| Basic Information | |
|---|---|
| Family ID | F051515 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 52 residues |
| Representative Sequence | MKSVGMVLLLAGLPTFAFAGGVIAPEISPASGVAALALVSGALLVIRGRRKK |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.01 % |
| % of genes near scaffold ends (potentially truncated) | 22.92 % |
| % of genes from short scaffolds (< 2000 bps) | 78.47 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (50.694 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (11.806 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.694 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (70.139 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF04116 | FA_hydroxylase | 24.79 |
| PF07883 | Cupin_2 | 1.71 |
| PF02558 | ApbA | 1.71 |
| PF12796 | Ank_2 | 0.85 |
| PF08379 | Bact_transglu_N | 0.85 |
| PF00135 | COesterase | 0.85 |
| PF05935 | Arylsulfotrans | 0.85 |
| PF07690 | MFS_1 | 0.85 |
| PF13709 | DUF4159 | 0.85 |
| PF05199 | GMC_oxred_C | 0.85 |
| PF16320 | Ribosomal_L12_N | 0.85 |
| PF02517 | Rce1-like | 0.85 |
| PF00903 | Glyoxalase | 0.85 |
| PF00753 | Lactamase_B | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 24.79 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG1305 | Transglutaminase-like enzyme, putative cysteine protease | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.85 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.85 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.69 % |
| Unclassified | root | N/A | 49.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10026896 | All Organisms → cellular organisms → Bacteria | 3441 | Open in IMG/M |
| 3300001356|JGI12269J14319_10371194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300004071|Ga0055486_10126493 | Not Available | 603 | Open in IMG/M |
| 3300004114|Ga0062593_102170355 | Not Available | 621 | Open in IMG/M |
| 3300004114|Ga0062593_102170355 | Not Available | 621 | Open in IMG/M |
| 3300004799|Ga0058863_10728702 | Not Available | 640 | Open in IMG/M |
| 3300004803|Ga0058862_11073986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 680 | Open in IMG/M |
| 3300005329|Ga0070683_100008938 | All Organisms → cellular organisms → Bacteria | 8537 | Open in IMG/M |
| 3300005329|Ga0070683_100008938 | All Organisms → cellular organisms → Bacteria | 8537 | Open in IMG/M |
| 3300005329|Ga0070683_100011039 | All Organisms → cellular organisms → Bacteria | 7786 | Open in IMG/M |
| 3300005329|Ga0070683_100011039 | All Organisms → cellular organisms → Bacteria | 7786 | Open in IMG/M |
| 3300005329|Ga0070683_100044586 | All Organisms → cellular organisms → Bacteria | 4090 | Open in IMG/M |
| 3300005331|Ga0070670_100933853 | Not Available | 787 | Open in IMG/M |
| 3300005331|Ga0070670_100933853 | Not Available | 787 | Open in IMG/M |
| 3300005334|Ga0068869_101688965 | Not Available | 565 | Open in IMG/M |
| 3300005338|Ga0068868_100556557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
| 3300005340|Ga0070689_100167754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1778 | Open in IMG/M |
| 3300005340|Ga0070689_100167754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1778 | Open in IMG/M |
| 3300005345|Ga0070692_11377550 | Not Available | 508 | Open in IMG/M |
| 3300005367|Ga0070667_102121636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 529 | Open in IMG/M |
| 3300005436|Ga0070713_100095558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 2564 | Open in IMG/M |
| 3300005436|Ga0070713_100095558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 2564 | Open in IMG/M |
| 3300005436|Ga0070713_100095558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 2564 | Open in IMG/M |
| 3300005436|Ga0070713_100522042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1122 | Open in IMG/M |
| 3300005437|Ga0070710_10772161 | Not Available | 684 | Open in IMG/M |
| 3300005437|Ga0070710_10772161 | Not Available | 684 | Open in IMG/M |
| 3300005439|Ga0070711_100458319 | Not Available | 1045 | Open in IMG/M |
| 3300005439|Ga0070711_100458319 | Not Available | 1045 | Open in IMG/M |
| 3300005439|Ga0070711_100615937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 907 | Open in IMG/M |
| 3300005468|Ga0070707_100668102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1002 | Open in IMG/M |
| 3300005535|Ga0070684_100059262 | All Organisms → cellular organisms → Bacteria | 3346 | Open in IMG/M |
| 3300005547|Ga0070693_100152470 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300005547|Ga0070693_100152470 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300005564|Ga0070664_101416422 | Not Available | 657 | Open in IMG/M |
| 3300005564|Ga0070664_101416422 | Not Available | 657 | Open in IMG/M |
| 3300005577|Ga0068857_100746222 | Not Available | 932 | Open in IMG/M |
| 3300005578|Ga0068854_102053412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 527 | Open in IMG/M |
| 3300005616|Ga0068852_102407202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 547 | Open in IMG/M |
| 3300005616|Ga0068852_102480664 | Not Available | 539 | Open in IMG/M |
| 3300005618|Ga0068864_101119798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 784 | Open in IMG/M |
| 3300005618|Ga0068864_101326458 | Not Available | 720 | Open in IMG/M |
| 3300005618|Ga0068864_101326458 | Not Available | 720 | Open in IMG/M |
| 3300005834|Ga0068851_10987424 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005836|Ga0074470_11267645 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300005842|Ga0068858_100032389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4855 | Open in IMG/M |
| 3300005842|Ga0068858_100032389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4855 | Open in IMG/M |
| 3300006163|Ga0070715_10174134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1074 | Open in IMG/M |
| 3300006163|Ga0070715_10696063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 606 | Open in IMG/M |
| 3300006237|Ga0097621_100082162 | All Organisms → cellular organisms → Bacteria | 2682 | Open in IMG/M |
| 3300006237|Ga0097621_100082162 | All Organisms → cellular organisms → Bacteria | 2682 | Open in IMG/M |
| 3300006358|Ga0068871_100858782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 839 | Open in IMG/M |
| 3300006755|Ga0079222_12065304 | Not Available | 562 | Open in IMG/M |
| 3300006755|Ga0079222_12520810 | Not Available | 516 | Open in IMG/M |
| 3300006854|Ga0075425_101145804 | Not Available | 885 | Open in IMG/M |
| 3300006893|Ga0073928_10237778 | Not Available | 1401 | Open in IMG/M |
| 3300006893|Ga0073928_10237778 | Not Available | 1401 | Open in IMG/M |
| 3300009098|Ga0105245_10151874 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
| 3300009098|Ga0105245_10151874 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
| 3300009098|Ga0105245_13156277 | Not Available | 511 | Open in IMG/M |
| 3300009148|Ga0105243_10807136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 925 | Open in IMG/M |
| 3300009174|Ga0105241_11075997 | Not Available | 756 | Open in IMG/M |
| 3300009174|Ga0105241_11456152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 658 | Open in IMG/M |
| 3300009176|Ga0105242_13292178 | Not Available | 502 | Open in IMG/M |
| 3300009177|Ga0105248_10132344 | All Organisms → cellular organisms → Bacteria | 2814 | Open in IMG/M |
| 3300009177|Ga0105248_10132344 | All Organisms → cellular organisms → Bacteria | 2814 | Open in IMG/M |
| 3300009177|Ga0105248_12572867 | Not Available | 580 | Open in IMG/M |
| 3300009553|Ga0105249_10048046 | All Organisms → cellular organisms → Bacteria | 3891 | Open in IMG/M |
| 3300009700|Ga0116217_10823816 | Not Available | 571 | Open in IMG/M |
| 3300009700|Ga0116217_10823816 | Not Available | 571 | Open in IMG/M |
| 3300009839|Ga0116223_10522798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 689 | Open in IMG/M |
| 3300010371|Ga0134125_11605185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 708 | Open in IMG/M |
| 3300010379|Ga0136449_100000053 | All Organisms → cellular organisms → Bacteria | 218430 | Open in IMG/M |
| 3300010379|Ga0136449_100893979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1449 | Open in IMG/M |
| 3300010379|Ga0136449_100893979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1449 | Open in IMG/M |
| 3300010397|Ga0134124_11084216 | Not Available | 817 | Open in IMG/M |
| 3300010399|Ga0134127_13032002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 548 | Open in IMG/M |
| 3300010399|Ga0134127_13210146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 534 | Open in IMG/M |
| 3300010403|Ga0134123_10662577 | Not Available | 1014 | Open in IMG/M |
| 3300010403|Ga0134123_10662577 | Not Available | 1014 | Open in IMG/M |
| 3300011119|Ga0105246_10128982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1886 | Open in IMG/M |
| 3300011119|Ga0105246_10718094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 878 | Open in IMG/M |
| 3300011119|Ga0105246_11490122 | Not Available | 635 | Open in IMG/M |
| 3300011119|Ga0105246_11490122 | Not Available | 635 | Open in IMG/M |
| 3300012189|Ga0137388_10919867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 808 | Open in IMG/M |
| 3300012982|Ga0168317_1000927 | All Organisms → cellular organisms → Bacteria | 18151 | Open in IMG/M |
| 3300013306|Ga0163162_13408128 | Not Available | 507 | Open in IMG/M |
| 3300013307|Ga0157372_10018032 | All Organisms → cellular organisms → Bacteria | 7588 | Open in IMG/M |
| 3300013308|Ga0157375_13426891 | Not Available | 528 | Open in IMG/M |
| 3300013308|Ga0157375_13775305 | Not Available | 503 | Open in IMG/M |
| 3300014325|Ga0163163_11177992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 829 | Open in IMG/M |
| 3300014501|Ga0182024_10590114 | Not Available | 1393 | Open in IMG/M |
| 3300014501|Ga0182024_10590114 | Not Available | 1393 | Open in IMG/M |
| 3300014745|Ga0157377_10560898 | Not Available | 808 | Open in IMG/M |
| 3300014968|Ga0157379_10161139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 2025 | Open in IMG/M |
| 3300014969|Ga0157376_10556336 | Not Available | 1136 | Open in IMG/M |
| 3300015371|Ga0132258_13465484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 1081 | Open in IMG/M |
| 3300017959|Ga0187779_10742996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 666 | Open in IMG/M |
| 3300020070|Ga0206356_10816672 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300020078|Ga0206352_10001222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 595 | Open in IMG/M |
| 3300020082|Ga0206353_10083009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 695 | Open in IMG/M |
| 3300021478|Ga0210402_11653610 | Not Available | 567 | Open in IMG/M |
| 3300025899|Ga0207642_10739821 | Not Available | 622 | Open in IMG/M |
| 3300025913|Ga0207695_11131331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 663 | Open in IMG/M |
| 3300025914|Ga0207671_10063646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 2741 | Open in IMG/M |
| 3300025914|Ga0207671_11201822 | Not Available | 593 | Open in IMG/M |
| 3300025914|Ga0207671_11201822 | Not Available | 593 | Open in IMG/M |
| 3300025916|Ga0207663_11517054 | Not Available | 540 | Open in IMG/M |
| 3300025922|Ga0207646_11242657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 652 | Open in IMG/M |
| 3300025923|Ga0207681_11726035 | Not Available | 523 | Open in IMG/M |
| 3300025924|Ga0207694_10005153 | All Organisms → cellular organisms → Bacteria | 10088 | Open in IMG/M |
| 3300025927|Ga0207687_11700675 | Not Available | 541 | Open in IMG/M |
| 3300025934|Ga0207686_10500722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 942 | Open in IMG/M |
| 3300025934|Ga0207686_10584761 | Not Available | 877 | Open in IMG/M |
| 3300025934|Ga0207686_10642450 | Not Available | 839 | Open in IMG/M |
| 3300025942|Ga0207689_11425323 | Not Available | 580 | Open in IMG/M |
| 3300025944|Ga0207661_10018187 | All Organisms → cellular organisms → Bacteria | 5221 | Open in IMG/M |
| 3300025945|Ga0207679_11978567 | Not Available | 531 | Open in IMG/M |
| 3300025986|Ga0207658_11975824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 531 | Open in IMG/M |
| 3300026035|Ga0207703_11573850 | Not Available | 632 | Open in IMG/M |
| 3300026078|Ga0207702_11282397 | Not Available | 727 | Open in IMG/M |
| 3300026088|Ga0207641_12131967 | Not Available | 561 | Open in IMG/M |
| 3300026095|Ga0207676_10661293 | Not Available | 1009 | Open in IMG/M |
| 3300026095|Ga0207676_10661293 | Not Available | 1009 | Open in IMG/M |
| 3300026095|Ga0207676_10677600 | Not Available | 997 | Open in IMG/M |
| 3300026095|Ga0207676_11061236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 800 | Open in IMG/M |
| 3300026095|Ga0207676_11839299 | Not Available | 604 | Open in IMG/M |
| 3300026116|Ga0207674_10828676 | Not Available | 892 | Open in IMG/M |
| 3300027854|Ga0209517_10005407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 16276 | Open in IMG/M |
| 3300027854|Ga0209517_10023335 | All Organisms → cellular organisms → Bacteria | 5569 | Open in IMG/M |
| 3300027905|Ga0209415_10017205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11530 | Open in IMG/M |
| 3300028381|Ga0268264_11756795 | Not Available | 630 | Open in IMG/M |
| 3300031057|Ga0170834_102698134 | Not Available | 682 | Open in IMG/M |
| 3300031057|Ga0170834_102698134 | Not Available | 682 | Open in IMG/M |
| 3300031057|Ga0170834_103639073 | Not Available | 602 | Open in IMG/M |
| 3300031231|Ga0170824_101427798 | Not Available | 661 | Open in IMG/M |
| 3300031231|Ga0170824_101427798 | Not Available | 661 | Open in IMG/M |
| 3300031231|Ga0170824_112345521 | Not Available | 596 | Open in IMG/M |
| 3300031231|Ga0170824_121719285 | Not Available | 624 | Open in IMG/M |
| 3300031902|Ga0302322_101077180 | Not Available | 971 | Open in IMG/M |
| 3300032160|Ga0311301_10005192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 45948 | Open in IMG/M |
| 3300032160|Ga0311301_10842320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1249 | Open in IMG/M |
| 3300032160|Ga0311301_10842320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1249 | Open in IMG/M |
| 3300033412|Ga0310810_11087799 | Not Available | 668 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.81% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 9.03% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.86% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.08% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.08% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.39% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.39% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.39% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.39% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.39% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.69% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.69% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004071 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100268962 | 3300000567 | Peatlands Soil | MKFVGMVLFFVGLSSVAMAGGSAAPEISPASGVAALALVSGALLVIRGRRKK* |
| JGI12269J14319_103711941 | 3300001356 | Peatlands Soil | MKFAGMVLVLAGFSSLAFAGGVAAPEIGPASGVGAVALLAGAILVIRGRRKK* |
| Ga0055486_101264931 | 3300004071 | Natural And Restored Wetlands | MKLSVVVLLLVGSSTLALAAGLALVPEISPASGAGALALFSGVLLVIRGRRKK* |
| Ga0062593_1021703552 | 3300004114 | Soil | MKLGGMFVLLLGFSSFAIAGFQAVPEISPASGVAAFALVSGALLVIRGRRKK* |
| Ga0062593_1021703553 | 3300004114 | Soil | MKFIGMLVLFGGLSGLVLAGGPAVPEISPASGMAALALVSGALLIVRG |
| Ga0058863_107287022 | 3300004799 | Host-Associated | MKIAGVLVLLLGVSSFAFAGTPAVPEISAASGVAAITLVSGALLVIRGRRKR* |
| Ga0058862_110739862 | 3300004803 | Host-Associated | WLSEEFLMKIAGVLVLLLGVSSFAFAGTPAVPEISAASGVAAITLVSGALLVIRGRRKR* |
| Ga0070683_1000089384 | 3300005329 | Corn Rhizosphere | MKFIGMVLLLAGFSSLAFAGAAPPAPEIGPASGVAALTLVSGAILVIRGRRKK* |
| Ga0070683_1000089386 | 3300005329 | Corn Rhizosphere | MKSIGMVLLLLGASSFAFASLAPAAPEISPASGVAALTLASGAILVIRGRRKH* |
| Ga0070683_1000110398 | 3300005329 | Corn Rhizosphere | MKSVGMAVLLLGLSSYAFAGLATVAPEISSASAVSAIALVSGAILVIRGRRKR* |
| Ga0070683_1000110399 | 3300005329 | Corn Rhizosphere | MKIAGMMLLMMGLSGLVLGAVTTAPEISTASGLSALALLSGAILVIRGRRKNK* |
| Ga0070683_1000445866 | 3300005329 | Corn Rhizosphere | MKIAGMLVLLLGVSSFAFAGTPAVPEISAASGVAAITLVSGALLVIRGRRKR* |
| Ga0070670_1009338532 | 3300005331 | Switchgrass Rhizosphere | MKLGGMIVLLLGFSSFAIAGFQGVPEISPASGVAAFALVSGALLVIRGRRKK* |
| Ga0070670_1009338533 | 3300005331 | Switchgrass Rhizosphere | MKLVGMLVLFGGLSGLVVAGGPAVPEISPASGMSALALVSGALLVIRGRRKN* |
| Ga0068869_1016889651 | 3300005334 | Miscanthus Rhizosphere | MKLGGMFVLLLGFSSFAIAGFQGVPEISPASGVAAFALVSGALLVIRGRRKK* |
| Ga0068868_1005565571 | 3300005338 | Miscanthus Rhizosphere | MKSIGMMLLLVGVSSFAVAGGVVAPEISTASGVAAFALLSGTLLVIRGRRR |
| Ga0070689_1001677543 | 3300005340 | Switchgrass Rhizosphere | MKFIGMLVLFGGLSGLVLAGGPAVPEISPASGMAALALVSGALLIVRGRRKK* |
| Ga0070689_1001677544 | 3300005340 | Switchgrass Rhizosphere | MKSIGMMLLLVGISSFAVAGGVVAPEISPATGVSAFALLSG |
| Ga0070692_113775502 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFTGMVLILMGLSSLAFAGVAAVPEIGPASGVGALALLAGGLLVIRGRRKRS* |
| Ga0070667_1021216361 | 3300005367 | Switchgrass Rhizosphere | VLLLLGASSFAFAGLNVVAPEISPASGVAALTLVSGAILVIRGRRKR* |
| Ga0070713_1000955582 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFSGMVLLVMGLSSLAMGAVVAAPEISPASGVAALALVSGAVLVIRGRRKH* |
| Ga0070713_1000955583 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFIGIVLLLVSLSSLAFAGVGKPVPEIGPATGVAAVALVSGALLVIRGRRKKQSKEVR* |
| Ga0070713_1000955584 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSIGIVLLILGFSTVAFAGGPTVPEISPASGVAAVALVSGALLVIRGRRKKQSKEVR* |
| Ga0070713_1005220422 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTAGMILLLAGLSSFVMGGASAVPEISPATGVGALALLSGAVLVIRGRHKRQ* |
| Ga0070710_107721611 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTIGMALLLMGLSSFAFAGGVATPEISPATGVAGLALVSGAVLVIRGRRKK* |
| Ga0070710_107721612 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTFGIASLLVGLSSFAMGGTPTTPEISPATGVAALALVSGAVLVIRGRRKK* |
| Ga0070711_1004583191 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFAGMVLLMMGLSGLAMGAVVAAPEISPASGVAALALVSGAILVIRGRRKH* |
| Ga0070711_1004583192 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFIGIAVLLAGLANVALAGTFSVPEIGPATGVAAVALVSGALLVIRGRRKK* |
| Ga0070711_1006159371 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFLGFALLLTGFSSLAFAGLAPVVPEISPASGVAALTLVSGAILVIRGRRKH* |
| Ga0070707_1006681021 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | APTGNLQCRRSVMKSIGIVLLILGFSTVAFAGGPTVPEISPASGVAAVALVSGALLVIRGRRKKQSKEVR* |
| Ga0070684_1000592626 | 3300005535 | Corn Rhizosphere | MKFIGMVLLLAGFSSLAFAGAPPPAPEIGPASGVAALTLVSGAILVIRGRRKK* |
| Ga0070693_1001524701 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIAGMMLLMMGLSGLVMGAVTTAPEISTASGLSALALLSGAILVIRGRRKNK* |
| Ga0070693_1001524702 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSVGMVVLLLGLSSYAFAGLSTVAPEISSASAVSAIALVSGAILVIRGRRKR* |
| Ga0070664_1014164221 | 3300005564 | Corn Rhizosphere | GMLVLFGGLSGLVLAGGPAVPEISPASGMAALALVSGALLIVRGRRKK* |
| Ga0070664_1014164222 | 3300005564 | Corn Rhizosphere | MKSIGMMLLLVGISSFAVAGGVVAPEISPATGVSAFALLSGALLVIRGRRRK* |
| Ga0068857_1007462222 | 3300005577 | Corn Rhizosphere | MKLVGMLVLFGGLSGLVVAGGPAVPEISPASGMAALALVSGALLIVRGRRKK* |
| Ga0068854_1020534122 | 3300005578 | Corn Rhizosphere | MKLIGMMLLLLGAASCAFAAVPEISPASGTAALALVSGGLLVARGRRKR* |
| Ga0068852_1024072023 | 3300005616 | Corn Rhizosphere | GMVLILAGFSSLAFAGVTPSAPEIGPASGVAALTLVSGAILVIRGRRKK* |
| Ga0068852_1024806642 | 3300005616 | Corn Rhizosphere | MKSFGMILLLAGLSSLTMAGTLTVPEVSPASGLAALAMVSGVLLVIRGRRKK* |
| Ga0068864_1011197982 | 3300005618 | Switchgrass Rhizosphere | MKLIGMMLLLAGFASCAFAAVPEISPASGTAALALVSGGLLVARGRRKR* |
| Ga0068864_1013264581 | 3300005618 | Switchgrass Rhizosphere | MRFVGTMLLLVGVSTLAMAGSPNVPEVSPASGLAALAMVSGALLVIRGRRKK* |
| Ga0068864_1013264584 | 3300005618 | Switchgrass Rhizosphere | VLLLGFSSFAIAGFQGVPEISPASGVAAFALVSGALLVIRGRRKK* |
| Ga0068851_109874241 | 3300005834 | Corn Rhizosphere | MKSIGLVLLLLGASSFAFAGLNVVAPEISPASGVAALTLVSGAILVIRGRRKR* |
| Ga0074470_112676451 | 3300005836 | Sediment (Intertidal) | MKFGGMVLLLVGLSSFAMGSNVVAPEISPASAVGALALVSGGLLVIRGRRKR* |
| Ga0068858_1000323894 | 3300005842 | Switchgrass Rhizosphere | MKFIGMALLLVSVASLAFAGATVAPEISPASGVAALTLVSGAILVIRGRRKQ* |
| Ga0068858_1000323895 | 3300005842 | Switchgrass Rhizosphere | MKIIGIALLLVGVASLAFAGTPVAPEISPASGVAALTLVSGAILVIRGRRKK* |
| Ga0070715_101741342 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTAGMILLLAGLSSFVMGGASAVPEISPATGVGALALLSGAVLVIRGRRKRQ* |
| Ga0070715_106960631 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTLGMVLLVLALPGFVFAAAVSAPEISPASGVAGLALVSGAVLVIRGRRKS* |
| Ga0097621_1000821623 | 3300006237 | Miscanthus Rhizosphere | MKTFGLALLFAGLSSLAFAGTLAVPEISPASGVAALTLVSGAILVIRGRRKR* |
| Ga0097621_1000821624 | 3300006237 | Miscanthus Rhizosphere | MKFFGMALLLVAAASSAFAGGVTVPEISPASGVAALTLVSGAILVIRSRRKQ* |
| Ga0068871_1008587822 | 3300006358 | Miscanthus Rhizosphere | MKSIGMVLLLAGLSGVAIAGTAGVPEISATSGAAALAVLSGAILVIRGRRKRN* |
| Ga0079222_120653042 | 3300006755 | Agricultural Soil | MKSLGMVLLLVGFSGFSMAGALVAAPEISPISGVTAIALISGAMLVVRGRRKK* |
| Ga0079222_125208102 | 3300006755 | Agricultural Soil | MKFFGMMLLLLGSSSLAFAGLVAAAPEISAASGVGALALLSGALLVIRGRRGR* |
| Ga0075425_1011458042 | 3300006854 | Populus Rhizosphere | MKSVGMVLLLVGLSTLAFAGSPTVPEISPASGVAALAMVSGAVLVIRGRRKR* |
| Ga0073928_102377781 | 3300006893 | Iron-Sulfur Acid Spring | MRKFLGLILLMAGASMMLDAGFLAVPEISPASGVAALAMLSGALLVIRGRRKK* |
| Ga0073928_102377782 | 3300006893 | Iron-Sulfur Acid Spring | MKSAGFVLLLIGLSSFATAGLATAAPEIGPASSGAAIALLSGALLVIRGRRKR* |
| Ga0105245_101518743 | 3300009098 | Miscanthus Rhizosphere | MKMIGIVLLLVSVASLAFAGGVVVPEISPASGVAGLTLVSGALLVIRGRRKQ* |
| Ga0105245_101518744 | 3300009098 | Miscanthus Rhizosphere | MKSFGMILILVGCSSLAFAGVAPSAPEIGPASGVAALTLVSGAILVIRGRRKK* |
| Ga0105245_131562771 | 3300009098 | Miscanthus Rhizosphere | MKLGGMFVLLLGFSSFAIAGFQAVPEISPASGVAAFALVSGALLVIRSRRRK* |
| Ga0105243_108071361 | 3300009148 | Miscanthus Rhizosphere | MKSIGMMLLFAGLSSLAMAGVFVSAPEISPASGVAALALVSGAILVIRGRSRR* |
| Ga0105241_110759972 | 3300009174 | Corn Rhizosphere | MKFVGGVLLLAGLTTVAFAGGAAAPEVSPASGVAALALVSGAILVIRGRHRK* |
| Ga0105241_114561522 | 3300009174 | Corn Rhizosphere | MKLAGMLLLMMGLSGLVMGAAVATPEISAATGLSALTLLAGAVLVIRGRRQR* |
| Ga0105242_132921781 | 3300009176 | Miscanthus Rhizosphere | MILLLAGLSSLTMAGTLTVPEVSPASGLAALAMVSGVLLVIRGRRKK* |
| Ga0105248_101323444 | 3300009177 | Switchgrass Rhizosphere | MKFIGMALLLVSVASLAFAGATVAPEISPASGVAALALVSGAILVIRGRRKK* |
| Ga0105248_101323445 | 3300009177 | Switchgrass Rhizosphere | MKIIGIALLMVGAASLAFAGTPVAPEISPASGVAALTLVSGAILVIRGRRKK* |
| Ga0105248_125728673 | 3300009177 | Switchgrass Rhizosphere | PFGGLAFMKFIGMALLLVSVASLAFAGATVAPEISPASGVAALTLVSGAILVIRGRRKQ* |
| Ga0105249_100480467 | 3300009553 | Switchgrass Rhizosphere | MKSIGLVLLLLGASSFAFAGLNVVAPEISPSSGVAALTLVSGAILVIRGRRKR* |
| Ga0116217_108238161 | 3300009700 | Peatlands Soil | MKFVGITLLFAGLSSVVLADVTTAPEVSPASGVAALALVSGAVLVIRGRRKSS |
| Ga0116217_108238162 | 3300009700 | Peatlands Soil | MKSVGLVMLLVGLSTLAFAGEPTAPEISPASGVAAIALVSGAVLVIRSRRKK* |
| Ga0116223_105227982 | 3300009839 | Peatlands Soil | MKFGIVLVLTSFSSLAFAGTGTAPEIGPESGVGAVALLAGAILVIRSRRKR* |
| Ga0134125_116051852 | 3300010371 | Terrestrial Soil | EEFLMKIAGVLVLLLGVSSFAFAGTPAVPEISAASGVAAITLVSGALLVIRGRRKR* |
| Ga0136449_100000053104 | 3300010379 | Peatlands Soil | MVGMKFVGMVLFFVGLSSVAMAGGSAAPEISPASGVAALALVSGALLVIRGRRKK* |
| Ga0136449_1008939791 | 3300010379 | Peatlands Soil | MKSIGIAFLLVGFSAFAFAGSARAPEISPASGVAALAMISGALLVIRGRRKK* |
| Ga0136449_1008939792 | 3300010379 | Peatlands Soil | MKFAGIALLLMGLASIAFAGIHTVPEIGPVSGVAALALVSGALLVIRGRRKK* |
| Ga0134124_110842162 | 3300010397 | Terrestrial Soil | MKFFGMALLLVAAASSAFAGGVTVPEISPASGVAALTLVSGAILVIRG |
| Ga0134127_130320022 | 3300010399 | Terrestrial Soil | DTFAAGDTWLSEEFLMKIAGVLVLLLGVSSFAFAGTPAVPEISAASGVAAITLVSGALLVIRGRRKR* |
| Ga0134127_132101461 | 3300010399 | Terrestrial Soil | MILLAVGVSNLAVAGATTAPEISPASGVAALALVSGAVLVIRARRRK* |
| Ga0134123_106625774 | 3300010403 | Terrestrial Soil | MLLLVGVSTLAMAGSPNVPEVSPASGLAALAMVSGALLVIRGRRKK* |
| Ga0134123_106625775 | 3300010403 | Terrestrial Soil | IREVWFLMKSIGMMLLLVGVSSFAVAGGVVAPEISTASGVAAFALLSGTLLVIRGRRRK* |
| Ga0105246_101289822 | 3300011119 | Miscanthus Rhizosphere | MKSFGMILLLAGLSSFTIAGTLTVPEVSPASGLAALAMVSGVLLVIRGRRKK* |
| Ga0105246_107180942 | 3300011119 | Miscanthus Rhizosphere | MKLGGMIVLLLGFSSFAIAGFQGVPEISPASGVAAFALVSGALLVIRG |
| Ga0105246_114901221 | 3300011119 | Miscanthus Rhizosphere | LVLFGGLSGLVLASGPAVPEISPASGMAALALVSGALLIVRGRRKN* |
| Ga0105246_114901222 | 3300011119 | Miscanthus Rhizosphere | MKSIGMMLLLVGLSSFAVAGGVVAPEISPATGVSAFALLSGALLVIRGRRRK* |
| Ga0137388_109198671 | 3300012189 | Vadose Zone Soil | LGTMLLLVGLCQFASGGAVAAPEINPESGVAAFALLSGALLVIRGRRKS* |
| Ga0168317_10009275 | 3300012982 | Weathered Mine Tailings | MKILGMFLLLASVSSLAMAGTNPIPEISPASGAAAIALVSGALLVIRGRRKR* |
| Ga0163162_134081283 | 3300013306 | Switchgrass Rhizosphere | MKTFGLALLFAGLSSLAFAGTLAVPEISPASGVAALTLVSGAILVIRGRRK |
| Ga0157372_100180327 | 3300013307 | Corn Rhizosphere | MKFIGMVLLLAGFSSLAFAGAAPPAPEIGPASGVAALTLVSGAILVIRGRRKNRTGI* |
| Ga0157375_134268911 | 3300013308 | Miscanthus Rhizosphere | MKTFGFALLFAGLSSLAFAGTPTVPEISPASGVAALTLVSGAILVIRGRRK |
| Ga0157375_137753053 | 3300013308 | Miscanthus Rhizosphere | MKLGGMIVLLLGFSSFAIAGFQAVPEISPASGVAAFAIVSGALLVIRGRRKK* |
| Ga0163163_111779923 | 3300014325 | Switchgrass Rhizosphere | MKSIGLVLLLLGASSFAFAGLNVVAPEISPTSGVAALTLVSGAILVIRGRRKR* |
| Ga0182024_105901142 | 3300014501 | Permafrost | MKFAGMVLLVMGLSGLAMGAALAAPEISPATGLGALALLSGAILVIRGRRKH* |
| Ga0182024_105901143 | 3300014501 | Permafrost | MKSVGIVFLLVGFSTFAFAGFTSAPEISPASGVAALALVSGAILVIRGRRKK* |
| Ga0157377_105608981 | 3300014745 | Miscanthus Rhizosphere | MKFIGMALLLVSVASLAFAGATVAPEISPASGVAALTLISGAILVIRGRRKQ* |
| Ga0157379_101611393 | 3300014968 | Switchgrass Rhizosphere | MKSVGMVLLLAGLPTFAFAGGVIAPEISPASGVAALALVSGALLVIRGRRKK* |
| Ga0157376_105563361 | 3300014969 | Miscanthus Rhizosphere | MKFFGMALLLVAAASSAFAGGVTVPEISPASGVAALTLVSGAILVIR |
| Ga0132258_134654843 | 3300015371 | Arabidopsis Rhizosphere | MTKILGVTLVLIGVAQFAIAGGATPAPEISPGSAAAALALLSGAILVIRGRRRK* |
| Ga0187779_107429963 | 3300017959 | Tropical Peatland | MKFVGMALLLAGFSGLALAGGVAAPEIGPASGVGAVALLAGGILVIRGRRKQ |
| Ga0206356_108166723 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIAGVLVLLLGVSSFAFAGTPAVPEISAASGVAAITLVSGALLVIRGRRKR |
| Ga0206352_100012221 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIAGMLVLLLGVSSFAFAGTPAVPEISAASGVAAITLVSGALLVIRGRRKR |
| Ga0206353_100830092 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | WLSEEFLMKIAGMLVLLLGVSSFAFAGTPAVPEISAASGVAAITLVSGALLVIRGRRKR |
| Ga0210402_116536102 | 3300021478 | Soil | MKSFGMMLLLVGFASLAMAGASPTPEISPATGVAGLAMVSGAVLVIRGRRKKS |
| Ga0242657_11864242 | 3300022722 | Soil | ALLVIGCSGFVFAGGVAVPEVSPATGVGALALVSGAVLVIRGRRKK |
| Ga0207642_107398212 | 3300025899 | Miscanthus Rhizosphere | MKLGGMIVLLLGFSSFAIAGFQGVPEISPASGVAAFALVSGALLVIRGRRKK |
| Ga0207695_111313313 | 3300025913 | Corn Rhizosphere | TGGFNSMKSIGLVLLLLGASSFAFAGLNVVAPEISPASGVAALTLVSGAILVIRGRRKK |
| Ga0207671_100636464 | 3300025914 | Corn Rhizosphere | MKFIGMVLLLAGFSSLAFAGAPPPAPEIGPASGVAALTLVSGAILVIRGRRKK |
| Ga0207671_112018222 | 3300025914 | Corn Rhizosphere | MKIIGIALLLVGVASLAFAGTPVAPEISPASGVAALTLVSGAILVIRGRRKK |
| Ga0207671_112018223 | 3300025914 | Corn Rhizosphere | MKFIGMALLLVSVASLAFAGATVAPEISPASGVAALTLVSGAILVIRGRRKQ |
| Ga0207663_115170541 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKMIGIVLLLVSVASLAFAGGVVVPEISPASGVAGLTLVSGALLVIRGRRKQ |
| Ga0207646_112426572 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFSGMVLLVMGLSSLAMGAVVAAPEISPASGVAALALVSGAVLVIRGRRKH |
| Ga0207681_117260351 | 3300025923 | Switchgrass Rhizosphere | MKLVGMLVLFGGLSGLVVAGGPAVPEISPASGMSALALVSGALLVIRGRRKN |
| Ga0207694_1000515315 | 3300025924 | Corn Rhizosphere | MKSIGLVLLLLGASSFAFAGLNVVAPEISPASGVAALTLVSGAILVIRGRRKR |
| Ga0207687_117006751 | 3300025927 | Miscanthus Rhizosphere | MKIAGMMLLMMGLSGLVLGAVTTAPEISTASGLSALALLSGAILVIRGRRKNK |
| Ga0207686_105007221 | 3300025934 | Miscanthus Rhizosphere | MKSIGMMLLFAGLSSLAMAGVFVSAPEISPASGVAALALVSGAILVIRGRSRR |
| Ga0207686_105847612 | 3300025934 | Miscanthus Rhizosphere | MKFVGGVLLLAGLTTVAFAGGAAAPEVSPASGVAALALVSGAILVIRGRHRK |
| Ga0207686_106424502 | 3300025934 | Miscanthus Rhizosphere | MKFIGMALLLVSVASLAFAGATVAPEISPASGVAALTLVSGAILVIRGRRQK |
| Ga0207689_114253233 | 3300025942 | Miscanthus Rhizosphere | MKFIGMLVLFGGLSGLVLAGGPAVPEISPASGMAALALVSGALLIVRGRRK |
| Ga0207661_100181874 | 3300025944 | Corn Rhizosphere | MKSVGMAVLLLGLSSYAFAGLATVAPEISSASAVSAIALVSGAILVIRGRRKR |
| Ga0207679_119785672 | 3300025945 | Corn Rhizosphere | MKSIGMMLLLVGISSFAVAGGVVAPEISPASGTAALALVSGGLLVARGRRKR |
| Ga0207658_119758241 | 3300025986 | Switchgrass Rhizosphere | AAGARNRTGGFNSMKSIGLVLLLLGASSFAFAGLNVVAPEISPASGVAALTLVSGAILVIRGRRKR |
| Ga0207703_115738502 | 3300026035 | Switchgrass Rhizosphere | MKFFGMALLLVAAASSAFAGGVTVPEISPASGVAALTLVSGAIL |
| Ga0207702_112823973 | 3300026078 | Corn Rhizosphere | MKSIGMVLLLLGASSFAFASLAPAAPEISPASGVAALTLASGAILVIRG |
| Ga0207641_121319673 | 3300026088 | Switchgrass Rhizosphere | MKFIGMLVLFGGLSGLVLAGGPAVPEISPASGMAALALVSGALLIVRGRRKK |
| Ga0207676_106612933 | 3300026095 | Switchgrass Rhizosphere | MLLLVGVSTLAMAGSPNVPEVSPASGLAALAMVSGALLVIRGRRKK |
| Ga0207676_106612936 | 3300026095 | Switchgrass Rhizosphere | VLLLGFSSFAIAGFQGVPEISPASGVAAFALVSGALLVIRGRRKK |
| Ga0207676_106776003 | 3300026095 | Switchgrass Rhizosphere | MKSIGMMLLLVGISSFAVAGGVVAPEISPATGVSAFALLSGALLVIRGRRRK |
| Ga0207676_110612362 | 3300026095 | Switchgrass Rhizosphere | GVRNNEGVWIDMKLIGMMLLLAGFASCAFAAVPEISPASGTAALALVSGGLLVARGRRKR |
| Ga0207676_118392991 | 3300026095 | Switchgrass Rhizosphere | MKFVGTMLFFVGLSSLAMAGSTNVPEVSPASGAAALALISGALLVIRGRRRK |
| Ga0207674_108286762 | 3300026116 | Corn Rhizosphere | MKLVGMLVLFGGLSGLVVAGGPAVPEISPASGMAALALVSGALLIVRGRRKK |
| Ga0209517_100054074 | 3300027854 | Peatlands Soil | MKFVGMVLFFVGLSSVAMAGGSAAPEISPASGVAALALVSGALLVIRGRRKK |
| Ga0209517_100233354 | 3300027854 | Peatlands Soil | MKFGIVLVLTSFSSLAFAGTGTAPEIGPESGVGAVALLAGAILVIRSRRKR |
| Ga0209415_1001720512 | 3300027905 | Peatlands Soil | MKSVGLVMLLVGLSTLAFAGEPTAPEISPASGVAAIALVSGAVLVIRSRRKK |
| Ga0268264_117567951 | 3300028381 | Switchgrass Rhizosphere | MKLGGMIVLLLGFSSFAIAGFQGFPEISPASGVAAFALVSGALLVIRGRRKK |
| Ga0170834_1026981341 | 3300031057 | Forest Soil | MKTVGMILLLIGCSGFVFAGAPSTPEISPATGVAALAMVSGSVLVIRGRRKK |
| Ga0170834_1026981342 | 3300031057 | Forest Soil | MKTFGMALLLIGCSGFCFAAAVAAPEISPASGVTAIALVSGAVLVIRGRRKK |
| Ga0170834_1036390731 | 3300031057 | Forest Soil | MKPIGMVLILVGISTFAFAGGPTVPEVGPASGVAALALVSGALLVIRGRRKK |
| Ga0170824_1014277982 | 3300031231 | Forest Soil | MKSFGMLLLLAGFASLAMAGPPAAPEISPATGVAGLALVSGAVLVIRGRRKKS |
| Ga0170824_1014277983 | 3300031231 | Forest Soil | MKSVGMLLLLVGFASLAMAGVGSAPEISPATGVAGLALVSGAVLVIRGRRKKS |
| Ga0170824_1123455213 | 3300031231 | Forest Soil | MKTVGMILLLIGCSGFVFAGAPATPEISPATGVAALALVSGAVLVIRGRRKK |
| Ga0170824_1217192851 | 3300031231 | Forest Soil | MKSIGMVLLLLGASSFAFAGLNVVAPEISPASGVAALTLVSGAILVIRGRRKR |
| Ga0302322_1010771802 | 3300031902 | Fen | MKSLGLVLLLVGLSTFALAGGGIAPEISPASGVSALALVSGALLVMRGRRKK |
| Ga0311301_1000519224 | 3300032160 | Peatlands Soil | MKFAGMVLVLAGFSSLAFAGGVAAPEIGPASGVGAVALLAGAILVIRGRRKK |
| Ga0311301_108423201 | 3300032160 | Peatlands Soil | MKSIGIAFLLVGFSAFAFAGSARAPEISPASGVAALAMISGALLVIRGRRKK |
| Ga0311301_108423202 | 3300032160 | Peatlands Soil | MKFAGIALLLMGLASIAFAGIHTVPEIGPVSGVAALALVSGALLVIRGRRKK |
| Ga0310810_110877992 | 3300033412 | Soil | MKFLGIMLLLAGVSSFAMAGAAAAPEISPASGVGALALLSGGLLVIRGRSRK |
| ⦗Top⦘ |