NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F051519

Metagenome / Metatranscriptome Family F051519

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051519
Family Type Metagenome / Metatranscriptome
Number of Sequences 144
Average Sequence Length 41 residues
Representative Sequence VMPAVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASDAA
Number of Associated Samples 128
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.86 %
% of genes near scaffold ends (potentially truncated) 76.39 %
% of genes from short scaffolds (< 2000 bps) 90.97 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.639 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.611 % of family members)
Environment Ontology (ENVO) Unclassified
(23.611 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.528 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.83%    β-sheet: 0.00%    Coil/Unstructured: 52.17%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.61
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 144 Family Scaffolds
PF030614HBT 9.72
PF00440TetR_N 4.17
PF01638HxlR 4.17
PF01402RHH_1 3.47
PF00005ABC_tran 3.47
PF13434Lys_Orn_oxgnase 3.47
PF08327AHSA1 2.78
PF02653BPD_transp_2 2.78
PF04149DUF397 2.08
PF12146Hydrolase_4 2.08
PF00753Lactamase_B 2.08
PF02861Clp_N 2.08
PF02657SufE 2.08
PF04075F420H2_quin_red 1.39
PF13458Peripla_BP_6 1.39
PF16925TetR_C_13 0.69
PF01844HNH 0.69
PF00723Glyco_hydro_15 0.69
PF08241Methyltransf_11 0.69
PF13487HD_5 0.69
PF11716MDMPI_N 0.69
PF01022HTH_5 0.69
PF00296Bac_luciferase 0.69
PF02776TPP_enzyme_N 0.69
PF00313CSD 0.69
PF01061ABC2_membrane 0.69
PF03446NAD_binding_2 0.69
PF00563EAL 0.69
PF00355Rieske 0.69
PF03176MMPL 0.69
PF00848Ring_hydroxyl_A 0.69
PF132794HBT_2 0.69
PF15919HicB_lk_antitox 0.69
PF00903Glyoxalase 0.69
PF00581Rhodanese 0.69
PF00293NUDIX 0.69
PF14833NAD_binding_11 0.69
PF02909TetR_C_1 0.69
PF13519VWA_2 0.69
PF00582Usp 0.69
PF00730HhH-GPD 0.69
PF13191AAA_16 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 144 Family Scaffolds
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 4.17
COG0542ATP-dependent Clp protease, ATP-binding subunit ClpAPosttranslational modification, protein turnover, chaperones [O] 2.08
COG2166Sulfur transfer protein SufE, Fe-S cluster assemblyPosttranslational modification, protein turnover, chaperones [O] 2.08
COG4638Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunitInorganic ion transport and metabolism [P] 1.39
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.69
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.69
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.69
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.69
COG3387Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 familyCarbohydrate transport and metabolism [G] 0.69
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.69
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 0.69
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.69
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.69
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 0.69
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 0.69
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.69
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.69
COG0177Endonuclease IIIReplication, recombination and repair [L] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.64 %
UnclassifiedrootN/A17.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559006|FI_contig15024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces832Open in IMG/M
2189573004|GZGWRS402HWBMAAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii501Open in IMG/M
3300000559|F14TC_112803702Not Available504Open in IMG/M
3300001431|F14TB_105570537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp.597Open in IMG/M
3300004099|Ga0058900_1377998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia792Open in IMG/M
3300004153|Ga0063455_101538300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300005440|Ga0070705_100891958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Corynebacteriales incertae sedis → Fodinicola → Fodinicola acaciae714Open in IMG/M
3300005538|Ga0070731_10476073Not Available831Open in IMG/M
3300005574|Ga0066694_10379370All Organisms → cellular organisms → Bacteria → Terrabacteria group667Open in IMG/M
3300005577|Ga0068857_100190367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1868Open in IMG/M
3300005719|Ga0068861_101066020All Organisms → cellular organisms → Bacteria → Terrabacteria group775Open in IMG/M
3300005841|Ga0068863_100417271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1314Open in IMG/M
3300005844|Ga0068862_100204580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1781Open in IMG/M
3300006162|Ga0075030_101520595Not Available524Open in IMG/M
3300006163|Ga0070715_10093172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1390Open in IMG/M
3300006163|Ga0070715_10377632All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300006893|Ga0073928_10340429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1114Open in IMG/M
3300006954|Ga0079219_10571542All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300009038|Ga0099829_10011456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia5773Open in IMG/M
3300009100|Ga0075418_11869152Not Available653Open in IMG/M
3300009137|Ga0066709_104321573All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300009143|Ga0099792_10359860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi880Open in IMG/M
3300009551|Ga0105238_10954583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria877Open in IMG/M
3300009792|Ga0126374_11124591All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei624Open in IMG/M
3300010046|Ga0126384_10371240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1199Open in IMG/M
3300010048|Ga0126373_10652652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1108Open in IMG/M
3300010337|Ga0134062_10154320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1023Open in IMG/M
3300010343|Ga0074044_10328068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1005Open in IMG/M
3300010358|Ga0126370_10065135All Organisms → cellular organisms → Bacteria2384Open in IMG/M
3300010361|Ga0126378_10316389All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei1666Open in IMG/M
3300010366|Ga0126379_11920110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi695Open in IMG/M
3300010371|Ga0134125_10689226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1127Open in IMG/M
3300010371|Ga0134125_11610197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Corynebacteriales incertae sedis → Fodinicola → Fodinicola acaciae707Open in IMG/M
3300010376|Ga0126381_100626066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1533Open in IMG/M
3300010376|Ga0126381_104114070All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300010379|Ga0136449_100547494All Organisms → cellular organisms → Bacteria1991Open in IMG/M
3300010396|Ga0134126_11733305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Corynebacteriales incertae sedis → Fodinicola → Fodinicola acaciae685Open in IMG/M
3300010396|Ga0134126_12693430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300010880|Ga0126350_10395318All Organisms → cellular organisms → Bacteria → Terrabacteria group570Open in IMG/M
3300011107|Ga0151490_1507696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi780Open in IMG/M
3300011120|Ga0150983_12368510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia574Open in IMG/M
3300011120|Ga0150983_14388979Not Available517Open in IMG/M
3300012189|Ga0137388_10077218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2795Open in IMG/M
3300012198|Ga0137364_10037763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3137Open in IMG/M
3300012198|Ga0137364_10788509All Organisms → cellular organisms → Bacteria → Terrabacteria group718Open in IMG/M
3300012201|Ga0137365_10016571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5760Open in IMG/M
3300012202|Ga0137363_11628703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia538Open in IMG/M
3300012211|Ga0137377_10078723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3098Open in IMG/M
3300012285|Ga0137370_10787436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300012359|Ga0137385_10607397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana919Open in IMG/M
3300012362|Ga0137361_10143974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2124Open in IMG/M
3300012363|Ga0137390_10724492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia956Open in IMG/M
3300012481|Ga0157320_1036813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300012917|Ga0137395_11028523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria588Open in IMG/M
3300012924|Ga0137413_11627925Not Available528Open in IMG/M
3300012930|Ga0137407_10526609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1105Open in IMG/M
3300012986|Ga0164304_10639686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi800Open in IMG/M
3300012987|Ga0164307_11927938All Organisms → cellular organisms → Bacteria → Terrabacteria group501Open in IMG/M
3300013306|Ga0163162_11950895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria672Open in IMG/M
3300015053|Ga0137405_1127555All Organisms → cellular organisms → Bacteria → Terrabacteria group669Open in IMG/M
3300015372|Ga0132256_101687380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii743Open in IMG/M
3300016371|Ga0182034_10671339All Organisms → cellular organisms → Bacteria → Proteobacteria879Open in IMG/M
3300017937|Ga0187809_10050009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1349Open in IMG/M
3300017937|Ga0187809_10233493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia661Open in IMG/M
3300017974|Ga0187777_10136136All Organisms → cellular organisms → Bacteria → Terrabacteria group1633Open in IMG/M
3300018006|Ga0187804_10579537Not Available509Open in IMG/M
3300018042|Ga0187871_10442786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia718Open in IMG/M
3300018046|Ga0187851_10790068Not Available534Open in IMG/M
3300020579|Ga0210407_10043802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3333Open in IMG/M
3300021178|Ga0210408_10784485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia747Open in IMG/M
3300021180|Ga0210396_11097822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria670Open in IMG/M
3300021180|Ga0210396_11528498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300021374|Ga0213881_10060811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1607Open in IMG/M
3300021402|Ga0210385_10809606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia718Open in IMG/M
3300021405|Ga0210387_10121910All Organisms → cellular organisms → Bacteria2204Open in IMG/M
3300021407|Ga0210383_11740577Not Available509Open in IMG/M
3300021475|Ga0210392_11030361All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300021477|Ga0210398_10497611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia992Open in IMG/M
3300021560|Ga0126371_12566781Not Available617Open in IMG/M
3300022708|Ga0242670_1068641Not Available537Open in IMG/M
3300022715|Ga0242678_1049933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300022724|Ga0242665_10325965Not Available544Open in IMG/M
3300022840|Ga0224549_1010707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1332Open in IMG/M
3300025903|Ga0207680_11348771Not Available507Open in IMG/M
3300025909|Ga0207705_10268907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1303Open in IMG/M
3300025913|Ga0207695_10723435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Corynebacteriales incertae sedis → Fodinicola → Fodinicola acaciae876Open in IMG/M
3300025916|Ga0207663_10065575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2322Open in IMG/M
3300025929|Ga0207664_10325187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces albus1357Open in IMG/M
3300025960|Ga0207651_10837745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Corynebacteriales incertae sedis → Fodinicola → Fodinicola acaciae817Open in IMG/M
3300025961|Ga0207712_12009046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. S39517Open in IMG/M
3300026118|Ga0207675_100227124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1800Open in IMG/M
3300026214|Ga0209838_1022595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria880Open in IMG/M
3300026551|Ga0209648_10843472Not Available501Open in IMG/M
3300027523|Ga0208890_1015566All Organisms → cellular organisms → Bacteria → Terrabacteria group1056Open in IMG/M
3300027768|Ga0209772_10101446All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300027775|Ga0209177_10391477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia555Open in IMG/M
3300027853|Ga0209274_10410184Not Available700Open in IMG/M
3300028782|Ga0307306_10183639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300028807|Ga0307305_10334441All Organisms → cellular organisms → Bacteria → Terrabacteria group687Open in IMG/M
3300028819|Ga0307296_10340579All Organisms → cellular organisms → Bacteria → Terrabacteria group819Open in IMG/M
3300028824|Ga0307310_10384906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia pini694Open in IMG/M
3300028828|Ga0307312_10176466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1365Open in IMG/M
3300028828|Ga0307312_10196458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Corynebacteriales incertae sedis → Fodinicola → Fodinicola acaciae1294Open in IMG/M
3300028828|Ga0307312_10587116All Organisms → cellular organisms → Bacteria → Terrabacteria group737Open in IMG/M
3300028877|Ga0302235_10132643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1118Open in IMG/M
3300030053|Ga0302177_10007066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7654Open in IMG/M
3300030057|Ga0302176_10415990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii542Open in IMG/M
3300030677|Ga0302317_10256840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium790Open in IMG/M
3300031027|Ga0302308_10065594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2570Open in IMG/M
3300031028|Ga0302180_10123833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1458Open in IMG/M
3300031057|Ga0170834_106424483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria961Open in IMG/M
3300031090|Ga0265760_10051775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1237Open in IMG/M
3300031231|Ga0170824_108138798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1017Open in IMG/M
3300031234|Ga0302325_12342942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia643Open in IMG/M
3300031525|Ga0302326_11532950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis890Open in IMG/M
3300031640|Ga0318555_10247668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia963Open in IMG/M
3300031708|Ga0310686_118527529Not Available511Open in IMG/M
3300031736|Ga0318501_10582242All Organisms → cellular organisms → Bacteria → Terrabacteria group614Open in IMG/M
3300031736|Ga0318501_10593252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia608Open in IMG/M
3300031751|Ga0318494_10131968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium roseum1398Open in IMG/M
3300031751|Ga0318494_10319266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria897Open in IMG/M
3300031764|Ga0318535_10309394Not Available707Open in IMG/M
3300031770|Ga0318521_10398371Not Available820Open in IMG/M
3300031771|Ga0318546_11292604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300031796|Ga0318576_10393203All Organisms → cellular organisms → Bacteria → Terrabacteria group655Open in IMG/M
3300031798|Ga0318523_10075584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1625Open in IMG/M
3300031799|Ga0318565_10424947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia643Open in IMG/M
3300031845|Ga0318511_10454625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300031846|Ga0318512_10058436Not Available1738Open in IMG/M
3300031846|Ga0318512_10704355All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei518Open in IMG/M
3300031860|Ga0318495_10546733All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300031879|Ga0306919_10014400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4592Open in IMG/M
3300031941|Ga0310912_10684005All Organisms → cellular organisms → Bacteria → Terrabacteria group796Open in IMG/M
3300032001|Ga0306922_11667519All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300032001|Ga0306922_12078873Not Available551Open in IMG/M
3300032035|Ga0310911_10624192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria625Open in IMG/M
3300032039|Ga0318559_10248660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia822Open in IMG/M
3300032039|Ga0318559_10271164Not Available786Open in IMG/M
3300032043|Ga0318556_10119924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1344Open in IMG/M
3300032067|Ga0318524_10748275Not Available516Open in IMG/M
3300032515|Ga0348332_10174355Not Available517Open in IMG/M
3300032515|Ga0348332_13513114Not Available517Open in IMG/M
3300032892|Ga0335081_11240367All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300033289|Ga0310914_11786711Not Available519Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.61%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.25%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.56%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.78%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.08%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.08%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.08%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.39%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.39%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.39%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.39%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.39%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.39%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.69%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.69%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.69%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.69%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.69%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.69%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.69%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.69%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.69%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.69%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.69%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.69%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.69%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.69%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.69%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559006Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembledEnvironmentalOpen in IMG/M
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300004099Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF236 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022708Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022715Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022840Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026214Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030677Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3EnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FI_000269002166559006Grass SoilVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA
FG2_086399602189573004Grass SoilMLPVGLADRLAAEAERRGLSVSDLLADYAEQGLRRDGTPG
F14TC_11280370233300000559SoilVVMPAVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASDAA*
F14TB_10557053733300001431SoilVMPAVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASDAA*
Ga0058900_137799813300004099Forest SoilLVLPARLAERLAARAEQRGLSFSDLLVEYAQDGLDHDGADGP*
Ga0063455_10153830013300004153SoilVRRTVVLPTVLAERLAARAEQRSLSVSDLLAEYAEEGLRRDDPGAA*
Ga0070705_10089195813300005440Corn, Switchgrass And Miscanthus RhizosphereRRTMVMPAGLAERLAARAEQRGLSVSDLLTEYAEEGLRRDRPGPA*
Ga0070731_1047607323300005538Surface SoilAERLAAQAERRGLSVSDLLIEYAEEGLRRDEADGAPA*
Ga0066694_1037937023300005574SoilVRRAVVMPIALAERLAARAEQRDLSVSDLLVEYAEEGLRRDVADG*
Ga0068857_10019036733300005577Corn RhizosphereERLAARAEQRGLSVSDLLTEYAEEGLRRDGPGPA*
Ga0068861_10106602013300005719Switchgrass RhizosphereDCVRRAVVMPIALAERLAARAEQRDLSVSDLLVEYAEEGLRRDVADG*
Ga0068863_10041727133300005841Switchgrass RhizosphereAERLAARAEQRGLSVSDLLTEYAEEGLRRDGPGPA*
Ga0068862_10020458013300005844Switchgrass RhizosphereLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA*
Ga0075030_10152059513300006162WatershedsDDCVRRSVVMTAVLAERLAAQAERRGLSISDLLAEYAEEGLRRDGADG*
Ga0070715_1009317253300006163Corn, Switchgrass And Miscanthus RhizosphereRLAAQAGRRGLSVSDLLAEYAEQGLQRDAGEEPAG*
Ga0070715_1037763213300006163Corn, Switchgrass And Miscanthus RhizospherePAVLAERLAARAEQRGLSISDLLTEYAEEGLRRDGPGPA*
Ga0073928_1034042933300006893Iron-Sulfur Acid SpringAALAERLAARAEQRGVSVSDLLVEYAQDGLDHDGAGGA*
Ga0079219_1057154213300006954Agricultural SoilDDCVRRTMVIPAVLAERLAARAEQRGLSISDLLTEYAEEGLRRDGPGPA*
Ga0099829_1001145633300009038Vadose Zone SoilMPAALAEQLAAIADQRGLSISDLLVEYAQQGLRRDGADH*
Ga0075418_1186915223300009100Populus RhizosphereLAERLAAEAERRGLSVSDLLVEYADEGLRRQGADQ*
Ga0066709_10432157323300009137Grasslands SoilMPAGLAERLAARAGQRGLSVSDLLTEYAEEGLRRDGSGAA*
Ga0099792_1035986013300009143Vadose Zone SoilMPAALAERLAAIADQRGVSISDLLVEYARQGLRRDGADY*
Ga0105238_1095458313300009551Corn RhizosphereTMVMPAGLAERLAARAEQRGLSVSDLLTEYAEEGLRRDRPGPA*
Ga0126374_1112459113300009792Tropical Forest SoilMPTVLAERLAARAEQRGLSVSDLLVQYAEEGLRRDQEPG*
Ga0126384_1037124023300010046Tropical Forest SoilMVVMPTVLAERLAARAEQRGLSVSDLLVQYAEEGLRRDREPG*
Ga0126373_1065265223300010048Tropical Forest SoilMPTVLAERLAARAQQRGLSVSDLLVQYAEEGLRRDTEPG*
Ga0134062_1015432013300010337Grasslands SoilMPIALAERLAARAEQRDLSVSDLLVEYAEEGLRRDVAD
Ga0074044_1032806823300010343Bog Forest SoilMPIALAERLAARAERLSLSVSDLLVGYAEEGLRRDEPQVPPSVR*
Ga0126370_1006513523300010358Tropical Forest SoilMPTVLAERLAARAEQRGLSVSDLLVQYAEEGLRRDPEPG*
Ga0126378_1031638923300010361Tropical Forest SoilMPAVLAERLAARAEQRDVSVSDLLVQYAEEGLRRDREPG*
Ga0126379_1192011023300010366Tropical Forest SoilMPTVLAERLAARAEQRGLSVSDLLVQYAEEGLRRDREPG*
Ga0134125_1068922613300010371Terrestrial SoilIVLAERLAAQAGRRGLSVSDLLAEYAEQGLQRDAGEEPAG*
Ga0134125_1161019723300010371Terrestrial SoilVRRTMVMPAGLAERLAARAEQRGLSVSDLLTEYAEEGLRRDGPGPA*
Ga0126381_10062606623300010376Tropical Forest SoilMPVALAERLAAEAERRELSVSELLIEYAEEGLRRDAADG*
Ga0126381_10411407013300010376Tropical Forest SoilPAPLAERLAARAEQRGLSFSDLLVEYAEDGLHRDGADGP*
Ga0136449_10054749413300010379Peatlands SoilIVMPAVLAEQLAVRAGQRGLSVSDLMVEYAREGLHHDRTGG*
Ga0134126_1173330513300010396Terrestrial SoilLAERLAARAEQRGLSVSDLLTEYAEEGLRRDGPGPA*
Ga0134126_1269343013300010396Terrestrial SoilVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA*
Ga0126350_1039531823300010880Boreal Forest SoilMLVLPATLAERLAARAEQRGLSVSDLLVEYAQDGLDHDRADGA*
Ga0151490_150769623300011107SoilMPAVLAERLAAQAEQRDLSVSDLLAEYAEEGLRRDEADG*
Ga0150983_1236851033300011120Forest SoilARLAERLAARAEQRGLSFSDLLVEYAQDGLDHDGADGP*
Ga0150983_1438897923300011120Forest SoilVRRTVVLPTLLAERIAAQAEQRGLSFSDLFVEYAQDGLRRDGAVGR*
Ga0137388_1007721823300012189Vadose Zone SoilMPAALAEQLAAIADQRGLSISDLLVEYAQQGLRRDGADP*
Ga0137364_1003776343300012198Vadose Zone SoilMPAGLAERLAARAEQRGLSVSDLLTEYAEEGLRRDGSGAA*
Ga0137364_1078850923300012198Vadose Zone SoilVMPIALAERLAARAEQRDLSVSDLLVEYAEEGLRRDVADG*
Ga0137365_1001657153300012201Vadose Zone SoilMPAVLAERLAAQAEQRDLSVSDLLAEYAEEGLRRDGADG*
Ga0137363_1162870323300012202Vadose Zone SoilMPAVLAERLAARADQRGLSISDLLTEYAEEGLRRDGAA*
Ga0137377_1007872313300012211Vadose Zone SoilVVLPAALAERLAAAAERLAAAAERRGLSVSDLLAEYAQEGLRRDAADG*
Ga0137370_1078743613300012285Vadose Zone SoilCVHRTMVMPAVLAERLASRAEQRGLSVSDLLTEYAEEGLRRDASGAD*
Ga0137385_1060739733300012359Vadose Zone SoilTVLAERLAAQAERRGLSVSDLLAEYAEEGLRHDAA*
Ga0137361_1014397433300012362Vadose Zone SoilMPAALAEQLAAIADQRGLSISDLLVEYAQQGLRRDGAD
Ga0137390_1072449223300012363Vadose Zone SoilVMPAALAERLAAIADQRGVSISDLLVEYARQGLRRDGADY*
Ga0157320_103681323300012481Arabidopsis RhizosphereRRTMVMPAVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGVG*
Ga0137395_1102852323300012917Vadose Zone SoilMPAALAERLAAIADQRGVSISDLLVEYARQGLRRDGADH*
Ga0137413_1162792513300012924Vadose Zone SoilVLAERLAARAEQRGLSISDLLAEYAEEGLRRDGSGAA*
Ga0137407_1052660923300012930Vadose Zone SoilVRRTFVMRADLAERLAVRAEQRGLSVSDLLVEFAEEGLRR
Ga0164304_1063968623300012986SoilMVMPAALAERLATRAEQRGLSVSELLSEYAEEGLRRDPLI*
Ga0164307_1192793813300012987SoilMVMPAALAERLATRAEQRGLSVSELLSEYAEEGLR
Ga0163162_1195089523300013306Switchgrass RhizosphereAVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA*
Ga0137405_112755523300015053Vadose Zone SoilVRRTFVMRADLAERLAVRAEQRGLSVSDLLVEFAEEGLRRNEAAG*
Ga0132256_10168738023300015372Arabidopsis RhizosphereMPIVLAERLAARAEQRDLSVSDLLVEYAEEGLRRDVADG
Ga0182034_1067133933300016371SoilALLAERLAARAEKRGLSFSDLIVEYAEDGLRRDGSDGP
Ga0187809_1005000913300017937Freshwater SedimentVLAERLAAQAEQRGLSVSDLLAEYAEEGLRREEPGGA
Ga0187809_1023349313300017937Freshwater SedimentAVLTERLAARAEQRGLSFSDLLVEYAQDGLERDEADGP
Ga0187777_1013613633300017974Tropical PeatlandVRRTVVLPALLAERLAARAEQRGLSFSDLLVEYAQDGLDRDGA
Ga0187804_1057953723300018006Freshwater SedimentVLAERLADRAERRGLSISDLLAEYAEEGLRRDGAAE
Ga0187871_1044278623300018042PeatlandTLILPALLAERLAARAEQRGLSFSDLLVEYAQDGLDRDRAGGR
Ga0187851_1079006813300018046PeatlandVLAEQLAAQADRRGLSVSDLLVEYAEIGLRRDEADD
Ga0210407_1004380213300020579SoilLAERLAAQAERRGLSISDLLAEYAEEGLRRDGADG
Ga0210408_1078448513300021178SoilVRRTVVMPIALAERLAAQAERRELSVSELLIEYAEEGLRRDAADA
Ga0210396_1109782223300021180SoilCVRRTMVMPAGLAERLAARAEQRGLSVSDLLTEYAEEGLRRDTSGAA
Ga0210396_1152849813300021180SoilRRMLVLPATLAERLAARAEQRGVSVSDLLVEYAQDGLDHDGADGA
Ga0213881_1006081133300021374Exposed RockMPTLPTALAERLAARAEQRDLSVSDLLAEYAQEGLLRDR
Ga0210385_1080960613300021402SoilDCVRRMLVLPARLAERLAAQAEQRGLSFSDLLVKYAQDGLDHDGADGP
Ga0210387_1012191013300021405SoilEHLADRAEKRGLSVSDLLVDYAEEGLRRDDEADTG
Ga0210383_1174057723300021407SoilDRVRRTIVLPTRLAERLAARAEQRGLSFSDLLVGYAQDGLDRDGADGP
Ga0210392_1103036113300021475SoilVRRTGVMPAVLAERLAARAEQRGLSISDLLTEYAEEGLRRDT
Ga0210398_1049761133300021477SoilVRRMLVLPARLAERLAAQAEQRGLSFSDLLVKYAQDGLDHDGADGP
Ga0126371_1256678123300021560Tropical Forest SoilVVMPAALAERLAAEAERRELSVSDLLVEYAEDGLRRGAPNGVP
Ga0242670_106864133300022708SoilLAERLAARAEQRGLSFSDLLVEYAQDGLDHDGADGP
Ga0242678_104993313300022715SoilRLAERLAARAEQRGLSFSDLLVEYAQDGLDRDGAGGP
Ga0242665_1032596513300022724SoilARLAERLAARAEQRGLSFSDLLVEYAQDGLDRDGADGP
Ga0224549_101070713300022840SoilRTLVLPALLAERLAARAEQRGLSFSDLLVEYAQGGLDRDCADGS
Ga0207680_1134877123300025903Switchgrass RhizosphereMVMPAALAERLAARAEQRGLSISDLLTEYAEEGLRRDT
Ga0207705_1026890733300025909Corn RhizosphereRVRRTMVMPAGLAERLAARAEQRGLSVSDLLTEYAEEGLRRDRPGPA
Ga0207695_1072343513300025913Corn RhizosphereRVRRTMVMPAGLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA
Ga0207663_1006557533300025916Corn, Switchgrass And Miscanthus RhizosphereMVMPAALAERLATRAEQRGLSVSELLSEYAEEGLRHDPQA
Ga0207664_1032518713300025929Agricultural SoilMPARLAERLAARAEQRGLSISDLLAEYAEEGLRRDT
Ga0207651_1083774533300025960Switchgrass RhizosphereRVRRTMVMPAGLAERLAARAEQRGLSVSDLLTEYAEEGLRRAGPGPA
Ga0207712_1200904623300025961Switchgrass RhizosphereDDRVRRTMVMPAGLAERLAARAEQRGLSVSDLVTEYAEEGLRRDGPGPA
Ga0207675_10022712433300026118Switchgrass RhizosphereDDCVRRTMVMPTGLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA
Ga0209838_102259523300026214SoilIGLAERLAAQAERRGLSISDLLVEYAEDGLRRDQAG
Ga0209648_1084347213300026551Grasslands SoilRTVVLPAVLAERLAAQAGRRGLSVSDLLAEYAEEGLRHDAA
Ga0208890_101556633300027523SoilMPAVLAERLAAQAEQRDLSVSDLLAEYAEEGLRRDGADG
Ga0209772_1010144623300027768Bog Forest SoilDCVRRTVVLPVVLAERLAARAERLRLSVSDLLVEYAEEGLRRDEPSVQ
Ga0209177_1039147723300027775Agricultural SoilMVMPVVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA
Ga0209274_1041018423300027853SoilVIPAGLAERVAARAEQRGLSFSDLLAEYAQQGLDRDG
Ga0307306_1018363913300028782SoilPAVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA
Ga0307305_1033444113300028807SoilRWSPYHFRRAVVMPIALAERLAARAEQRDLSVSDLLVEYAEEGLRRDAADG
Ga0307296_1034057913300028819SoilAVVMPIALAERLAARAEQRDLSVSDLLVEYAEEGLRRDAADG
Ga0307310_1038490613300028824SoilMPAVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA
Ga0307312_1017646613300028828SoilAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA
Ga0307312_1019645813300028828SoilAVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDASGAA
Ga0307312_1058711613300028828SoilTVVMPAVLAERLAAQAEQRDLSVSDLLAEYAEEGLRRDGAGG
Ga0302235_1013264333300028877PalsaRTLILPARLAERLAARAEQRGLSFSDLLVEYAQDSLDRDRADGS
Ga0302177_1000706613300030053PalsaPVVLAERLAARAGQRGLSVSDLLVEYAEIGLRRDEADD
Ga0302176_1041599013300030057PalsaVVIPVMLAERLAAQADRRRLSVSDLLVEYAEIGLRRDEADD
Ga0302317_1025684013300030677PalsaLAEQLAARAEHHGLSVSDLLAQYAEEGLRRDEDAGQ
Ga0302308_1006559453300031027PalsaRTLVLPALLAERLAARAEQRGLSFSDLLVEYAQDSLDRDRADGS
Ga0302180_1012383333300031028PalsaRRTVVIPAVLAERLAAQADRRGLSVSDLLVEYAEIGLRRDEADD
Ga0170834_10642448333300031057Forest SoilDFVCRTVVMPVALVSRLAATAERRGLSVSDLLIEYAAAGLRREEQHD
Ga0265760_1005177523300031090SoilVVLPTVLAERLAARAEGLGLSVSDLLVEYAEEGLRRDEPQAPPSVP
Ga0170824_10813879833300031231Forest SoilDDFVCRTVVMPVALVSRLAATAERRGLSVSDLLIEYAAAGLRREEQHD
Ga0302325_1234294223300031234PalsaLAERLAARAEQRGLSFSDLLVEYAQDSLDRDRADGS
Ga0302326_1153295023300031525PalsaPALLAERLAAWAEQRGLSFSDLLVEYAQAGLDRDRADGS
Ga0318555_1024766813300031640SoilRTVVIRAVLAEQLAATAERRGLSVSDLLAEYAEQGLRNDPAARPPPG
Ga0310686_11852752923300031708SoilVLPARLAERLAARAEQRGLSFSDLLVEYAQDGLDRDGADGP
Ga0318501_1058224223300031736SoilMPAVLAERLAATAERRGLSVSDLLAEYAEQGLQHDLAAR
Ga0318501_1059325233300031736SoilCVRRTVVLPAQLAERLAARAEQRGLSFSDLLVEYAQDGLHRDGVDGR
Ga0318494_1013196833300031751SoilRRTVVMPTELAERLAAEAERRELSVSDLLVEYAEEGLRRDAPNGVP
Ga0318494_1031926633300031751SoilRRTGVMPAALAERLAAEAERRELSVSDLLVEYAEEGLRRDTPDSVP
Ga0318535_1030939413300031764SoilAELLADRAERRGLSVSDLLAEYAEEGLRRDGADGPGS
Ga0318521_1039837123300031770SoilAALAELLADRAERRGLSVSDLLAEYAEEGLRRDGADGPGS
Ga0318546_1129260413300031771SoilLAERLAARAEQRGLSVSDLLTEYAEEGLRRDGPGVG
Ga0318576_1039320323300031796SoilMPAALAERLAATAERRGLSVGDLLAEYAEQGLQHDPAAR
Ga0318523_1007558443300031798SoilTVVMPTALAERLAAEAERRELSVSDLLVEYAEEGLRRDAPNGVP
Ga0318565_1042494733300031799SoilVRPERLAARAEQRGLSFSDLLVEYAQDGLHRDGADGR
Ga0318511_1045462523300031845SoilMPTVLAERVAARAEQHGPSVSDLLVQYGEEGLRRDQAPG
Ga0318512_1005843633300031846SoilPAALAELLADRAERRGLSVSDLLAEYAEEGLRRDGADGPGS
Ga0318512_1070435513300031846SoilVLAERVAARAEQHGPSVSDLLVQYGEEGLRRDQAPG
Ga0318495_1054673323300031860SoilRTVVLPALLAERLAARAEKRGLSFSDLLVEYAEDGLRRDGADGP
Ga0306919_1001440013300031879SoilRRTVVLPAQLAERLAARAEQRGLSFSDLLVEYAQDGLHRDGADGR
Ga0310912_1068400523300031941SoilMPAVLAERLAATAERRGLSVSDLLAEYAEQGLQHDPAAR
Ga0306922_1166751923300032001SoilVVLPALLAERLAARAEKRGLSFSDLLVEYAEDGLRRDGADGP
Ga0306922_1207887313300032001SoilSVRRTVVMPTELAERLAAEAERRELSVSDLLVEYAEEGLRRDTPDSVP
Ga0310911_1062419213300032035SoilRRTVVMPAVLAERLAARAEQRGLSVSDLLTEYAEEGLRRDERPDVG
Ga0318559_1024866013300032039SoilTVVLPAQLAERLAARAEQRGLSFSDLLVEYAQDGLHRDGVDGR
Ga0318559_1027116413300032039SoilLLADRAERRGLSVSDLLAEYAEEGLRRDGADGPGS
Ga0318556_1011992413300032043SoilDCVRRTVVLPALLTERLAARAEQRGLSFSDLLVEYAEDGLHRDGADRP
Ga0318524_1074827523300032067SoilSVRRTVVMPAALAERLAAEAERRELSVSDLLVEYAEEGLRRDTPDSVP
Ga0348332_1017435513300032515Plant LitterRRMLVLPARLAERLAAQAEQRGLSLSDLLVEYAQDGLEHDGADGP
Ga0348332_1351311423300032515Plant LitterVLPTLLAERIAAQAEQRGLSFSDLLVEYAQDGLRRDGAAGR
Ga0335081_1124036723300032892SoilRRTVVMPTVLAERLAATAERRGLSVSDLLVEYAREGLRRDGPGG
Ga0310914_1178671123300033289SoilTVVLPTLLAERIAARAEQRGLSFSDLLVEYAQDGLRRDGAVGQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.