| Basic Information | |
|---|---|
| Family ID | F051514 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MVHVRDAKSGDIEVFSGTSQTRLRDKDLAARIARAIG |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 5.59 % |
| % of genes near scaffold ends (potentially truncated) | 89.58 % |
| % of genes from short scaffolds (< 2000 bps) | 90.28 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.722 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (47.222 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.722 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.444 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.92% β-sheet: 26.15% Coil/Unstructured: 56.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF14224 | DUF4331 | 91.67 |
| PF10099 | RskA | 2.08 |
| PF00881 | Nitroreductase | 0.69 |
| PF01381 | HTH_3 | 0.69 |
| PF01274 | Malate_synthase | 0.69 |
| PF01229 | Glyco_hydro_39 | 0.69 |
| PF12802 | MarR_2 | 0.69 |
| PF00708 | Acylphosphatase | 0.69 |
| PF04264 | YceI | 0.69 |
| PF01810 | LysE | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG2225 | Malate synthase | Energy production and conversion [C] | 0.69 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.69 |
| COG3664 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.72 % |
| All Organisms | root | All Organisms | 40.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001686|C688J18823_10884586 | Not Available | 567 | Open in IMG/M |
| 3300004091|Ga0062387_101216400 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300004121|Ga0058882_1740564 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005542|Ga0070732_10074517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1981 | Open in IMG/M |
| 3300005610|Ga0070763_10526746 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005616|Ga0068852_100158100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2113 | Open in IMG/M |
| 3300006028|Ga0070717_11334944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 652 | Open in IMG/M |
| 3300006163|Ga0070715_10191991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1032 | Open in IMG/M |
| 3300007076|Ga0075435_100930171 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300009090|Ga0099827_10207334 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
| 3300009101|Ga0105247_10106343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1800 | Open in IMG/M |
| 3300009522|Ga0116218_1112195 | Not Available | 1241 | Open in IMG/M |
| 3300009525|Ga0116220_10343981 | Not Available | 661 | Open in IMG/M |
| 3300009628|Ga0116125_1172156 | Not Available | 607 | Open in IMG/M |
| 3300009628|Ga0116125_1209199 | Not Available | 557 | Open in IMG/M |
| 3300010361|Ga0126378_12808103 | Not Available | 556 | Open in IMG/M |
| 3300010364|Ga0134066_10166928 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300010379|Ga0136449_100310647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2865 | Open in IMG/M |
| 3300010379|Ga0136449_102352179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 770 | Open in IMG/M |
| 3300010379|Ga0136449_102776425 | Not Available | 692 | Open in IMG/M |
| 3300010880|Ga0126350_10230949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1093 | Open in IMG/M |
| 3300011120|Ga0150983_16704192 | Not Available | 515 | Open in IMG/M |
| 3300011270|Ga0137391_10004640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10504 | Open in IMG/M |
| 3300013764|Ga0120111_1027057 | Not Available | 1560 | Open in IMG/M |
| 3300014169|Ga0181531_10041507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2675 | Open in IMG/M |
| 3300014493|Ga0182016_10588981 | Not Available | 634 | Open in IMG/M |
| 3300014655|Ga0181516_10428268 | Not Available | 677 | Open in IMG/M |
| 3300017654|Ga0134069_1121407 | Not Available | 861 | Open in IMG/M |
| 3300017822|Ga0187802_10423137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
| 3300017924|Ga0187820_1144303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 713 | Open in IMG/M |
| 3300017973|Ga0187780_10017960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5114 | Open in IMG/M |
| 3300017975|Ga0187782_11149723 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300018035|Ga0187875_10274497 | Not Available | 916 | Open in IMG/M |
| 3300018043|Ga0187887_10723544 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300018047|Ga0187859_10343925 | Not Available | 812 | Open in IMG/M |
| 3300020580|Ga0210403_11290971 | Not Available | 558 | Open in IMG/M |
| 3300020583|Ga0210401_11082240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
| 3300021180|Ga0210396_10420978 | Not Available | 1173 | Open in IMG/M |
| 3300021181|Ga0210388_11131195 | Not Available | 667 | Open in IMG/M |
| 3300021362|Ga0213882_10225063 | Not Available | 776 | Open in IMG/M |
| 3300021401|Ga0210393_11016867 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300021402|Ga0210385_10380833 | Not Available | 1057 | Open in IMG/M |
| 3300021402|Ga0210385_10664184 | Not Available | 797 | Open in IMG/M |
| 3300021402|Ga0210385_11193164 | Not Available | 584 | Open in IMG/M |
| 3300021402|Ga0210385_11282957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300021403|Ga0210397_10970310 | Not Available | 659 | Open in IMG/M |
| 3300021407|Ga0210383_11129061 | Not Available | 661 | Open in IMG/M |
| 3300021475|Ga0210392_10618646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 804 | Open in IMG/M |
| 3300021478|Ga0210402_11808517 | Not Available | 537 | Open in IMG/M |
| 3300021478|Ga0210402_11837878 | Not Available | 532 | Open in IMG/M |
| 3300022523|Ga0242663_1109828 | Not Available | 558 | Open in IMG/M |
| 3300022528|Ga0242669_1080357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 604 | Open in IMG/M |
| 3300022557|Ga0212123_10005229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 23321 | Open in IMG/M |
| 3300022709|Ga0222756_1038967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 680 | Open in IMG/M |
| 3300022734|Ga0224571_106254 | Not Available | 792 | Open in IMG/M |
| 3300024176|Ga0224565_1038337 | Not Available | 551 | Open in IMG/M |
| 3300024227|Ga0228598_1042412 | Not Available | 899 | Open in IMG/M |
| 3300024271|Ga0224564_1052390 | Not Available | 797 | Open in IMG/M |
| 3300025633|Ga0208480_1125255 | Not Available | 595 | Open in IMG/M |
| 3300025924|Ga0207694_10120408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2095 | Open in IMG/M |
| 3300027371|Ga0209418_1009010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1530 | Open in IMG/M |
| 3300027648|Ga0209420_1103517 | Not Available | 807 | Open in IMG/M |
| 3300027692|Ga0209530_1164474 | Not Available | 619 | Open in IMG/M |
| 3300027768|Ga0209772_10046651 | Not Available | 1285 | Open in IMG/M |
| 3300027853|Ga0209274_10027406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2622 | Open in IMG/M |
| 3300027855|Ga0209693_10232053 | Not Available | 906 | Open in IMG/M |
| 3300027857|Ga0209166_10464622 | Not Available | 653 | Open in IMG/M |
| 3300027884|Ga0209275_10354613 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300027889|Ga0209380_10261708 | Not Available | 1016 | Open in IMG/M |
| 3300027894|Ga0209068_10809907 | Not Available | 552 | Open in IMG/M |
| 3300027908|Ga0209006_10266236 | Not Available | 1471 | Open in IMG/M |
| 3300027908|Ga0209006_11438322 | Not Available | 525 | Open in IMG/M |
| 3300028801|Ga0302226_10503071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300029910|Ga0311369_10425769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1146 | Open in IMG/M |
| 3300029951|Ga0311371_10034070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9044 | Open in IMG/M |
| 3300030399|Ga0311353_11041742 | Not Available | 683 | Open in IMG/M |
| 3300030520|Ga0311372_10434026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1969 | Open in IMG/M |
| 3300030617|Ga0311356_10313872 | Not Available | 1568 | Open in IMG/M |
| 3300030617|Ga0311356_10909404 | Not Available | 828 | Open in IMG/M |
| 3300030740|Ga0265460_10020047 | Not Available | 1870 | Open in IMG/M |
| 3300030740|Ga0265460_12950691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 511 | Open in IMG/M |
| 3300030743|Ga0265461_10549769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 974 | Open in IMG/M |
| 3300030743|Ga0265461_12118064 | Not Available | 647 | Open in IMG/M |
| 3300030743|Ga0265461_13616424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300031236|Ga0302324_100558614 | Not Available | 1654 | Open in IMG/M |
| 3300031543|Ga0318516_10174288 | Not Available | 1238 | Open in IMG/M |
| 3300031543|Ga0318516_10561018 | Not Available | 653 | Open in IMG/M |
| 3300031544|Ga0318534_10298262 | Not Available | 928 | Open in IMG/M |
| 3300031544|Ga0318534_10845756 | Not Available | 513 | Open in IMG/M |
| 3300031564|Ga0318573_10626927 | Not Available | 578 | Open in IMG/M |
| 3300031572|Ga0318515_10251749 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300031572|Ga0318515_10450328 | Not Available | 688 | Open in IMG/M |
| 3300031640|Ga0318555_10765032 | Not Available | 521 | Open in IMG/M |
| 3300031668|Ga0318542_10032292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2265 | Open in IMG/M |
| 3300031668|Ga0318542_10323370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 791 | Open in IMG/M |
| 3300031680|Ga0318574_10378535 | Not Available | 826 | Open in IMG/M |
| 3300031680|Ga0318574_10551812 | Not Available | 675 | Open in IMG/M |
| 3300031682|Ga0318560_10537189 | Not Available | 633 | Open in IMG/M |
| 3300031713|Ga0318496_10443856 | Not Available | 717 | Open in IMG/M |
| 3300031724|Ga0318500_10065736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1580 | Open in IMG/M |
| 3300031744|Ga0306918_10927793 | Not Available | 678 | Open in IMG/M |
| 3300031747|Ga0318502_10119961 | Not Available | 1476 | Open in IMG/M |
| 3300031747|Ga0318502_10277733 | Not Available | 982 | Open in IMG/M |
| 3300031748|Ga0318492_10421446 | Not Available | 703 | Open in IMG/M |
| 3300031751|Ga0318494_10257292 | Not Available | 1002 | Open in IMG/M |
| 3300031768|Ga0318509_10294552 | Not Available | 908 | Open in IMG/M |
| 3300031770|Ga0318521_10238969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1058 | Open in IMG/M |
| 3300031797|Ga0318550_10049259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1888 | Open in IMG/M |
| 3300031799|Ga0318565_10209066 | Not Available | 949 | Open in IMG/M |
| 3300031831|Ga0318564_10023938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2558 | Open in IMG/M |
| 3300031831|Ga0318564_10042401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1968 | Open in IMG/M |
| 3300031845|Ga0318511_10386139 | Not Available | 640 | Open in IMG/M |
| 3300031846|Ga0318512_10121881 | Not Available | 1241 | Open in IMG/M |
| 3300031859|Ga0318527_10169209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 920 | Open in IMG/M |
| 3300031860|Ga0318495_10539455 | Not Available | 507 | Open in IMG/M |
| 3300031869|Ga0316030_109652 | Not Available | 553 | Open in IMG/M |
| 3300031870|Ga0316029_108900 | Not Available | 551 | Open in IMG/M |
| 3300031880|Ga0318544_10166395 | Not Available | 848 | Open in IMG/M |
| 3300031893|Ga0318536_10525192 | Not Available | 594 | Open in IMG/M |
| 3300031894|Ga0318522_10177643 | Not Available | 805 | Open in IMG/M |
| 3300031897|Ga0318520_10161705 | Not Available | 1304 | Open in IMG/M |
| 3300031897|Ga0318520_10576609 | Not Available | 698 | Open in IMG/M |
| 3300031910|Ga0306923_12037118 | Not Available | 581 | Open in IMG/M |
| 3300031912|Ga0306921_11860056 | Not Available | 645 | Open in IMG/M |
| 3300032008|Ga0318562_10764172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300032035|Ga0310911_10661346 | Not Available | 606 | Open in IMG/M |
| 3300032043|Ga0318556_10132561 | Not Available | 1279 | Open in IMG/M |
| 3300032054|Ga0318570_10522979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300032060|Ga0318505_10289612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300032063|Ga0318504_10614627 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300032065|Ga0318513_10562336 | Not Available | 558 | Open in IMG/M |
| 3300032089|Ga0318525_10246532 | Not Available | 918 | Open in IMG/M |
| 3300032160|Ga0311301_10231574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3089 | Open in IMG/M |
| 3300032180|Ga0307471_101874524 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300032261|Ga0306920_101005095 | Not Available | 1214 | Open in IMG/M |
| 3300032770|Ga0335085_12552395 | Not Available | 506 | Open in IMG/M |
| 3300032805|Ga0335078_11455930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 769 | Open in IMG/M |
| 3300032893|Ga0335069_10142877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2973 | Open in IMG/M |
| 3300033158|Ga0335077_11450928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 659 | Open in IMG/M |
| 3300033289|Ga0310914_10345940 | Not Available | 1344 | Open in IMG/M |
| 3300033289|Ga0310914_10352756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1330 | Open in IMG/M |
| 3300033289|Ga0310914_10809310 | Not Available | 835 | Open in IMG/M |
| 3300034124|Ga0370483_0068940 | Not Available | 1137 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 47.22% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.86% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.08% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.39% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.39% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.39% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.39% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.39% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.39% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.39% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.39% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.39% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.39% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.69% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.69% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.69% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.69% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.69% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.69% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031869 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031870 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI1 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J18823_108845862 | 3300001686 | Soil | AQSQDHHEHAGPIMVHVRDARTGDIEVFSGTSQTQLRDKDLAARIARALA* |
| Ga0062387_1012164002 | 3300004091 | Bog Forest Soil | HVHGEAKTPAGPIMVQVRDAKSGDIEVLSGTSQTRVRDKDLAARIARAIG* |
| Ga0058882_17405642 | 3300004121 | Forest Soil | EPIVVHVRNARTGDIEVFSGTSQTRLRDKDLAARIARAIG* |
| Ga0070732_100745171 | 3300005542 | Surface Soil | HVRDARSGDIEVFSGTSQIRLRDKDLAARISRAFG* |
| Ga0070763_105267462 | 3300005610 | Soil | VVHVRNAKSGDIEVFSGTSQTSLRDRDLAARIVRAIG* |
| Ga0068852_1001581004 | 3300005616 | Corn Rhizosphere | VVHVRDARSGDIEVFAGTSQSRLRDKDLAARIARAIG* |
| Ga0070717_113349442 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | HVRDARSGDIEVFAGTSQTRLRDQDLAARIARAIG* |
| Ga0070715_101919911 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | HVRDARSGDIEVFAGTSQTRVRDKDLAARIARAIG* |
| Ga0075435_1009301712 | 3300007076 | Populus Rhizosphere | IVVHVRDARSGDIEVFAGTSQSRLRDKDLAARIARAIG* |
| Ga0099827_102073342 | 3300009090 | Vadose Zone Soil | MPAGPIMVHVRDAKAGDIEVFSGTSQTRLRDKDLAARIARAIG* |
| Ga0105247_101063431 | 3300009101 | Switchgrass Rhizosphere | VRDARSGDIEVFAGTSQSRLRDKDLAARIARAIG* |
| Ga0116218_11121952 | 3300009522 | Peatlands Soil | MVHVRDARSGDIEVFSGTSQTRLRDADLAARIARAIG* |
| Ga0116220_103439811 | 3300009525 | Peatlands Soil | IVVHVRDARSGDIEELSGTRETSLRDKDLAARIVREIG* |
| Ga0116125_11721561 | 3300009628 | Peatland | GHSEPKAVDGPIMVHVRDAKSGDIEVFSGTSKTRLNDKHLAALITRAIG* |
| Ga0116125_12091991 | 3300009628 | Peatland | APQVAGSIMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG* |
| Ga0126378_128081032 | 3300010361 | Tropical Forest Soil | HVRDARSGDIEVFSGTSQTRLRDAGLAARIARAIG* |
| Ga0134066_101669281 | 3300010364 | Grasslands Soil | DTAAGPIMVHVRDTRSGDIEVFAGTGQTRLRDKDLAARIARAIG* |
| Ga0136449_1003106471 | 3300010379 | Peatlands Soil | EDQLPSGAIVLNVRDVKSGDIEVFYGTSQVQLQDKELTARIARAIG* |
| Ga0136449_1023521791 | 3300010379 | Peatlands Soil | VHDHGEASSPAGPIMVHVRDVRSGDIEVFSGTSQTRLRDADLAARLARAIG* |
| Ga0136449_1027764252 | 3300010379 | Peatlands Soil | MVHVRDAKSGDIEVFSGTSQTRLRDKDLAARIARAIG* |
| Ga0126350_102309491 | 3300010880 | Boreal Forest Soil | GPVVVHVRDAKSGDIEVFSGTSQTSLRDKDLAARIVRAIG* |
| Ga0150983_167041921 | 3300011120 | Forest Soil | APAHGDLKAPSGPIVVHVRNAKSGDIEVFSGTSQTRLRDKDLAARIVRAIA* |
| Ga0137391_100046409 | 3300011270 | Vadose Zone Soil | MPAGPIMVHVRDAKAGDIEVFSGISQTRLRDKDLAARIARAIG* |
| Ga0120111_10270572 | 3300013764 | Permafrost | APGDLVVHVRDAGSGEMDVFTGTSQIRLRDKDLAARLIRAIG* |
| Ga0181531_100415072 | 3300014169 | Bog | VVHVRNAKSGDIEVFSGTSQTRLQDKDLAARIARAIG* |
| Ga0182016_105889811 | 3300014493 | Bog | MVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG* |
| Ga0181516_104282681 | 3300014655 | Bog | APAPAPDVAGSIMVHVRDARSGDIEVFSGTSKTRLHDKDLAARIARAIG* |
| Ga0134069_11214071 | 3300017654 | Grasslands Soil | HVRDARSGDIEVFAGTSQTRLRDQDLAARIARAIG |
| Ga0187802_104231371 | 3300017822 | Freshwater Sediment | GHGDAKTPAGPIMVHVRDAGSGDIEVFSGTSQTRLRDADLAARLARAIG |
| Ga0187820_11443031 | 3300017924 | Freshwater Sediment | PIVVHVRDAKSGDIEVFAGTSQTRLRDTDLAARIARVVG |
| Ga0187780_100179604 | 3300017973 | Tropical Peatland | VVHVRNAKSGDIEVFSGTSQNRLRDKDLANRIARAIG |
| Ga0187782_111497231 | 3300017975 | Tropical Peatland | IVVHVRDARSGDIEVLSGTSQTRLRDKVLAARIARAIG |
| Ga0187875_102744972 | 3300018035 | Peatland | GAIMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARVIS |
| Ga0187887_107235441 | 3300018043 | Peatland | IMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG |
| Ga0187859_103439252 | 3300018047 | Peatland | GSAAEGSAAAPAGAIMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARVIS |
| Ga0210403_112909712 | 3300020580 | Soil | QSPGQPHRGAPAEPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG |
| Ga0210401_110822401 | 3300020583 | Soil | AGPVVVHVRDAKSGDSEVFSGTSQTSVRDKDLAARIVRAIG |
| Ga0210396_104209782 | 3300021180 | Soil | MVHVRDAGSGDIEVFSGTSQTRVRDKDLAARIARAVG |
| Ga0210388_111311951 | 3300021181 | Soil | DQPKLPSGPIVLNVRDAKSGDIEVFYGTSQVQLQDKELTARIARAIG |
| Ga0213882_102250632 | 3300021362 | Exposed Rock | VHVRDARSGDIEVFSGISATRLRDKDLAARIARAIG |
| Ga0210393_110168672 | 3300021401 | Soil | PQVAGPIMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG |
| Ga0210385_103808331 | 3300021402 | Soil | HGHGAAKTPAGPIMVHVRDAGSGDIEVFSGTSQTRVRDKDLAARIARAVG |
| Ga0210385_106641842 | 3300021402 | Soil | VVHVRNARTGDIEVFSGASQTRLRDKDLAARIARAAR |
| Ga0210385_111931642 | 3300021402 | Soil | PIVVHVRDAKSGDIEVLSGTSETRLRDKDLAARIVRAIG |
| Ga0210385_112829572 | 3300021402 | Soil | LKAPAGPVVVHVRDAKSGDIEVFSGTSQTSLRDKDLAARIVRAIG |
| Ga0210397_109703102 | 3300021403 | Soil | VVHVRNAKSGDIEVFSGTSQTRLRDKDLAARIARAIG |
| Ga0210383_111290612 | 3300021407 | Soil | MVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG |
| Ga0210392_106186462 | 3300021475 | Soil | QPHGEAPAGPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG |
| Ga0210402_118085172 | 3300021478 | Soil | VHVRDARSGDIEVFHGTSQSRLRDTDLAARIARAVG |
| Ga0210402_118378782 | 3300021478 | Soil | HVRDARSGDIEVFAGTSQTRVRDKDLAARITRAIG |
| Ga0242663_11098282 | 3300022523 | Soil | PIVVHVRNAKSGDIEVFSGTSQTSLRDKDLAARIARAIG |
| Ga0242669_10803571 | 3300022528 | Soil | DQPHGHDTAGGPIMVHVRDARTGDIEVFAGTSQTRLRDKDLAARIARAIG |
| Ga0212123_1000522924 | 3300022557 | Iron-Sulfur Acid Spring | VVHVRDARSGDIEVFAGTRQTRLRDQDLAARIARATR |
| Ga0222756_10389671 | 3300022709 | Soil | GPVVVHVRDAKSGDIEVFSGTSQTSLRDKDLAARIVRAIG |
| Ga0224571_1062541 | 3300022734 | Rhizosphere | AKTPAGPIMVHVRDAGSGDIEVFSGTSQTRVRDRDLAARIARAVG |
| Ga0224565_10383372 | 3300024176 | Plant Litter | DARTGDIEVFSGTSQTRLRDRDLAARIARASQQGR |
| Ga0228598_10424121 | 3300024227 | Rhizosphere | AGGEVKAPAGPIVVHVRNAKSGDIEVFSGTGQTRLRDTDLAARIARAIG |
| Ga0224564_10523902 | 3300024271 | Soil | KTPAGPIMVHVRDAGSGDIEVFSGTSQTRVRDKDLAARIARAVG |
| Ga0208480_11252551 | 3300025633 | Arctic Peat Soil | SEAAGPITVHVRDAKTGDIEIFEGTRETRLRDKDLAARIARAIA |
| Ga0207694_101204081 | 3300025924 | Corn Rhizosphere | VVHVRDARSGDIEVFAGTSQSRLRDKDLAARIARAIG |
| Ga0209418_10090101 | 3300027371 | Forest Soil | PPAPDRSSGRTPAGPIMVHVRDTRSGDIEVFAGTSQARLRDKDLAARIARAIG |
| Ga0209420_11035172 | 3300027648 | Forest Soil | VHVRDAKSGDIEVLSGTSKTRLRDKDLAARIARAIG |
| Ga0209530_11644742 | 3300027692 | Forest Soil | AGSIMVHVRDAKSGDIEVLSGTSKTRLRDKDLAARIARAIG |
| Ga0209772_100466511 | 3300027768 | Bog Forest Soil | VVVHVRNAKSGDIEVFSGTSQTSLRDKDLAARIVRAIG |
| Ga0209274_100274061 | 3300027853 | Soil | ATPPLEPIVVHVRDAKSGDIEVFHGTSQTRLRDQDLAARIARAIA |
| Ga0209693_102320532 | 3300027855 | Soil | APSGPVVVHVRNTTSGDIEVFSGTSQTSLRDKDLAARIVRAIR |
| Ga0209166_104646222 | 3300027857 | Surface Soil | ADGPIVVHVRNAKSGDIEVFSGTGQTRVRDADLAARIVRAIA |
| Ga0209275_103546132 | 3300027884 | Soil | VVHVRDAKSGDIEVFSGTSQIRLRDRDLAARISRAFG |
| Ga0209380_102617081 | 3300027889 | Soil | GGDVKAPAGPVVVHVRNAKSGDIEVFSGTSQTRLRDKDLAARIVRAIA |
| Ga0209068_108099071 | 3300027894 | Watersheds | IMVHVRDARSGDIEVFSGTSQTRVRDKDLAARIARAVG |
| Ga0209006_102662361 | 3300027908 | Forest Soil | ITVHVRDARTGDIEVFSGTSQTRLRDKDLAARIARAIA |
| Ga0209006_114383221 | 3300027908 | Forest Soil | HVRDARSGDIEVFSGTSQTRLRDKDLAARIARAIG |
| Ga0302226_105030711 | 3300028801 | Palsa | DGPIMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG |
| Ga0311369_104257692 | 3300029910 | Palsa | PPRHGAPQFAGPIMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG |
| Ga0311371_100340701 | 3300029951 | Palsa | QFAGPIMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG |
| Ga0311353_110417421 | 3300030399 | Palsa | HVRDAKTGDIEVFSGTSQTRLRDKDLAARIARAIA |
| Ga0311372_104340263 | 3300030520 | Palsa | AGPITVHVRDAKTGDIEVFAGTSQTRLRDKDLAARIARAIA |
| Ga0311356_103138721 | 3300030617 | Palsa | HVRDAKTGDIEVFAGTSQTRLRDKDLAARIARAIA |
| Ga0311356_109094041 | 3300030617 | Palsa | KPATAAGPLVVHVRDAKTGDIEVFHGTSATRLRDKDLAARIAAAIR |
| Ga0265460_100200472 | 3300030740 | Soil | VVHVRNAKSGDIEGFSGTSQTSLRDKDLAARIARAIG |
| Ga0265460_129506912 | 3300030740 | Soil | RHSAPQVAGPIMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG |
| Ga0265461_105497691 | 3300030743 | Soil | HSEPIVVHVRNARSGDIEVFSGTSQTRLRDKDLAARIARAAR |
| Ga0265461_121180642 | 3300030743 | Soil | FSPIVVHVRDARSGDIEVLSGTRGTRLRDKDLAARIARAIG |
| Ga0265461_136164241 | 3300030743 | Soil | PKDTAGPVVVHVRDAKSGDIEVFSGTSQTRLRDKDLAARIVRAIG |
| Ga0302324_1005586141 | 3300031236 | Palsa | EVAGPITVHVRDAKTGDIEVFAGTSQTRLRDKDLAARIARAIA |
| Ga0318516_101742882 | 3300031543 | Soil | VHVRDARSGDIEVFAGTSQTRLRDQDLAARIARSIG |
| Ga0318516_105610182 | 3300031543 | Soil | IMVHVRDARSGDIELFSGTSQTRLRDKDLAARIARAIG |
| Ga0318534_102982621 | 3300031544 | Soil | IIVHVRNAASGDIEVFSGTSQTRLRDAGLAARIARAIG |
| Ga0318534_108457563 | 3300031544 | Soil | AAGREVKAPAGPIVLHVRDAGSGDIEVFSGTSQTRLRDTDLAARITRVIG |
| Ga0318573_106269272 | 3300031564 | Soil | MVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG |
| Ga0318515_102517492 | 3300031572 | Soil | VVHVRDAGSGDIEVFSGTSQTRLRDTDLAARITRVIG |
| Ga0318515_104503282 | 3300031572 | Soil | VHVRDARTGDIEVFSGTSQSRVRDQDLAARIARAIS |
| Ga0318555_107650322 | 3300031640 | Soil | VHVRDAGSGDIEVFSGTSQTRLRDTDLAARITRVIG |
| Ga0318542_100322921 | 3300031668 | Soil | IVHVRDARSGDIEVFAGTSQTRLRDQDLAARIARSIG |
| Ga0318542_103233701 | 3300031668 | Soil | PPSQSPGRAPAGPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG |
| Ga0318574_103785352 | 3300031680 | Soil | IVVHVRNAKSGDIEVFSGTDQTRLRDTDLAARIARAIG |
| Ga0318574_105518122 | 3300031680 | Soil | MVHVRDARSGDIEVFAGTSQARLRDQDLAARIARAIG |
| Ga0318560_105371892 | 3300031682 | Soil | ISVHVRNAASGDIEVFSGTSQTRLRDAGLAARIARAIG |
| Ga0318496_104438561 | 3300031713 | Soil | IVVHVRNATSGDIEVFSGTSQTRLRDAGLAARIARAIG |
| Ga0318500_100657361 | 3300031724 | Soil | SPGRAPAGPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG |
| Ga0306918_109277932 | 3300031744 | Soil | IVVHVRDAGSGDIEVFSGTSQTRLRDTDLAARITRVIG |
| Ga0318502_101199611 | 3300031747 | Soil | VKAPSGPIIVHVRNAASGDIEVFSGTSQTRLRDAGLAARIARAIG |
| Ga0318502_102777331 | 3300031747 | Soil | SGPIVVHVRNAKSGEIDVFSGTSQTRLRDKDLAARIARTVR |
| Ga0318492_104214461 | 3300031748 | Soil | IMVHVRDAKSGDIEVFSGTSQTRLRDTDLAARIARAIG |
| Ga0318494_102572922 | 3300031751 | Soil | VHVRDTRSGDIEVFAGTSQARLRDKDLAARIARAIG |
| Ga0318509_102945521 | 3300031768 | Soil | PIVVHVRDAGSGDIEVFSGTSQTRLRDTDLAARITRVIG |
| Ga0318521_102389691 | 3300031770 | Soil | PIVVHVRDAKSGDIEVFSGTSQTRLRDTDLAARIARAIG |
| Ga0318550_100492591 | 3300031797 | Soil | VHVRDARSGDIEVFAGTSQTRLRDQDLAARIARALG |
| Ga0318565_102090662 | 3300031799 | Soil | MVHVRDAKSGDIEVFSGTSQTRLRDTDLAARIARAIG |
| Ga0318564_100239384 | 3300031831 | Soil | VHVRNAASGDIEVFSGTSQTRLRDAGLAARIARAIG |
| Ga0318564_100424011 | 3300031831 | Soil | PIVVHVRDAESGDIEVFSGTSQTRLRDTDLAARITRAIG |
| Ga0318511_103861391 | 3300031845 | Soil | VVHVRNAKSGEIDVFSGTSQTRLRDKDLAARIARTVR |
| Ga0318512_101218811 | 3300031846 | Soil | VVHVRNAKSGDIEVFSGTDQTRLRDTDLAARIARAIG |
| Ga0318527_101692091 | 3300031859 | Soil | GPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG |
| Ga0318495_105394551 | 3300031860 | Soil | PIVVHVRNATSGDIEVFSGTSQTRLRDAGLAALIARAIG |
| Ga0316030_1096521 | 3300031869 | Soil | HVRDLKTGDIEVFSGTKQTRVRDRALAARIASAIS |
| Ga0316029_1089002 | 3300031870 | Soil | VHVRDLKTGDIEVFSGTKQTRVRDRALAARIASAIS |
| Ga0318544_101663952 | 3300031880 | Soil | EVKAPSGPIIVHVRNAASGDIEVFSGTSQTRLRDAGLAARIARAIG |
| Ga0318536_105251921 | 3300031893 | Soil | VHVRDAKSGDIEVFSGTSQTRLRDTDLAARIARAIG |
| Ga0318522_101776431 | 3300031894 | Soil | HVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG |
| Ga0318520_101617051 | 3300031897 | Soil | VHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG |
| Ga0318520_105766091 | 3300031897 | Soil | VHVRNATSGDIEVFSGTSQTRLRDAGLAALIARAIG |
| Ga0306923_120371182 | 3300031910 | Soil | GREVKAPAGPIVLHVRDAGSGDIEVFSGTSQTRLRDTDLAARITRVIG |
| Ga0306921_118600562 | 3300031912 | Soil | MVHVRDARSGDIEVFAGTSQTRLRDKDLAARIARAIG |
| Ga0310913_103669611 | 3300031945 | Soil | QSPRQSPGRAPAGPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG |
| Ga0318562_107641722 | 3300032008 | Soil | PAGPIMVHVRDTRSGDIEVFAGTSQTRLRDTDLAARIARAIG |
| Ga0310911_106613461 | 3300032035 | Soil | PIVVHVRNAKSGDIEVFSGTSQTRLRDTDLAARIARAIG |
| Ga0318556_101325611 | 3300032043 | Soil | IMVHVRDARSGDIEVFAGTSQTRLRDQDLAARIARSIG |
| Ga0318570_105229791 | 3300032054 | Soil | PAGPIMVHVRDTRSGDIEVFAGTSQARLRDQDLAARIARAIG |
| Ga0318505_102896121 | 3300032060 | Soil | ARAPAGPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG |
| Ga0318504_106146272 | 3300032063 | Soil | IRAPAGPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG |
| Ga0318513_105623362 | 3300032065 | Soil | IVVHVRDAKSGDIEVFSGTSQTRLRDTDLAARITRAIG |
| Ga0318525_102465322 | 3300032089 | Soil | IVHVRNAASGDIEVFSGTSQTRLRDAGLAARIARAIG |
| Ga0311301_102315741 | 3300032160 | Peatlands Soil | VLNVRDVKSGDIEVFYGTSQVQLQDKELTARIARAIG |
| Ga0307471_1018745241 | 3300032180 | Hardwood Forest Soil | SPGQPHRGAPAEPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLATRIARAAG |
| Ga0306920_1010050952 | 3300032261 | Soil | VVHVRDAKSGDIEVFSGTSQTRLRDTDLAARIARAIG |
| Ga0335085_125523952 | 3300032770 | Soil | AHARLPGREPAGPIMVHVRDTRSGDIEVFAGTSQTRLRDPDLAALIARAIG |
| Ga0335078_114559301 | 3300032805 | Soil | HRGAAAEPIMVHVRDTRSGDIEVFAGTSQTRLRDQDLAARITRAIG |
| Ga0335069_101428771 | 3300032893 | Soil | MLHVRDTRSGDIEVFAGTSQARLRDKDLAARIARAIG |
| Ga0335077_114509281 | 3300033158 | Soil | SSGRSPAGPIMVHVRDTRSGDIEVFAGTSQARLRDKDLAARIARAIG |
| Ga0310914_103459402 | 3300033289 | Soil | VVHVRDAESGDIEVFSGTSQTRLRDTDLAARITRAIG |
| Ga0310914_103527562 | 3300033289 | Soil | SPSQPPGRAPAGPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG |
| Ga0310914_108093101 | 3300033289 | Soil | HVRDAKSGDIEVFSGTSQTRLRDTDLAARIARAIG |
| Ga0370483_0068940_16_129 | 3300034124 | Untreated Peat Soil | VVHVRNAKSGDIEVFSGTSQTRLQDKDLAARIARAIG |
| ⦗Top⦘ |