | SufE | 2.08 |
| PF04075 | F420H2_quin_red | 1.39 |
| PF13458 | Peripla_BP_6 | 1.39 |
| PF16925 | TetR_C_13 | 0.69 |
| PF01844 | HNH | 0.69 |
| PF00723 | Glyco_hydro_15 | 0.69 |
| PF08241 | Methyltransf_11 | 0.69 |
| PF13487 | HD_5 | 0.69 |
| PF11716 | MDMPI_N | 0.69 |
| PF01022 | HTH_5 | 0.69 |
| PF00296 | Bac_luciferase | 0.69 |
| PF02776 | TPP_enzyme_N | 0.69 |
| PF00313 | CSD | 0.69 |
| PF01061 | ABC2_membrane | 0.69 |
| PF03446 | NAD_binding_2 | 0.69 |
| PF00563 | EAL | 0.69 |
| PF00355 | Rieske | 0.69 |
| PF03176 | MMPL | 0.69 |
| PF00848 | Ring_hydroxyl_A | 0.69 |
| PF13279 | 4HBT_2 | 0.69 |
| PF15919 | HicB_lk_antitox | 0.69 |
| PF00903 | Glyoxalase | 0.69 |
| PF00581 | Rhodanese | 0.69 |
| PF00293 | NUDIX | 0.69 |
| PF14833 | NAD_binding_11 | 0.69 |
| PF02909 | TetR_C_1 | 0.69 |
| PF13519 | VWA_2 | 0.69 |
| PF00582 | Usp | 0.69 |
| PF00730 | HhH-GPD | 0.69 |
| PF13191 | AAA_16 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 4.17 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 2.08 |
| COG2166 | Sulfur transfer protein SufE, Fe-S cluster assembly | Posttranslational modification, protein turnover, chaperones [O] | 2.08 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.39 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.69 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.69 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.69 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.69 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.69 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.69 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.69 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.69 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.69 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.69 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.69 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.69 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.69 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.64 % |
| Unclassified | root | N/A | 17.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559006|FI_contig15024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 832 | Open in IMG/M |
| 2189573004|GZGWRS402HWBMA | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 501 | Open in IMG/M |
| 3300000559|F14TC_112803702 | Not Available | 504 | Open in IMG/M |
| 3300001431|F14TB_105570537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. | 597 | Open in IMG/M |
| 3300004099|Ga0058900_1377998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 792 | Open in IMG/M |
| 3300004153|Ga0063455_101538300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300005440|Ga0070705_100891958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Corynebacteriales incertae sedis → Fodinicola → Fodinicola acaciae | 714 | Open in IMG/M |
| 3300005538|Ga0070731_10476073 | Not Available | 831 | Open in IMG/M |
| 3300005574|Ga0066694_10379370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 667 | Open in IMG/M |
| 3300005577|Ga0068857_100190367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1868 | Open in IMG/M |
| 3300005719|Ga0068861_101066020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 775 | Open in IMG/M |
| 3300005841|Ga0068863_100417271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1314 | Open in IMG/M |
| 3300005844|Ga0068862_100204580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1781 | Open in IMG/M |
| 3300006162|Ga0075030_101520595 | Not Available | 524 | Open in IMG/M |
| 3300006163|Ga0070715_10093172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1390 | Open in IMG/M |
| 3300006163|Ga0070715_10377632 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300006893|Ga0073928_10340429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1114 | Open in IMG/M |
| 3300006954|Ga0079219_10571542 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300009038|Ga0099829_10011456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 5773 | Open in IMG/M |
| 3300009100|Ga0075418_11869152 | Not Available | 653 | Open in IMG/M |
| 3300009137|Ga0066709_104321573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
| 3300009143|Ga0099792_10359860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 880 | Open in IMG/M |
| 3300009551|Ga0105238_10954583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 877 | Open in IMG/M |
| 3300009792|Ga0126374_11124591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei | 624 | Open in IMG/M |
| 3300010046|Ga0126384_10371240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1199 | Open in IMG/M |
| 3300010048|Ga0126373_10652652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1108 | Open in IMG/M |
| 3300010337|Ga0134062_10154320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1023 | Open in IMG/M |
| 3300010343|Ga0074044_10328068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1005 | Open in IMG/M |
| 3300010358|Ga0126370_10065135 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
| 3300010361|Ga0126378_10316389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei | 1666 | Open in IMG/M |
| 3300010366|Ga0126379_11920110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 695 | Open in IMG/M |
| 3300010371|Ga0134125_10689226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1127 | Open in IMG/M |
| 3300010371|Ga0134125_11610197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Corynebacteriales incertae sedis → Fodinicola → Fodinicola acaciae | 707 | Open in IMG/M |
| 3300010376|Ga0126381_100626066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1533 | Open in IMG/M |
| 3300010376|Ga0126381_104114070 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300010379|Ga0136449_100547494 | All Organisms → cellular organisms → Bacteria | 1991 | Open in IMG/M |
| 3300010396|Ga0134126_11733305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Corynebacteriales incertae sedis → Fodinicola → Fodinicola acaciae | 685 | Open in IMG/M |
| 3300010396|Ga0134126_12693430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300010880|Ga0126350_10395318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 570 | Open in IMG/M |
| 3300011107|Ga0151490_1507696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 780 | Open in IMG/M |
| 3300011120|Ga0150983_12368510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
| 3300011120|Ga0150983_14388979 | Not Available | 517 | Open in IMG/M |
| 3300012189|Ga0137388_10077218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2795 | Open in IMG/M |
| 3300012198|Ga0137364_10037763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3137 | Open in IMG/M |
| 3300012198|Ga0137364_10788509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 718 | Open in IMG/M |
| 3300012201|Ga0137365_10016571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5760 | Open in IMG/M |
| 3300012202|Ga0137363_11628703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 538 | Open in IMG/M |
| 3300012211|Ga0137377_10078723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3098 | Open in IMG/M |
| 3300012285|Ga0137370_10787436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300012359|Ga0137385_10607397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana | 919 | Open in IMG/M |
| 3300012362|Ga0137361_10143974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2124 | Open in IMG/M |
| 3300012363|Ga0137390_10724492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 956 | Open in IMG/M |
| 3300012481|Ga0157320_1036813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300012917|Ga0137395_11028523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300012924|Ga0137413_11627925 | Not Available | 528 | Open in IMG/M |
| 3300012930|Ga0137407_10526609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1105 | Open in IMG/M |
| 3300012986|Ga0164304_10639686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 800 | Open in IMG/M |
| 3300012987|Ga0164307_11927938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
| 3300013306|Ga0163162_11950895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 672 | Open in IMG/M |
| 3300015053|Ga0137405_1127555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 669 | Open in IMG/M |
| 3300015372|Ga0132256_101687380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 743 | Open in IMG/M |
| 3300016371|Ga0182034_10671339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 879 | Open in IMG/M |
| 3300017937|Ga0187809_10050009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1349 | Open in IMG/M |
| 3300017937|Ga0187809_10233493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
| 3300017974|Ga0187777_10136136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1633 | Open in IMG/M |
| 3300018006|Ga0187804_10579537 | Not Available | 509 | Open in IMG/M |
| 3300018042|Ga0187871_10442786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 718 | Open in IMG/M |
| 3300018046|Ga0187851_10790068 | Not Available | 534 | Open in IMG/M |
| 3300020579|Ga0210407_10043802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3333 | Open in IMG/M |
| 3300021178|Ga0210408_10784485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 747 | Open in IMG/M |
| 3300021180|Ga0210396_11097822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 670 | Open in IMG/M |
| 3300021180|Ga0210396_11528498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
| 3300021374|Ga0213881_10060811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1607 | Open in IMG/M |
| 3300021402|Ga0210385_10809606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 718 | Open in IMG/M |
| 3300021405|Ga0210387_10121910 | All Organisms → cellular organisms → Bacteria | 2204 | Open in IMG/M |
| 3300021407|Ga0210383_11740577 | Not Available | 509 | Open in IMG/M |
| 3300021475|Ga0210392_11030361 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300021477|Ga0210398_10497611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 992 | Open in IMG/M |
| 3300021560|Ga0126371_12566781 | Not Available | 617 | Open in IMG/M |
| 3300022708|Ga0242670_1068641 | Not Available | 537 | Open in IMG/M |
| 3300022715|Ga0242678_1049933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300022724|Ga0242665_10325965 | Not Available | 544 | Open in IMG/M |
| 3300022840|Ga0224549_1010707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1332 | Open in IMG/M |
| 3300025903|Ga0207680_11348771 | Not Available | 507 | Open in IMG/M |
| 3300025909|Ga0207705_10268907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1303 | Open in IMG/M |
| 3300025913|Ga0207695_10723435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Corynebacteriales incertae sedis → Fodinicola → Fodinicola acaciae | 876 | Open in IMG/M |
| 3300025916|Ga0207663_10065575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2322 | Open in IMG/M |
| 3300025929|Ga0207664_10325187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces albus | 1357 | Open in IMG/M |
| 3300025960|Ga0207651_10837745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Corynebacteriales incertae sedis → Fodinicola → Fodinicola acaciae | 817 | Open in IMG/M |
| 3300025961|Ga0207712_12009046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. S39 | 517 | Open in IMG/M |
| 3300026118|Ga0207675_100227124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1800 | Open in IMG/M |
| 3300026214|Ga0209838_1022595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 880 | Open in IMG/M |
| 3300026551|Ga0209648_10843472 | Not Available | 501 | Open in IMG/M |
| 3300027523|Ga0208890_1015566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1056 | Open in IMG/M |
| 3300027768|Ga0209772_10101446 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300027775|Ga0209177_10391477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
| 3300027853|Ga0209274_10410184 | Not Available | 700 | Open in IMG/M |
| 3300028782|Ga0307306_10183639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300028807|Ga0307305_10334441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 687 | Open in IMG/M |
| 3300028819|Ga0307296_10340579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 819 | Open in IMG/M |
| 3300028824|Ga0307310_10384906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia pini | 694 | Open in IMG/M |
| 3300028828|Ga0307312_10176466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1365 | Open in IMG/M |
| 3300028828|Ga0307312_10196458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Corynebacteriales incertae sedis → Fodinicola → Fodinicola acaciae | 1294 | Open in IMG/M |
| 3300028828|Ga0307312_10587116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 737 | Open in IMG/M |
| 3300028877|Ga0302235_10132643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1118 | Open in IMG/M |
| 3300030053|Ga0302177_10007066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7654 | Open in IMG/M |
| 3300030057|Ga0302176_10415990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 542 | Open in IMG/M |
| 3300030677|Ga0302317_10256840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
| 3300031027|Ga0302308_10065594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2570 | Open in IMG/M |
| 3300031028|Ga0302180_10123833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1458 | Open in IMG/M |
| 3300031057|Ga0170834_106424483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 961 | Open in IMG/M |
| 3300031090|Ga0265760_10051775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1237 | Open in IMG/M |
| 3300031231|Ga0170824_108138798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1017 | Open in IMG/M |
| 3300031234|Ga0302325_12342942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
| 3300031525|Ga0302326_11532950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 890 | Open in IMG/M |
| 3300031640|Ga0318555_10247668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 963 | Open in IMG/M |
| 3300031708|Ga0310686_118527529 | Not Available | 511 | Open in IMG/M |
| 3300031736|Ga0318501_10582242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 614 | Open in IMG/M |
| 3300031736|Ga0318501_10593252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300031751|Ga0318494_10131968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium roseum | 1398 | Open in IMG/M |
| 3300031751|Ga0318494_10319266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
| 3300031764|Ga0318535_10309394 | Not Available | 707 | Open in IMG/M |
| 3300031770|Ga0318521_10398371 | Not Available | 820 | Open in IMG/M |
| 3300031771|Ga0318546_11292604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300031796|Ga0318576_10393203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 655 | Open in IMG/M |
| 3300031798|Ga0318523_10075584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1625 | Open in IMG/M |
| 3300031799|Ga0318565_10424947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
| 3300031845|Ga0318511_10454625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300031846|Ga0318512_10058436 | Not Available | 1738 | Open in IMG/M |
| 3300031846|Ga0318512_10704355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei | 518 | Open in IMG/M |
| 3300031860|Ga0318495_10546733 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300031879|Ga0306919_10014400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4592 | Open in IMG/M |
| 3300031941|Ga0310912_10684005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 796 | Open in IMG/M |
| 3300032001|Ga0306922_11667519 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300032001|Ga0306922_12078873 | Not Available | 551 | Open in IMG/M |
| 3300032035|Ga0310911_10624192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
| 3300032039|Ga0318559_10248660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 822 | Open in IMG/M |
| 3300032039|Ga0318559_10271164 | Not Available | 786 | Open in IMG/M |
| 3300032043|Ga0318556_10119924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1344 | Open in IMG/M |
| 3300032067|Ga0318524_10748275 | Not Available | 516 | Open in IMG/M |
| 3300032515|Ga0348332_10174355 | Not Available | 517 | Open in IMG/M |
| 3300032515|Ga0348332_13513114 | Not Available | 517 | Open in IMG/M |
| 3300032892|Ga0335081_11240367 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300033289|Ga0310914_11786711 | Not Available | 519 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.25% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.08% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.39% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.39% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.39% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.39% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.39% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.69% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.69% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.69% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.69% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.69% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004099 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF236 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00026900 | 2166559006 | Grass Soil | VLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA |
| FG2_08639960 | 2189573004 | Grass Soil | MLPVGLADRLAAEAERRGLSVSDLLADYAEQGLRRDGTPG |
| F14TC_1128037023 | 3300000559 | Soil | VVMPAVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASDAA* |
| F14TB_1055705373 | 3300001431 | Soil | VMPAVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASDAA* |
| Ga0058900_13779981 | 3300004099 | Forest Soil | LVLPARLAERLAARAEQRGLSFSDLLVEYAQDGLDHDGADGP* |
| Ga0063455_1015383001 | 3300004153 | Soil | VRRTVVLPTVLAERLAARAEQRSLSVSDLLAEYAEEGLRRDDPGAA* |
| Ga0070705_1008919581 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RRTMVMPAGLAERLAARAEQRGLSVSDLLTEYAEEGLRRDRPGPA* |
| Ga0070731_104760732 | 3300005538 | Surface Soil | AERLAAQAERRGLSVSDLLIEYAEEGLRRDEADGAPA* |
| Ga0066694_103793702 | 3300005574 | Soil | VRRAVVMPIALAERLAARAEQRDLSVSDLLVEYAEEGLRRDVADG* |
| Ga0068857_1001903673 | 3300005577 | Corn Rhizosphere | ERLAARAEQRGLSVSDLLTEYAEEGLRRDGPGPA* |
| Ga0068861_1010660201 | 3300005719 | Switchgrass Rhizosphere | DCVRRAVVMPIALAERLAARAEQRDLSVSDLLVEYAEEGLRRDVADG* |
| Ga0068863_1004172713 | 3300005841 | Switchgrass Rhizosphere | AERLAARAEQRGLSVSDLLTEYAEEGLRRDGPGPA* |
| Ga0068862_1002045801 | 3300005844 | Switchgrass Rhizosphere | LAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA* |
| Ga0075030_1015205951 | 3300006162 | Watersheds | DDCVRRSVVMTAVLAERLAAQAERRGLSISDLLAEYAEEGLRRDGADG* |
| Ga0070715_100931725 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RLAAQAGRRGLSVSDLLAEYAEQGLQRDAGEEPAG* |
| Ga0070715_103776321 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | PAVLAERLAARAEQRGLSISDLLTEYAEEGLRRDGPGPA* |
| Ga0073928_103404293 | 3300006893 | Iron-Sulfur Acid Spring | AALAERLAARAEQRGVSVSDLLVEYAQDGLDHDGAGGA* |
| Ga0079219_105715421 | 3300006954 | Agricultural Soil | DDCVRRTMVIPAVLAERLAARAEQRGLSISDLLTEYAEEGLRRDGPGPA* |
| Ga0099829_100114563 | 3300009038 | Vadose Zone Soil | MPAALAEQLAAIADQRGLSISDLLVEYAQQGLRRDGADH* |
| Ga0075418_118691522 | 3300009100 | Populus Rhizosphere | LAERLAAEAERRGLSVSDLLVEYADEGLRRQGADQ* |
| Ga0066709_1043215732 | 3300009137 | Grasslands Soil | MPAGLAERLAARAGQRGLSVSDLLTEYAEEGLRRDGSGAA* |
| Ga0099792_103598601 | 3300009143 | Vadose Zone Soil | MPAALAERLAAIADQRGVSISDLLVEYARQGLRRDGADY* |
| Ga0105238_109545831 | 3300009551 | Corn Rhizosphere | TMVMPAGLAERLAARAEQRGLSVSDLLTEYAEEGLRRDRPGPA* |
| Ga0126374_111245911 | 3300009792 | Tropical Forest Soil | MPTVLAERLAARAEQRGLSVSDLLVQYAEEGLRRDQEPG* |
| Ga0126384_103712402 | 3300010046 | Tropical Forest Soil | MVVMPTVLAERLAARAEQRGLSVSDLLVQYAEEGLRRDREPG* |
| Ga0126373_106526522 | 3300010048 | Tropical Forest Soil | MPTVLAERLAARAQQRGLSVSDLLVQYAEEGLRRDTEPG* |
| Ga0134062_101543201 | 3300010337 | Grasslands Soil | MPIALAERLAARAEQRDLSVSDLLVEYAEEGLRRDVAD |
| Ga0074044_103280682 | 3300010343 | Bog Forest Soil | MPIALAERLAARAERLSLSVSDLLVGYAEEGLRRDEPQVPPSVR* |
| Ga0126370_100651352 | 3300010358 | Tropical Forest Soil | MPTVLAERLAARAEQRGLSVSDLLVQYAEEGLRRDPEPG* |
| Ga0126378_103163892 | 3300010361 | Tropical Forest Soil | MPAVLAERLAARAEQRDVSVSDLLVQYAEEGLRRDREPG* |
| Ga0126379_119201102 | 3300010366 | Tropical Forest Soil | MPTVLAERLAARAEQRGLSVSDLLVQYAEEGLRRDREPG* |
| Ga0134125_106892261 | 3300010371 | Terrestrial Soil | IVLAERLAAQAGRRGLSVSDLLAEYAEQGLQRDAGEEPAG* |
| Ga0134125_116101972 | 3300010371 | Terrestrial Soil | VRRTMVMPAGLAERLAARAEQRGLSVSDLLTEYAEEGLRRDGPGPA* |
| Ga0126381_1006260662 | 3300010376 | Tropical Forest Soil | MPVALAERLAAEAERRELSVSELLIEYAEEGLRRDAADG* |
| Ga0126381_1041140701 | 3300010376 | Tropical Forest Soil | PAPLAERLAARAEQRGLSFSDLLVEYAEDGLHRDGADGP* |
| Ga0136449_1005474941 | 3300010379 | Peatlands Soil | IVMPAVLAEQLAVRAGQRGLSVSDLMVEYAREGLHHDRTGG* |
| Ga0134126_117333051 | 3300010396 | Terrestrial Soil | LAERLAARAEQRGLSVSDLLTEYAEEGLRRDGPGPA* |
| Ga0134126_126934301 | 3300010396 | Terrestrial Soil | VLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA* |
| Ga0126350_103953182 | 3300010880 | Boreal Forest Soil | MLVLPATLAERLAARAEQRGLSVSDLLVEYAQDGLDHDRADGA* |
| Ga0151490_15076962 | 3300011107 | Soil | MPAVLAERLAAQAEQRDLSVSDLLAEYAEEGLRRDEADG* |
| Ga0150983_123685103 | 3300011120 | Forest Soil | ARLAERLAARAEQRGLSFSDLLVEYAQDGLDHDGADGP* |
| Ga0150983_143889792 | 3300011120 | Forest Soil | VRRTVVLPTLLAERIAAQAEQRGLSFSDLFVEYAQDGLRRDGAVGR* |
| Ga0137388_100772182 | 3300012189 | Vadose Zone Soil | MPAALAEQLAAIADQRGLSISDLLVEYAQQGLRRDGADP* |
| Ga0137364_100377634 | 3300012198 | Vadose Zone Soil | MPAGLAERLAARAEQRGLSVSDLLTEYAEEGLRRDGSGAA* |
| Ga0137364_107885092 | 3300012198 | Vadose Zone Soil | VMPIALAERLAARAEQRDLSVSDLLVEYAEEGLRRDVADG* |
| Ga0137365_100165715 | 3300012201 | Vadose Zone Soil | MPAVLAERLAAQAEQRDLSVSDLLAEYAEEGLRRDGADG* |
| Ga0137363_116287032 | 3300012202 | Vadose Zone Soil | MPAVLAERLAARADQRGLSISDLLTEYAEEGLRRDGAA* |
| Ga0137377_100787231 | 3300012211 | Vadose Zone Soil | VVLPAALAERLAAAAERLAAAAERRGLSVSDLLAEYAQEGLRRDAADG* |
| Ga0137370_107874361 | 3300012285 | Vadose Zone Soil | CVHRTMVMPAVLAERLASRAEQRGLSVSDLLTEYAEEGLRRDASGAD* |
| Ga0137385_106073973 | 3300012359 | Vadose Zone Soil | TVLAERLAAQAERRGLSVSDLLAEYAEEGLRHDAA* |
| Ga0137361_101439743 | 3300012362 | Vadose Zone Soil | MPAALAEQLAAIADQRGLSISDLLVEYAQQGLRRDGAD |
| Ga0137390_107244922 | 3300012363 | Vadose Zone Soil | VMPAALAERLAAIADQRGVSISDLLVEYARQGLRRDGADY* |
| Ga0157320_10368132 | 3300012481 | Arabidopsis Rhizosphere | RRTMVMPAVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGVG* |
| Ga0137395_110285232 | 3300012917 | Vadose Zone Soil | MPAALAERLAAIADQRGVSISDLLVEYARQGLRRDGADH* |
| Ga0137413_116279251 | 3300012924 | Vadose Zone Soil | VLAERLAARAEQRGLSISDLLAEYAEEGLRRDGSGAA* |
| Ga0137407_105266092 | 3300012930 | Vadose Zone Soil | VRRTFVMRADLAERLAVRAEQRGLSVSDLLVEFAEEGLRR |
| Ga0164304_106396862 | 3300012986 | Soil | MVMPAALAERLATRAEQRGLSVSELLSEYAEEGLRRDPLI* |
| Ga0164307_119279381 | 3300012987 | Soil | MVMPAALAERLATRAEQRGLSVSELLSEYAEEGLR |
| Ga0163162_119508952 | 3300013306 | Switchgrass Rhizosphere | AVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA* |
| Ga0137405_11275552 | 3300015053 | Vadose Zone Soil | VRRTFVMRADLAERLAVRAEQRGLSVSDLLVEFAEEGLRRNEAAG* |
| Ga0132256_1016873802 | 3300015372 | Arabidopsis Rhizosphere | MPIVLAERLAARAEQRDLSVSDLLVEYAEEGLRRDVADG |
| Ga0182034_106713393 | 3300016371 | Soil | ALLAERLAARAEKRGLSFSDLIVEYAEDGLRRDGSDGP |
| Ga0187809_100500091 | 3300017937 | Freshwater Sediment | VLAERLAAQAEQRGLSVSDLLAEYAEEGLRREEPGGA |
| Ga0187809_102334931 | 3300017937 | Freshwater Sediment | AVLTERLAARAEQRGLSFSDLLVEYAQDGLERDEADGP |
| Ga0187777_101361363 | 3300017974 | Tropical Peatland | VRRTVVLPALLAERLAARAEQRGLSFSDLLVEYAQDGLDRDGA |
| Ga0187804_105795372 | 3300018006 | Freshwater Sediment | VLAERLADRAERRGLSISDLLAEYAEEGLRRDGAAE |
| Ga0187871_104427862 | 3300018042 | Peatland | TLILPALLAERLAARAEQRGLSFSDLLVEYAQDGLDRDRAGGR |
| Ga0187851_107900681 | 3300018046 | Peatland | VLAEQLAAQADRRGLSVSDLLVEYAEIGLRRDEADD |
| Ga0210407_100438021 | 3300020579 | Soil | LAERLAAQAERRGLSISDLLAEYAEEGLRRDGADG |
| Ga0210408_107844851 | 3300021178 | Soil | VRRTVVMPIALAERLAAQAERRELSVSELLIEYAEEGLRRDAADA |
| Ga0210396_110978222 | 3300021180 | Soil | CVRRTMVMPAGLAERLAARAEQRGLSVSDLLTEYAEEGLRRDTSGAA |
| Ga0210396_115284981 | 3300021180 | Soil | RRMLVLPATLAERLAARAEQRGVSVSDLLVEYAQDGLDHDGADGA |
| Ga0213881_100608113 | 3300021374 | Exposed Rock | MPTLPTALAERLAARAEQRDLSVSDLLAEYAQEGLLRDR |
| Ga0210385_108096061 | 3300021402 | Soil | DCVRRMLVLPARLAERLAAQAEQRGLSFSDLLVKYAQDGLDHDGADGP |
| Ga0210387_101219101 | 3300021405 | Soil | EHLADRAEKRGLSVSDLLVDYAEEGLRRDDEADTG |
| Ga0210383_117405772 | 3300021407 | Soil | DRVRRTIVLPTRLAERLAARAEQRGLSFSDLLVGYAQDGLDRDGADGP |
| Ga0210392_110303611 | 3300021475 | Soil | VRRTGVMPAVLAERLAARAEQRGLSISDLLTEYAEEGLRRDT |
| Ga0210398_104976113 | 3300021477 | Soil | VRRMLVLPARLAERLAAQAEQRGLSFSDLLVKYAQDGLDHDGADGP |
| Ga0126371_125667812 | 3300021560 | Tropical Forest Soil | VVMPAALAERLAAEAERRELSVSDLLVEYAEDGLRRGAPNGVP |
| Ga0242670_10686413 | 3300022708 | Soil | LAERLAARAEQRGLSFSDLLVEYAQDGLDHDGADGP |
| Ga0242678_10499331 | 3300022715 | Soil | RLAERLAARAEQRGLSFSDLLVEYAQDGLDRDGAGGP |
| Ga0242665_103259651 | 3300022724 | Soil | ARLAERLAARAEQRGLSFSDLLVEYAQDGLDRDGADGP |
| Ga0224549_10107071 | 3300022840 | Soil | RTLVLPALLAERLAARAEQRGLSFSDLLVEYAQGGLDRDCADGS |
| Ga0207680_113487712 | 3300025903 | Switchgrass Rhizosphere | MVMPAALAERLAARAEQRGLSISDLLTEYAEEGLRRDT |
| Ga0207705_102689073 | 3300025909 | Corn Rhizosphere | RVRRTMVMPAGLAERLAARAEQRGLSVSDLLTEYAEEGLRRDRPGPA |
| Ga0207695_107234351 | 3300025913 | Corn Rhizosphere | RVRRTMVMPAGLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA |
| Ga0207663_100655753 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMPAALAERLATRAEQRGLSVSELLSEYAEEGLRHDPQA |
| Ga0207664_103251871 | 3300025929 | Agricultural Soil | MPARLAERLAARAEQRGLSISDLLAEYAEEGLRRDT |
| Ga0207651_108377453 | 3300025960 | Switchgrass Rhizosphere | RVRRTMVMPAGLAERLAARAEQRGLSVSDLLTEYAEEGLRRAGPGPA |
| Ga0207712_120090462 | 3300025961 | Switchgrass Rhizosphere | DDRVRRTMVMPAGLAERLAARAEQRGLSVSDLVTEYAEEGLRRDGPGPA |
| Ga0207675_1002271243 | 3300026118 | Switchgrass Rhizosphere | DDCVRRTMVMPTGLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA |
| Ga0209838_10225952 | 3300026214 | Soil | IGLAERLAAQAERRGLSISDLLVEYAEDGLRRDQAG |
| Ga0209648_108434721 | 3300026551 | Grasslands Soil | RTVVLPAVLAERLAAQAGRRGLSVSDLLAEYAEEGLRHDAA |
| Ga0208890_10155663 | 3300027523 | Soil | MPAVLAERLAAQAEQRDLSVSDLLAEYAEEGLRRDGADG |
| Ga0209772_101014462 | 3300027768 | Bog Forest Soil | DCVRRTVVLPVVLAERLAARAERLRLSVSDLLVEYAEEGLRRDEPSVQ |
| Ga0209177_103914772 | 3300027775 | Agricultural Soil | MVMPVVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA |
| Ga0209274_104101842 | 3300027853 | Soil | VIPAGLAERVAARAEQRGLSFSDLLAEYAQQGLDRDG |
| Ga0307306_101836391 | 3300028782 | Soil | PAVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA |
| Ga0307305_103344411 | 3300028807 | Soil | RWSPYHFRRAVVMPIALAERLAARAEQRDLSVSDLLVEYAEEGLRRDAADG |
| Ga0307296_103405791 | 3300028819 | Soil | AVVMPIALAERLAARAEQRDLSVSDLLVEYAEEGLRRDAADG |
| Ga0307310_103849061 | 3300028824 | Soil | MPAVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA |
| Ga0307312_101764661 | 3300028828 | Soil | AERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA |
| Ga0307312_101964581 | 3300028828 | Soil | AVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA |
| Ga0307312_105871161 | 3300028828 | Soil | TVVMPAVLAERLAAQAEQRDLSVSDLLAEYAEEGLRRDGAGG |
| Ga0302235_101326433 | 3300028877 | Palsa | RTLILPARLAERLAARAEQRGLSFSDLLVEYAQDSLDRDRADGS |
| Ga0302177_100070661 | 3300030053 | Palsa | PVVLAERLAARAGQRGLSVSDLLVEYAEIGLRRDEADD |
| Ga0302176_104159901 | 3300030057 | Palsa | VVIPVMLAERLAAQADRRRLSVSDLLVEYAEIGLRRDEADD |
| Ga0302317_102568401 | 3300030677 | Palsa | LAEQLAARAEHHGLSVSDLLAQYAEEGLRRDEDAGQ |
| Ga0302308_100655945 | 3300031027 | Palsa | RTLVLPALLAERLAARAEQRGLSFSDLLVEYAQDSLDRDRADGS |
| Ga0302180_101238333 | 3300031028 | Palsa | RRTVVIPAVLAERLAAQADRRGLSVSDLLVEYAEIGLRRDEADD |
| Ga0170834_1064244833 | 3300031057 | Forest Soil | DFVCRTVVMPVALVSRLAATAERRGLSVSDLLIEYAAAGLRREEQHD |
| Ga0265760_100517752 | 3300031090 | Soil | VVLPTVLAERLAARAEGLGLSVSDLLVEYAEEGLRRDEPQAPPSVP |
| Ga0170824_1081387983 | 3300031231 | Forest Soil | DDFVCRTVVMPVALVSRLAATAERRGLSVSDLLIEYAAAGLRREEQHD |
| Ga0302325_123429422 | 3300031234 | Palsa | LAERLAARAEQRGLSFSDLLVEYAQDSLDRDRADGS |
| Ga0302326_115329502 | 3300031525 | Palsa | PALLAERLAAWAEQRGLSFSDLLVEYAQAGLDRDRADGS |
| Ga0318555_102476681 | 3300031640 | Soil | RTVVIRAVLAEQLAATAERRGLSVSDLLAEYAEQGLRNDPAARPPPG |
| Ga0310686_1185275292 | 3300031708 | Soil | VLPARLAERLAARAEQRGLSFSDLLVEYAQDGLDRDGADGP |
| Ga0318501_105822422 | 3300031736 | Soil | MPAVLAERLAATAERRGLSVSDLLAEYAEQGLQHDLAAR |
| Ga0318501_105932523 | 3300031736 | Soil | CVRRTVVLPAQLAERLAARAEQRGLSFSDLLVEYAQDGLHRDGVDGR |
| Ga0318494_101319683 | 3300031751 | Soil | RRTVVMPTELAERLAAEAERRELSVSDLLVEYAEEGLRRDAPNGVP |
| Ga0318494_103192663 | 3300031751 | Soil | RRTGVMPAALAERLAAEAERRELSVSDLLVEYAEEGLRRDTPDSVP |
| Ga0318535_103093941 | 3300031764 | Soil | AELLADRAERRGLSVSDLLAEYAEEGLRRDGADGPGS |
| Ga0318521_103983712 | 3300031770 | Soil | AALAELLADRAERRGLSVSDLLAEYAEEGLRRDGADGPGS |
| Ga0318546_112926041 | 3300031771 | Soil | LAERLAARAEQRGLSVSDLLTEYAEEGLRRDGPGVG |
| Ga0318576_103932032 | 3300031796 | Soil | MPAALAERLAATAERRGLSVGDLLAEYAEQGLQHDPAAR |
| Ga0318523_100755844 | 3300031798 | Soil | TVVMPTALAERLAAEAERRELSVSDLLVEYAEEGLRRDAPNGVP |
| Ga0318565_104249473 | 3300031799 | Soil | VRPERLAARAEQRGLSFSDLLVEYAQDGLHRDGADGR |
| Ga0318511_104546252 | 3300031845 | Soil | MPTVLAERVAARAEQHGPSVSDLLVQYGEEGLRRDQAPG |
| Ga0318512_100584363 | 3300031846 | Soil | PAALAELLADRAERRGLSVSDLLAEYAEEGLRRDGADGPGS |
| Ga0318512_107043551 | 3300031846 | Soil | VLAERVAARAEQHGPSVSDLLVQYGEEGLRRDQAPG |
| Ga0318495_105467332 | 3300031860 | Soil | RTVVLPALLAERLAARAEKRGLSFSDLLVEYAEDGLRRDGADGP |
| Ga0306919_100144001 | 3300031879 | Soil | RRTVVLPAQLAERLAARAEQRGLSFSDLLVEYAQDGLHRDGADGR |
| Ga0310912_106840052 | 3300031941 | Soil | MPAVLAERLAATAERRGLSVSDLLAEYAEQGLQHDPAAR |
| Ga0306922_116675192 | 3300032001 | Soil | VVLPALLAERLAARAEKRGLSFSDLLVEYAEDGLRRDGADGP |
| Ga0306922_120788731 | 3300032001 | Soil | SVRRTVVMPTELAERLAAEAERRELSVSDLLVEYAEEGLRRDTPDSVP |
| Ga0310911_106241921 | 3300032035 | Soil | RRTVVMPAVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDERPDVG |
| Ga0318559_102486601 | 3300032039 | Soil | TVVLPAQLAERLAARAEQRGLSFSDLLVEYAQDGLHRDGVDGR |
| Ga0318559_102711641 | 3300032039 | Soil | LLADRAERRGLSVSDLLAEYAEEGLRRDGADGPGS |
| Ga0318556_101199241 | 3300032043 | Soil | DCVRRTVVLPALLTERLAARAEQRGLSFSDLLVEYAEDGLHRDGADRP |
| Ga0318524_107482752 | 3300032067 | Soil | SVRRTVVMPAALAERLAAEAERRELSVSDLLVEYAEEGLRRDTPDSVP |
| Ga0348332_101743551 | 3300032515 | Plant Litter | RRMLVLPARLAERLAAQAEQRGLSLSDLLVEYAQDGLEHDGADGP |
| Ga0348332_135131142 | 3300032515 | Plant Litter | VLPTLLAERIAAQAEQRGLSFSDLLVEYAQDGLRRDGAAGR |
| Ga0335081_112403672 | 3300032892 | Soil | RRTVVMPTVLAERLAATAERRGLSVSDLLVEYAREGLRRDGPGG |
| Ga0310914_117867112 | 3300033289 | Soil | TVVLPTLLAERIAARAEQRGLSFSDLLVEYAQDGLRRDGAVGQ |
| ⦗Top⦘ |