| Basic Information | |
|---|---|
| Family ID | F051510 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 45 residues |
| Representative Sequence | QPMRDAVRAAFADVVAEHGSMPRERAEAYLDELETTARYRPDLWG |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.78 % |
| % of genes near scaffold ends (potentially truncated) | 92.36 % |
| % of genes from short scaffolds (< 2000 bps) | 89.58 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.73 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.139 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.222 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.778 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.278 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.21% β-sheet: 0.00% Coil/Unstructured: 54.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.73 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| c.25.1.4: NADPH-cytochrome p450 reductase-like | d1f20a2 | 1f20 | 0.82818 |
| c.25.1.0: automated matches | d3qfta2 | 3qft | 0.82301 |
| c.23.1.0: automated matches | d6wsha1 | 6wsh | 0.76751 |
| c.23.1.1: CheY-related | d1s8na_ | 1s8n | 0.75829 |
| c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain | d1c1da1 | 1c1d | 0.73246 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF00710 | Asparaginase | 5.56 |
| PF16859 | TetR_C_11 | 4.86 |
| PF01740 | STAS | 4.17 |
| PF00069 | Pkinase | 2.78 |
| PF00903 | Glyoxalase | 2.08 |
| PF00440 | TetR_N | 2.08 |
| PF01909 | NTP_transf_2 | 1.39 |
| PF07286 | D-Glu_cyclase | 1.39 |
| PF00667 | FAD_binding_1 | 1.39 |
| PF00384 | Molybdopterin | 1.39 |
| PF09754 | PAC2 | 0.69 |
| PF03435 | Sacchrp_dh_NADP | 0.69 |
| PF12146 | Hydrolase_4 | 0.69 |
| PF00067 | p450 | 0.69 |
| PF03372 | Exo_endo_phos | 0.69 |
| PF00348 | polyprenyl_synt | 0.69 |
| PF07883 | Cupin_2 | 0.69 |
| PF07690 | MFS_1 | 0.69 |
| PF01047 | MarR | 0.69 |
| PF01545 | Cation_efflux | 0.69 |
| PF01351 | RNase_HII | 0.69 |
| PF09990 | DUF2231 | 0.69 |
| PF01636 | APH | 0.69 |
| PF00892 | EamA | 0.69 |
| PF05721 | PhyH | 0.69 |
| PF09130 | DUF1932 | 0.69 |
| PF01042 | Ribonuc_L-PSP | 0.69 |
| PF12680 | SnoaL_2 | 0.69 |
| PF08281 | Sigma70_r4_2 | 0.69 |
| PF00583 | Acetyltransf_1 | 0.69 |
| PF02567 | PhzC-PhzF | 0.69 |
| PF00106 | adh_short | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG0252 | L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D | Translation, ribosomal structure and biogenesis [J] | 11.11 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 11.11 |
| COG0369 | Flavoprotein (flavin reductase) subunit CysJ of sulfite and N-hydroxylaminopurine reductases | Nucleotide transport and metabolism [F] | 1.39 |
| COG4336 | Uncharacterized conserved protein YcsI, UPF0317/DUF1446 family | Function unknown [S] | 1.39 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.69 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.69 |
| COG0164 | Ribonuclease HII | Replication, recombination and repair [L] | 0.69 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.69 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.69 |
| COG1039 | Ribonuclease HIII | Replication, recombination and repair [L] | 0.69 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.69 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.69 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.69 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.69 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.14 % |
| Unclassified | root | N/A | 29.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10333652 | Not Available | 538 | Open in IMG/M |
| 3300002907|JGI25613J43889_10000326 | All Organisms → cellular organisms → Bacteria | 10680 | Open in IMG/M |
| 3300004268|Ga0066398_10073421 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300004633|Ga0066395_11009398 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 508 | Open in IMG/M |
| 3300004961|Ga0072333_1130250 | Not Available | 544 | Open in IMG/M |
| 3300005336|Ga0070680_100871978 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300005337|Ga0070682_100544568 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005435|Ga0070714_100875844 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300005437|Ga0070710_10460273 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300005439|Ga0070711_100359518 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300005455|Ga0070663_100964440 | Not Available | 740 | Open in IMG/M |
| 3300005530|Ga0070679_101480774 | Not Available | 626 | Open in IMG/M |
| 3300005535|Ga0070684_100028101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4755 | Open in IMG/M |
| 3300005548|Ga0070665_100122708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2600 | Open in IMG/M |
| 3300005563|Ga0068855_100902298 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300005578|Ga0068854_102231757 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005899|Ga0075271_10045374 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300005983|Ga0081540_1233972 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300006028|Ga0070717_10417705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1206 | Open in IMG/M |
| 3300006028|Ga0070717_10509802 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300006028|Ga0070717_10809235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 852 | Open in IMG/M |
| 3300006163|Ga0070715_10246785 | Not Available | 931 | Open in IMG/M |
| 3300006173|Ga0070716_101753555 | Not Available | 513 | Open in IMG/M |
| 3300006354|Ga0075021_10672863 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300006796|Ga0066665_11104970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 604 | Open in IMG/M |
| 3300006804|Ga0079221_10386745 | Not Available | 861 | Open in IMG/M |
| 3300006852|Ga0075433_10177905 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300006953|Ga0074063_14138798 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300007076|Ga0075435_101742476 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300009088|Ga0099830_11581837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
| 3300009174|Ga0105241_11450380 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300009520|Ga0116214_1003096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6127 | Open in IMG/M |
| 3300010043|Ga0126380_10929438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces xiamenensis | 725 | Open in IMG/M |
| 3300010046|Ga0126384_10099135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2145 | Open in IMG/M |
| 3300010048|Ga0126373_13154031 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
| 3300010325|Ga0134064_10446768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300010358|Ga0126370_11697583 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300010359|Ga0126376_10780656 | Not Available | 930 | Open in IMG/M |
| 3300010360|Ga0126372_11935044 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300010360|Ga0126372_12647474 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 553 | Open in IMG/M |
| 3300010361|Ga0126378_13409416 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
| 3300010366|Ga0126379_10169306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. URHA0032 | 2063 | Open in IMG/M |
| 3300010366|Ga0126379_13541703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 523 | Open in IMG/M |
| 3300010373|Ga0134128_13007803 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300010396|Ga0134126_11081386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 895 | Open in IMG/M |
| 3300010398|Ga0126383_11550694 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 752 | Open in IMG/M |
| 3300010398|Ga0126383_12593145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300010398|Ga0126383_12875549 | Not Available | 562 | Open in IMG/M |
| 3300010869|Ga0126359_1068365 | Not Available | 979 | Open in IMG/M |
| 3300010880|Ga0126350_12067981 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 798 | Open in IMG/M |
| 3300010937|Ga0137776_1317221 | Not Available | 594 | Open in IMG/M |
| 3300012096|Ga0137389_10188159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1713 | Open in IMG/M |
| 3300012202|Ga0137363_10171899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1719 | Open in IMG/M |
| 3300012351|Ga0137386_10069738 | All Organisms → cellular organisms → Bacteria | 2451 | Open in IMG/M |
| 3300012359|Ga0137385_10377642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1211 | Open in IMG/M |
| 3300012927|Ga0137416_10492378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1055 | Open in IMG/M |
| 3300012930|Ga0137407_10030520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4195 | Open in IMG/M |
| 3300012971|Ga0126369_11178911 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 856 | Open in IMG/M |
| 3300013104|Ga0157370_10393884 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300013307|Ga0157372_10741399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1142 | Open in IMG/M |
| 3300013307|Ga0157372_11477535 | Not Available | 783 | Open in IMG/M |
| 3300014157|Ga0134078_10593000 | Not Available | 529 | Open in IMG/M |
| 3300014166|Ga0134079_10422705 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300016270|Ga0182036_10972803 | Not Available | 698 | Open in IMG/M |
| 3300016294|Ga0182041_11714562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
| 3300016319|Ga0182033_11750788 | Not Available | 563 | Open in IMG/M |
| 3300016341|Ga0182035_11846507 | Not Available | 548 | Open in IMG/M |
| 3300016357|Ga0182032_10413261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1094 | Open in IMG/M |
| 3300016371|Ga0182034_11615295 | Not Available | 569 | Open in IMG/M |
| 3300016387|Ga0182040_10966912 | Not Available | 709 | Open in IMG/M |
| 3300016445|Ga0182038_11074634 | Not Available | 714 | Open in IMG/M |
| 3300017933|Ga0187801_10248459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 714 | Open in IMG/M |
| 3300017973|Ga0187780_11411635 | Not Available | 513 | Open in IMG/M |
| 3300018060|Ga0187765_10785984 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300018064|Ga0187773_10780420 | Not Available | 605 | Open in IMG/M |
| 3300019789|Ga0137408_1327640 | All Organisms → cellular organisms → Bacteria | 3335 | Open in IMG/M |
| 3300019890|Ga0193728_1097626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1362 | Open in IMG/M |
| 3300020140|Ga0179590_1175703 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300020579|Ga0210407_10178796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1644 | Open in IMG/M |
| 3300021088|Ga0210404_10684050 | Not Available | 585 | Open in IMG/M |
| 3300021374|Ga0213881_10163775 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300021405|Ga0210387_11786262 | Not Available | 518 | Open in IMG/M |
| 3300021479|Ga0210410_10657922 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300021560|Ga0126371_10420078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1481 | Open in IMG/M |
| 3300025464|Ga0208076_1092156 | Not Available | 522 | Open in IMG/M |
| 3300025898|Ga0207692_10605622 | Not Available | 705 | Open in IMG/M |
| 3300025901|Ga0207688_11045180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 516 | Open in IMG/M |
| 3300025919|Ga0207657_11431591 | Not Available | 518 | Open in IMG/M |
| 3300025929|Ga0207664_10851849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2575 | 819 | Open in IMG/M |
| 3300025929|Ga0207664_10869068 | Not Available | 810 | Open in IMG/M |
| 3300025929|Ga0207664_11467350 | Not Available | 603 | Open in IMG/M |
| 3300025932|Ga0207690_10119710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1910 | Open in IMG/M |
| 3300025939|Ga0207665_10656463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 822 | Open in IMG/M |
| 3300025945|Ga0207679_11972886 | Not Available | 532 | Open in IMG/M |
| 3300026116|Ga0207674_10184945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2034 | Open in IMG/M |
| 3300026121|Ga0207683_10401621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1261 | Open in IMG/M |
| 3300026320|Ga0209131_1000265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 37964 | Open in IMG/M |
| 3300027671|Ga0209588_1237847 | Not Available | 559 | Open in IMG/M |
| 3300027889|Ga0209380_10514942 | Not Available | 697 | Open in IMG/M |
| 3300027908|Ga0209006_11289772 | Not Available | 565 | Open in IMG/M |
| 3300028881|Ga0307277_10013352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3178 | Open in IMG/M |
| 3300030740|Ga0265460_10407779 | Not Available | 996 | Open in IMG/M |
| 3300031018|Ga0265773_1004690 | Not Available | 960 | Open in IMG/M |
| 3300031170|Ga0307498_10009457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1907 | Open in IMG/M |
| 3300031543|Ga0318516_10061514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. URHA0032 | 2066 | Open in IMG/M |
| 3300031543|Ga0318516_10422938 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 767 | Open in IMG/M |
| 3300031561|Ga0318528_10394667 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 743 | Open in IMG/M |
| 3300031681|Ga0318572_10336574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 894 | Open in IMG/M |
| 3300031682|Ga0318560_10189351 | Not Available | 1097 | Open in IMG/M |
| 3300031708|Ga0310686_109943360 | Not Available | 524 | Open in IMG/M |
| 3300031708|Ga0310686_112842865 | Not Available | 582 | Open in IMG/M |
| 3300031713|Ga0318496_10217713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1051 | Open in IMG/M |
| 3300031724|Ga0318500_10351095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 728 | Open in IMG/M |
| 3300031740|Ga0307468_102567132 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031744|Ga0306918_10932402 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300031751|Ga0318494_10291664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 940 | Open in IMG/M |
| 3300031765|Ga0318554_10188679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1173 | Open in IMG/M |
| 3300031765|Ga0318554_10653512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300031769|Ga0318526_10022459 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
| 3300031771|Ga0318546_11255030 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 520 | Open in IMG/M |
| 3300031779|Ga0318566_10449686 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300031793|Ga0318548_10176648 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1045 | Open in IMG/M |
| 3300031821|Ga0318567_10469834 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300031833|Ga0310917_10232790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1238 | Open in IMG/M |
| 3300031846|Ga0318512_10345329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 744 | Open in IMG/M |
| 3300031859|Ga0318527_10152389 | Not Available | 970 | Open in IMG/M |
| 3300031890|Ga0306925_11613774 | Not Available | 630 | Open in IMG/M |
| 3300031910|Ga0306923_11559070 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 688 | Open in IMG/M |
| 3300031912|Ga0306921_11068920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 906 | Open in IMG/M |
| 3300031942|Ga0310916_11736128 | Not Available | 504 | Open in IMG/M |
| 3300031947|Ga0310909_10667724 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300032008|Ga0318562_10829823 | Not Available | 528 | Open in IMG/M |
| 3300032009|Ga0318563_10408305 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300032042|Ga0318545_10343037 | Not Available | 538 | Open in IMG/M |
| 3300032052|Ga0318506_10363144 | Not Available | 642 | Open in IMG/M |
| 3300032054|Ga0318570_10235826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 829 | Open in IMG/M |
| 3300032068|Ga0318553_10052966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. URHA0032 | 2002 | Open in IMG/M |
| 3300032074|Ga0308173_10988613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 781 | Open in IMG/M |
| 3300032205|Ga0307472_101240079 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 714 | Open in IMG/M |
| 3300032261|Ga0306920_101434748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 988 | Open in IMG/M |
| 3300033134|Ga0335073_11285176 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300033289|Ga0310914_10477502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1128 | Open in IMG/M |
| 3300034818|Ga0373950_0017230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1243 | Open in IMG/M |
| 3300034819|Ga0373958_0007751 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.03% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.17% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.08% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.08% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.08% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.39% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.39% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.39% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.39% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.39% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.69% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.69% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.69% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004961 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 83 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005899 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_103336521 | 3300001356 | Peatlands Soil | VRTAFADVLTEHASMPPECAEAYLNKMETSARYRPDLWS* |
| JGI25613J43889_100003266 | 3300002907 | Grasslands Soil | MRAAVRAAFVDIVAEHGSLPRVRAEAYLDELESTARYRPDLWG* |
| Ga0066398_100734211 | 3300004268 | Tropical Forest Soil | GYVYVCGSQPMRDAVRAAFIDVVTEHGPVPRERAEAYLQEMETTERYRPDLWV* |
| Ga0066395_110093981 | 3300004633 | Tropical Forest Soil | GYVYVCGSQPMRDAVRAVFVDVVAEQGSLPRGQAEAYVEELERTTHYRPDLWG* |
| Ga0072333_11302501 | 3300004961 | Peatlands Soil | LVWRLLAADGYVYVCGSQPMRTAVRAAIVDVVAEQRSLPHEPAEAYLQEMEATARYRPDLWG* |
| Ga0070680_1008719781 | 3300005336 | Corn Rhizosphere | AMREGVRAAFVDVVAEHGAMPREHAEAYVDELETSEQRYRPDLWG* |
| Ga0070682_1005445683 | 3300005337 | Corn Rhizosphere | LRDGVRRAFVDVLEAQGAMPREHAEAYLHELEHTQNRYRPDLWG* |
| Ga0070714_1008758443 | 3300005435 | Agricultural Soil | MRDAVRAAFIDVVTEHGSLPREHAEAYLQEMETTERYRPDLWV* |
| Ga0070710_104602733 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VCGSAPVRAGIRAALADVIADRGALPPERAGAYLDELETTARYRPDLWG* |
| Ga0070711_1003595183 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | DAVRAAFTDVIADHGGLARDHAAAYLDELETTARYRPDLWV* |
| Ga0070663_1009644402 | 3300005455 | Corn Rhizosphere | VYVCGSQPMRAAVRAAFTDVAAEHGSLPPAQAAAYLDELETTAHYRPDLWG* |
| Ga0070679_1014807741 | 3300005530 | Corn Rhizosphere | YVYVCGSQAMRDGVRDAFVDVAAEHGALPREHAEAFVVELEATEQRYRPDLWG* |
| Ga0070684_1000281011 | 3300005535 | Corn Rhizosphere | QPMRAAVRAAVTDVAAEHGSLSPGQAAAYLDELEATARYRPDLWG* |
| Ga0070665_1001227083 | 3300005548 | Switchgrass Rhizosphere | VTDVAAEHGSLSPGQAAAYLDELEATARYRPDLWG* |
| Ga0068855_1009022981 | 3300005563 | Corn Rhizosphere | VYVCGSLPMRDGVRQAFVDVVAEHAPMPREHAEAYLHELEATENRYRPDLWG* |
| Ga0068854_1022317571 | 3300005578 | Corn Rhizosphere | IDVVTEHGSLPREHAEAYLQEMETTERYRPDLWV* |
| Ga0075271_100453741 | 3300005899 | Rice Paddy Soil | QPMREAVRAAFADVVTEHGSLPREHAEAYLHEMETTARYRPDLWG* |
| Ga0081540_12339723 | 3300005983 | Tabebuia Heterophylla Rhizosphere | GGYAYVCGSQPMRDAVRAAFIDVATEHGSLPRERAGAYLQELETAERYRPDLWV* |
| Ga0070717_104177054 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AEVIADHGALPPERAAAYLDDLETTARYRPDLWG* |
| Ga0070717_105098023 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AAVRAALADVIADHGALPPARAAAYLDDLETSARYRPDLWG* |
| Ga0070717_108092351 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ALAEVIADHGALPPERAAAYLDDLETTARYRPDLWG* |
| Ga0070715_102467851 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | QPMRQAVRAAIADIVEGHGSLPPAAAEAYVCDLESAARYRPDLWV* |
| Ga0070716_1017535551 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AVRAAFTDVAAEHGSLLPAQAAAYLDELETTAHYRPDLWG* |
| Ga0075021_106728631 | 3300006354 | Watersheds | RTAFTDVIAEHGGLARDHAAAYLDELETTARYRPDLWV* |
| Ga0066665_111049703 | 3300006796 | Soil | AAFTDVIADHGGLARDHAVAYLDELETTARYRPDLWV* |
| Ga0079221_103867452 | 3300006804 | Agricultural Soil | VCGSQPMRAAVRAAFTDVAAEHGSLPPAQAAAYLDELETTAHYRPDLWG* |
| Ga0075433_101779051 | 3300006852 | Populus Rhizosphere | VRTAFADVIAEHGRLPRDRAEAYLDELETTARYRPDLWG* |
| Ga0074063_141387981 | 3300006953 | Soil | RDAVRTAFADVIADHGRLPRDRAEAYLDELETTARYRPDLWG* |
| Ga0075435_1017424763 | 3300007076 | Populus Rhizosphere | AAVRAEVRAALADVIADHGALPPERAAAYLDDLETTARYRPDLWG* |
| Ga0099830_115818373 | 3300009088 | Vadose Zone Soil | VYVCGSQPMRDAVRDAFVDVVADHGMRPREHAEAYVRQLETTARYRPDLWG* |
| Ga0105241_114503801 | 3300009174 | Corn Rhizosphere | LDSGAYVYVCGGQALRDGVRRAFVDVLEAHGSMPREHAEAYLHELELTENRYRPDLWG* |
| Ga0116214_10030968 | 3300009520 | Peatlands Soil | MRTAVRAAIVNVVAEQRSLPHEPAEAYLQEMEATARYRPDLWG* |
| Ga0126380_109294381 | 3300010043 | Tropical Forest Soil | SQPMRDAVRAAFVDVVTERGSLPREHAEAYLHEMETTARYRPDLWG* |
| Ga0126384_100991351 | 3300010046 | Tropical Forest Soil | AAFVDVVTERGSLPREHAEAYLHEMETTARYRPDLWG* |
| Ga0126373_131540313 | 3300010048 | Tropical Forest Soil | GYVYVCGSQPMRDAVRAAFADVVTEHGSLPREHADAYLHEMETTARYRPDLWG* |
| Ga0134064_104467681 | 3300010325 | Grasslands Soil | MRDAVRDAFTDVIADHGGLARDHAAAYLDELETTARYRPDLWV* |
| Ga0126370_116975831 | 3300010358 | Tropical Forest Soil | AAFTDVIADHGGLPRERAAAYLHELETTTRYRPDLWG* |
| Ga0126376_107806563 | 3300010359 | Tropical Forest Soil | SQPMRQAVRAAIADVVAEHGPLSRAAAEAYVCDMESAARYRPDLWV* |
| Ga0126372_119350443 | 3300010360 | Tropical Forest Soil | EGGYVYVCGSQPMRDAVRAVFVDVVAEQGSLPRGQAEAYVEELERTTHYRPDLWG* |
| Ga0126372_126474743 | 3300010360 | Tropical Forest Soil | EGGYVYVCGSQPMRDAVRAVFVDVVAEQGSLPRVQAEAYVDELERTTHYRPDLWG* |
| Ga0126378_134094163 | 3300010361 | Tropical Forest Soil | YVCGSQPMRDAVRAAFIDIVTEHGPLPRERAEAYLQEMETTERYRPDLWV* |
| Ga0126379_101693061 | 3300010366 | Tropical Forest Soil | MRDGVRAAFVDVVTEHGSLPREHAEAYLHEMETTARYRPDLWG* |
| Ga0126379_135417032 | 3300010366 | Tropical Forest Soil | EAVRDAFVDVAMDHGSLPREHAEAHLAELEATARYRPDLWE* |
| Ga0134128_130078031 | 3300010373 | Terrestrial Soil | PMRDAVRTAFADVIAEHGRLPRDRAEAYLDELETTARYRPDLWG* |
| Ga0134126_110813861 | 3300010396 | Terrestrial Soil | MRDGVRAAFVDLIAEHLSISRERAESVLLELETVDNRYRPDLWG* |
| Ga0126383_115506942 | 3300010398 | Tropical Forest Soil | GYVYVCGSQPMRDAVRAAFVDVVTERGSLPREHAEAYLHEMETTARYRPDLWG* |
| Ga0126383_125931453 | 3300010398 | Tropical Forest Soil | RAAFVDVAAEHGALPRGQAEAYVDELETTAHYRPDLWG* |
| Ga0126383_128755491 | 3300010398 | Tropical Forest Soil | EGVREAFVDVVEKHGGMPRHCAEAYLHELETTLQRYRPDLWG* |
| Ga0126359_10683651 | 3300010869 | Boreal Forest Soil | RAAFADVIADHGALPRERAAAYLDELETTARYRPDLWG* |
| Ga0126350_120679813 | 3300010880 | Boreal Forest Soil | WRLLAADGYVYVCGSQPMRDAVRAAFADVLTGHASMPPEYAQAYLSELETTARYRPDLWS |
| Ga0137776_13172211 | 3300010937 | Sediment | LIDVVTEHGSLPREHAEAYLQEMETAERYRPDLWV* |
| Ga0137389_101881591 | 3300012096 | Vadose Zone Soil | RAAVRAAFVDIVAEHGSLPRVRAEAYLDELESTARYRPDLWG* |
| Ga0137363_101718994 | 3300012202 | Vadose Zone Soil | YAYVCGSQPMRDAVRAALIDVVTEHGSLPREHAEAYVQELETTERYRPDLWV* |
| Ga0137386_100697381 | 3300012351 | Vadose Zone Soil | MRASVRAAFVDVVAEYGSLPREQAEAYIDELETTTRYRPDL |
| Ga0137385_103776423 | 3300012359 | Vadose Zone Soil | MRASVRAVFVDVVAEYGSLPREQAEAYIDELETTTRYR |
| Ga0137416_104923783 | 3300012927 | Vadose Zone Soil | VDIVAEHGSLPRVRAEAYLDELESTARYRPDLWG* |
| Ga0137407_100305201 | 3300012930 | Vadose Zone Soil | APMRAAVRAALAGVIADHGALASARADAYLDELETTARYRPDLWG* |
| Ga0126369_111789112 | 3300012971 | Tropical Forest Soil | MRDAVRAAFVDVVADHGSLPHEQAAAYVDELETTTHYRPDLWG* |
| Ga0157370_103938844 | 3300013104 | Corn Rhizosphere | AFVDVVAEHGSLPREHAEGYLLELETIDNRYRPDLWG* |
| Ga0157372_107413991 | 3300013307 | Corn Rhizosphere | QLVWRLLEAGAYVYVCGGQAMRDGVREAFIDVVAECAPMPREHAEAFVENLELRENRYRPDLWG* |
| Ga0157372_114775351 | 3300013307 | Corn Rhizosphere | AYVYVCGGQALRDGVRRAFVDVLEAQGAMPREHAEAYLHELEHTQNRYRPDLWG* |
| Ga0134078_105930001 | 3300014157 | Grasslands Soil | MRDAVRVAFTDVIADHGGLARDQAVAYLDELETTGRYRPDLWV* |
| Ga0134079_104227053 | 3300014166 | Grasslands Soil | VCGSQPMRDAVRAAFTDVIADHGGLARDHAAAYLDELETTARYRPDLWV* |
| Ga0182036_109728031 | 3300016270 | Soil | AFVDVVTEHGSLPREHAEAYLHEMETTARYRPDLWG |
| Ga0182041_117145623 | 3300016294 | Soil | AFIDVIADHGGVPPEGAAAYLHELESTTRYRPDLWG |
| Ga0182033_117507881 | 3300016319 | Soil | DAVRTAFADVAAEHGALPHERAAAYVDELEATTRYRPDLWN |
| Ga0182035_118465071 | 3300016341 | Soil | GGYVYVCGSPAVRESVRAAFVDVVAEHGSLLRRHAEVFLNELDTTARYRSDLWA |
| Ga0182032_104132613 | 3300016357 | Soil | VRAAFVDVVAEHGSLPRDQAGAYIDELETTTHYRPDLWG |
| Ga0182034_116152951 | 3300016371 | Soil | YVCGAQPMRDAVRTAFADVAAEHGALPRERAAAYVDELEATNRYRPDLWG |
| Ga0182040_109669121 | 3300016387 | Soil | CGSQPMRDAVRAAFADVIADHGALPRERAAAYLHELETTARYRPDLWG |
| Ga0182038_110746341 | 3300016445 | Soil | AVRAAFADVIADHGALPRERAAAYLHELETTTRYRPDLWG |
| Ga0187801_102484593 | 3300017933 | Freshwater Sediment | CGSAPMRDAVRTAVTDVIAGHGPLPREHAEAYLHELETTARYRPDLWG |
| Ga0187780_114116353 | 3300017973 | Tropical Peatland | QPMRDGVRGAFVDVAAEHGRLPHEHAEAHLHELETTARYRPDLWG |
| Ga0187765_107859843 | 3300018060 | Tropical Peatland | SPPMRDAVRDVFVDVVADHGSLPREDAEAYLQHLELTARYRPDLWG |
| Ga0187773_107804203 | 3300018064 | Tropical Peatland | CGSQPMRDAVRAAFVDVIAQHASLSPERAEAYLDELDKTTRYRPDLWG |
| Ga0137408_13276407 | 3300019789 | Vadose Zone Soil | MRDAVRAAFADVIADHGGLPRDRAAAYLDELETTARYRPDLWG |
| Ga0193728_10976261 | 3300019890 | Soil | FADVIAEHGRLPRDRAEAYLDELETTARYRPDLWG |
| Ga0179590_11757031 | 3300020140 | Vadose Zone Soil | VCGAQPMRDAVRTAFADVIADHGRLPRDRAEAYLDELETTARYRPDLWG |
| Ga0210407_101787964 | 3300020579 | Soil | YICGSQPIRDAVRAAFADVVAEHGSMPRERAEAYLDELETTARYRPDLWG |
| Ga0210404_106840503 | 3300021088 | Soil | SQPMRDAVRAAFADVVAEHGSMPRERAEAYLDELETTARYRPDLWG |
| Ga0213881_101637753 | 3300021374 | Exposed Rock | EAVRAAFADVVAEGTGLTHERAQAYLDRMETTTRYRPDLWA |
| Ga0210387_117862621 | 3300021405 | Soil | QPMRDAVRAAFADVVAEHGSMPRERAEAYLDELETTARYRPDLWG |
| Ga0210410_106579221 | 3300021479 | Soil | RAAFTDVIADHGGLPRDRAAAYLDELETTARYRPDLWV |
| Ga0126371_104200783 | 3300021560 | Tropical Forest Soil | CGSQPVRDAVHAAFTDVIAEQGSLPREHAEAYLHELETTTHYRPDLWG |
| Ga0208076_10921563 | 3300025464 | Arctic Peat Soil | SQPMRTAVREAFTDVVAEHGSLPREQAEAFLLELENTTRYRPDLWG |
| Ga0207692_106056221 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | SAPVRAGIRAALADVIADRGALPPERAGAYLDELETTARYRPDLWG |
| Ga0207688_110451801 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | AFVDVIAEHGTMPSAGAETLLAELEKAGRYRPDLWG |
| Ga0207657_114315913 | 3300025919 | Corn Rhizosphere | AYVYVCGGQAMRDGVRRAFVDVVEANGSMPREHAEAYLHELEHTQNRYRPDLWG |
| Ga0207664_108518493 | 3300025929 | Agricultural Soil | AVRAALADVIADHGALPPARAAAYLDELETSARYRPDLWG |
| Ga0207664_108690681 | 3300025929 | Agricultural Soil | ALAEVIADHGALPPERAAAYLDDLETTARYRPDLWG |
| Ga0207664_114673501 | 3300025929 | Agricultural Soil | CGSQPMRTAVRAAFTDVAAEHGSLLPAQAAAYLDELETTAHYRPDLWG |
| Ga0207690_101197104 | 3300025932 | Corn Rhizosphere | MRDGVREAFVDIVADHGAMPVEHAEAYLHELELTENRYRPDLWG |
| Ga0207665_106564633 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | YVCGGQALRDGVRRAFVDVLEAHGSMPREHAEAYLHELEHTQNRYRPDLWG |
| Ga0207679_119728863 | 3300025945 | Corn Rhizosphere | MRDGVRRAFVDVVEANGSMPREHAEAYLHELEHTQNRYRPDLWG |
| Ga0207674_101849454 | 3300026116 | Corn Rhizosphere | GSAAVRAEVRAALADVIADHGALPPERAAAYLDDLETTARYRPDLWG |
| Ga0207683_104016211 | 3300026121 | Miscanthus Rhizosphere | DAVRAAFIDVVTEHGSLPREHAEAYLQEMETTERYRPDLWV |
| Ga0209131_100026515 | 3300026320 | Grasslands Soil | MRAAVRAAFVDIVAEHGSLPRVRAEAYLDELESTARYRPDLWG |
| Ga0209588_12378471 | 3300027671 | Vadose Zone Soil | PMRAAVRAAFVDIVAEHGSLPRVRAEAYLDELEATARYRPDLWG |
| Ga0209380_105149423 | 3300027889 | Soil | DAVRAAFVDVIAEHGSMPREHAGAYLHELETTARYRPDLWG |
| Ga0209006_112897722 | 3300027908 | Forest Soil | AVRAAFADVLTEHASMPPECAEAYLHKLETTARYRPDLWS |
| Ga0307277_100133521 | 3300028881 | Soil | FANVIAEHGRLPRDRAEAYLDELETTARYRPDLWG |
| Ga0265460_104077793 | 3300030740 | Soil | FVDVIAHQGALPREHAEAYLADMETTARYRPDLWG |
| Ga0265773_10046903 | 3300031018 | Soil | PMRDAVRDAFVDVIAEYGSMPREHAETYLHELETTTRYRPDLWG |
| Ga0307498_100094574 | 3300031170 | Soil | YVCGSQPMRDAVRAALIDIVTEHGSLPHEHAEAYLQEMETAERYRPDLWV |
| Ga0318516_100615144 | 3300031543 | Soil | VYVCGSQPVRDAVRAAFVDVVTEHGSLPREHAEAYLHEMETTARYRPDLWG |
| Ga0318516_104229382 | 3300031543 | Soil | MRDAVRAAFVDVVAEQGSLPRDQAGAYLHELETTTHYRPDLWG |
| Ga0318528_103946671 | 3300031561 | Soil | GYVYVCGSQPMRDNVFEAFVDVVSKHGSRSHEDAEAYMRELETAKDRYRPDLWG |
| Ga0318572_103365741 | 3300031681 | Soil | TAEGYVYVCGSQPMRDAVRAAFVDVVAEHGSLPRDQAGAYIDELETTTHYRPDLWG |
| Ga0318560_101893514 | 3300031682 | Soil | CGSQPVRDAVRAAFVDVVTEHGSLPREHAEAYLHEMETTARYRPDLWG |
| Ga0310686_1099433603 | 3300031708 | Soil | GSQPMRDAVRAAFVDVIAEHGSMPRQHAEAYLHELETTARYRPDLWG |
| Ga0310686_1128428652 | 3300031708 | Soil | SQSMRDAVRAAFVDVVTQHGLLPRQHSEAYLSELETTERYRPDLWI |
| Ga0318496_102177133 | 3300031713 | Soil | TAEGYVYVCGSQPMRDAVRAAFVDVVAEHGPLPRGQAEAYLDELETTTHYRPDLWG |
| Ga0318500_103510953 | 3300031724 | Soil | SQPMRDAVRAAFVDVVAEHGPLPRGQAEAYLDELETTTHYRPDLWG |
| Ga0307468_1025671323 | 3300031740 | Hardwood Forest Soil | PMRDAVRTAFADVIAEHGRLPRDRAEAYLDELETTARYRPDLWG |
| Ga0306918_109324021 | 3300031744 | Soil | VRAAFADVIADQAPMPRDCAAAYLDQLETTERYRPDLWG |
| Ga0318494_102916641 | 3300031751 | Soil | PMRDAVRAAFVDVVAEHGSLPRGRAEAYIDELETTAHYRPDLWG |
| Ga0318554_101886791 | 3300031765 | Soil | AVRVAFAEVAAEHGALPGERAAAYVDELEATNRYRPDLWG |
| Ga0318554_106535123 | 3300031765 | Soil | SQPMRDAVRAAFVDVVAEHGSLPRGRAEAYIDELETTAHYRPDLWG |
| Ga0318526_100224591 | 3300031769 | Soil | VYVCGSQPMRDAVRAAFVDVVAEHGSLPRDQAGAYIDELETTTHYRPDLWG |
| Ga0318546_112550303 | 3300031771 | Soil | VYVCGSQPMRDAVRAAFIDVIADQGGLPPERAAACLHELESTTRYRPDLWG |
| Ga0318566_104496861 | 3300031779 | Soil | YVCGSQPMRDAVRAAFTDVIADHGALPRERAEAYLDELETTARYRPDLWG |
| Ga0318548_101766482 | 3300031793 | Soil | VREAVRDAFVDVAAEHGPLPRERASEYLSELERTARYRPDLWG |
| Ga0318567_104698343 | 3300031821 | Soil | YVCGAQPMRNAVRAAFTDVIADHGGLLRERAAAYLHELETTARYRPDLWG |
| Ga0310917_102327903 | 3300031833 | Soil | SQPMRDAVRAAFVDVVAEHGSLPRDQAGAYIDELETTTHYRPDLWG |
| Ga0318512_103453291 | 3300031846 | Soil | HRLRAAVRAALIDVVTEDGSLPREHAEAYLQEMETAERYRPDLWV |
| Ga0318527_101523891 | 3300031859 | Soil | VCGSQPVREAVRAAFVDVAAEHGSLPRERAEAFLGRLETTTRYRPDLWG |
| Ga0306925_116137741 | 3300031890 | Soil | YVCGAQPMRDAVRTAFTDVIADHGALPRERAAAYLHELETTARYRPDLWG |
| Ga0306923_115590701 | 3300031910 | Soil | VCGSQPVRDAVRAAFVDVVTEHGSLPREHAEAYLHEMETTARYRPDLWG |
| Ga0306921_110689203 | 3300031912 | Soil | VCGSQPMRDAVRAAFVDVVAEHGPLPRGQAEAYLDELETTTHYRPDLWG |
| Ga0310916_117361283 | 3300031942 | Soil | QPMRDAVRAAFADVIADHGALPRERAAAYLHELETTARYRPDLWG |
| Ga0310909_106677243 | 3300031947 | Soil | DAVRAAFTDVIADHGALPRERAEAYLDELETTARYRPDLWG |
| Ga0318562_108298231 | 3300032008 | Soil | AFVDVAAEHGPLPRERASEYLSELERTARYRPDLWG |
| Ga0318563_104083053 | 3300032009 | Soil | QPMRDAVCDAFTDVVAEHGSMPREHAEAYLQQLELTTRYRPDLWG |
| Ga0318545_103430371 | 3300032042 | Soil | AAFVDVVTEHGSLPREHAEAYLHEMETTARYRPDLWG |
| Ga0318506_103631443 | 3300032052 | Soil | RTAFTDVIADHGALPRERAAAYLHELETTARYRPDLWG |
| Ga0318570_102358261 | 3300032054 | Soil | QPMRDAVRAAFVDVVAEHGSLPRGRAEAYIDELETTAHYRPDLWG |
| Ga0318553_100529664 | 3300032068 | Soil | YVCGSQPVRDAVRAAFVDVVTEHGSLPREHAEAYLHEMETTARYRPDLWG |
| Ga0308173_109886131 | 3300032074 | Soil | PAAVRAEVRAALADVIADHGALPPERAAAYLDDLETTARYRPDLWG |
| Ga0307472_1012400792 | 3300032205 | Hardwood Forest Soil | MRDAVRAAFTDVITEHGALPRERAAAYLHELESTTRYRPDLWG |
| Ga0306920_1014347483 | 3300032261 | Soil | AEGYVYVCGSQPMRDAVRAAFVDVVAEHGSLPRGRAEAYIDELETTAHYRPDLWG |
| Ga0335073_112851761 | 3300033134 | Soil | VCGSQPMRDAVRTAFTSVIAEHGGLPRERAAAYLHELETTTRYRPDLWG |
| Ga0310914_104775021 | 3300033289 | Soil | ALIDVVTEHGPLPREHAEAYLQEMETAERYRPDLWV |
| Ga0373950_0017230_1135_1242 | 3300034818 | Rhizosphere Soil | FIDVVTEHGSLPREHAEAYLQEMETTERYRPDLWV |
| Ga0373958_0007751_1566_1697 | 3300034819 | Rhizosphere Soil | MRDAVRTAFADVIADHGRLPRDRAEAYLDELETTARYRPDLWG |
| ⦗Top⦘ |