NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F051456

Metagenome / Metatranscriptome Family F051456

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051456
Family Type Metagenome / Metatranscriptome
Number of Sequences 144
Average Sequence Length 155 residues
Representative Sequence CDDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEIWPAHWNDPRFNFKPQNLDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDYELPDPGSAMHFKKKRSGVISFLGAFISVGLLLFYPTCGLKIPQKDNPFYYRKKYATSSSI
Number of Associated Samples 119
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 21.53 %
% of genes near scaffold ends (potentially truncated) 66.67 %
% of genes from short scaffolds (< 2000 bps) 97.92 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(18.056 % of family members)
Environment Ontology (ENVO) Unclassified
(44.444 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(43.056 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 33.91%    β-sheet: 0.00%    Coil/Unstructured: 66.09%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 144 Family Scaffolds
PF04641Rtf2 0.69
PF13418Kelch_4 0.69
PF13964Kelch_6 0.69
PF01344Kelch_1 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002161|JGI24766J26685_10113920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida572Open in IMG/M
3300004112|Ga0065166_10071815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1203Open in IMG/M
3300004241|Ga0066604_10162904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida888Open in IMG/M
3300005662|Ga0078894_10508224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1081Open in IMG/M
3300005662|Ga0078894_11708288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida516Open in IMG/M
3300005987|Ga0075158_10350862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida832Open in IMG/M
3300005988|Ga0075160_10309857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida861Open in IMG/M
3300006037|Ga0075465_10075686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida731Open in IMG/M
3300006056|Ga0075163_10265325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1968Open in IMG/M
3300006165|Ga0075443_10270922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii619Open in IMG/M
3300006357|Ga0075502_1595243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida564Open in IMG/M
3300006383|Ga0075504_1220932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida502Open in IMG/M
3300006383|Ga0075504_1374329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida528Open in IMG/M
3300006394|Ga0075492_1526364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida717Open in IMG/M
3300006396|Ga0075493_1440071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida928Open in IMG/M
3300006641|Ga0075471_10281092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii850Open in IMG/M
3300006803|Ga0075467_10076230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2035Open in IMG/M
3300006803|Ga0075467_10135277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1430Open in IMG/M
3300006803|Ga0075467_10313458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida832Open in IMG/M
3300006803|Ga0075467_10532373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida603Open in IMG/M
3300006805|Ga0075464_10381781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida855Open in IMG/M
3300007171|Ga0102977_1167059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2454Open in IMG/M
3300007253|Ga0075182_10388335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida638Open in IMG/M
3300007516|Ga0105050_10894638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida502Open in IMG/M
3300008107|Ga0114340_1074181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1423Open in IMG/M
3300008116|Ga0114350_1050742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1510Open in IMG/M
3300008117|Ga0114351_1157121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1243Open in IMG/M
3300009155|Ga0114968_10092551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1859Open in IMG/M
3300009159|Ga0114978_10288520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1008Open in IMG/M
3300009230|Ga0103855_10129914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida510Open in IMG/M
3300009263|Ga0103872_1040310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida657Open in IMG/M
3300009432|Ga0115005_10700030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida814Open in IMG/M
3300009436|Ga0115008_10546678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida830Open in IMG/M
3300009436|Ga0115008_11044048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida612Open in IMG/M
3300009606|Ga0115102_10422619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea597Open in IMG/M
3300010309|Ga0102890_1061006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii751Open in IMG/M
3300010885|Ga0133913_13300943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1062Open in IMG/M
3300012408|Ga0138265_1108694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida682Open in IMG/M
3300012412|Ga0138266_1084326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida729Open in IMG/M
3300012415|Ga0138263_1842353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida700Open in IMG/M
3300012416|Ga0138259_1510710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida642Open in IMG/M
3300012523|Ga0129350_1330117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida532Open in IMG/M
3300012756|Ga0138272_1185815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida924Open in IMG/M
3300012952|Ga0163180_10482236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii923Open in IMG/M
3300012970|Ga0129338_1406751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida531Open in IMG/M
3300018413|Ga0181560_10366117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida665Open in IMG/M
3300018684|Ga0192983_1027403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida776Open in IMG/M
3300018848|Ga0192970_1060194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida708Open in IMG/M
3300018871|Ga0192978_1076199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida617Open in IMG/M
3300018874|Ga0192977_1067015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida728Open in IMG/M
3300018899|Ga0193090_1089516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida708Open in IMG/M
3300018926|Ga0192989_10140251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea590Open in IMG/M
3300018948|Ga0192985_1175713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida700Open in IMG/M
3300018980|Ga0192961_10230111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea549Open in IMG/M
3300018981|Ga0192968_10113352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii718Open in IMG/M
3300018982|Ga0192947_10150971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida775Open in IMG/M
3300018982|Ga0192947_10214537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea629Open in IMG/M
3300018999|Ga0193514_10275139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida581Open in IMG/M
3300019011|Ga0192926_10467544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida524Open in IMG/M
3300019017|Ga0193569_10181392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii942Open in IMG/M
3300019017|Ga0193569_10237431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii788Open in IMG/M
3300019036|Ga0192945_10226077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida597Open in IMG/M
3300019048|Ga0192981_10239750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida697Open in IMG/M
3300019085|Ga0188830_1022278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii522Open in IMG/M
3300019123|Ga0192980_1052729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida774Open in IMG/M
3300019282|Ga0182075_1558497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida540Open in IMG/M
3300020161|Ga0211726_10362982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida770Open in IMG/M
3300020193|Ga0194131_10256164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea803Open in IMG/M
3300020197|Ga0194128_10317084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii771Open in IMG/M
3300020200|Ga0194121_10548672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea559Open in IMG/M
3300020205|Ga0211731_10811767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida988Open in IMG/M
3300020221|Ga0194127_10537280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea752Open in IMG/M
3300020222|Ga0194125_10704009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea588Open in IMG/M
3300020603|Ga0194126_10460042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea794Open in IMG/M
3300021169|Ga0206687_1647345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida733Open in IMG/M
3300021350|Ga0206692_1254854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea548Open in IMG/M
3300021350|Ga0206692_1255082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea561Open in IMG/M
3300021350|Ga0206692_1761679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida569Open in IMG/M
3300021350|Ga0206692_1832036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida662Open in IMG/M
3300021424|Ga0194117_10550644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida508Open in IMG/M
3300021925|Ga0063096_1071870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii794Open in IMG/M
3300021927|Ga0063103_1028168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida719Open in IMG/M
3300021950|Ga0063101_1064628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida610Open in IMG/M
3300021963|Ga0222712_10664591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea592Open in IMG/M
3300025451|Ga0208426_1060415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida584Open in IMG/M
3300025848|Ga0208005_1097793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii916Open in IMG/M
3300025887|Ga0208544_10155881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii976Open in IMG/M
3300025887|Ga0208544_10301513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida624Open in IMG/M
3300026088|Ga0207641_12469589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida518Open in IMG/M
3300027226|Ga0208309_1031558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii669Open in IMG/M
3300027769|Ga0209770_10024538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2641Open in IMG/M
3300027781|Ga0209175_10196445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida862Open in IMG/M
3300027782|Ga0209500_10227341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida827Open in IMG/M
3300027789|Ga0209174_10171448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida984Open in IMG/M
3300030564|Ga0210256_10684593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida644Open in IMG/M
3300030575|Ga0210288_1104069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida694Open in IMG/M
3300030584|Ga0247658_1119099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea548Open in IMG/M
3300030591|Ga0247626_1119108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida690Open in IMG/M
3300030595|Ga0210276_10299884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida682Open in IMG/M
3300030604|Ga0247637_1115120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida619Open in IMG/M
3300030609|Ga0247634_10330180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida618Open in IMG/M
3300030609|Ga0247634_10463515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea546Open in IMG/M
3300030621|Ga0247655_10102734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida722Open in IMG/M
3300030625|Ga0210259_11399501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida599Open in IMG/M
3300030630|Ga0210282_10169486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida678Open in IMG/M
3300030632|Ga0210250_11916408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida647Open in IMG/M
3300030635|Ga0247627_10287510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida545Open in IMG/M
3300030635|Ga0247627_10318321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida525Open in IMG/M
3300030653|Ga0307402_10624650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida627Open in IMG/M
3300030699|Ga0307398_10677858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida571Open in IMG/M
3300030702|Ga0307399_10432222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida641Open in IMG/M
3300030738|Ga0265462_11309645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida657Open in IMG/M
3300030738|Ga0265462_12549888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida511Open in IMG/M
3300030740|Ga0265460_11154721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida736Open in IMG/M
3300030740|Ga0265460_12124757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida588Open in IMG/M
3300030741|Ga0265459_11403418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida787Open in IMG/M
3300030741|Ga0265459_11655831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida743Open in IMG/M
3300030741|Ga0265459_11887543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida709Open in IMG/M
3300030741|Ga0265459_12934833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida594Open in IMG/M
3300030741|Ga0265459_13542354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea547Open in IMG/M
3300030743|Ga0265461_11336776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida756Open in IMG/M
3300030743|Ga0265461_12273994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea630Open in IMG/M
3300030743|Ga0265461_13447781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida535Open in IMG/M
3300031231|Ga0170824_112164596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea514Open in IMG/M
3300031231|Ga0170824_116584154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida651Open in IMG/M
3300031231|Ga0170824_125218390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida736Open in IMG/M
3300031446|Ga0170820_17166617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida637Open in IMG/M
3300031710|Ga0307386_10418973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida691Open in IMG/M
3300031717|Ga0307396_10373194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida683Open in IMG/M
3300031729|Ga0307391_10446784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida721Open in IMG/M
3300031729|Ga0307391_10458591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida712Open in IMG/M
3300031737|Ga0307387_10979713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida539Open in IMG/M
3300031752|Ga0307404_10356567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida610Open in IMG/M
3300032463|Ga0314684_10860131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida511Open in IMG/M
3300032518|Ga0314689_10477053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida653Open in IMG/M
3300032519|Ga0314676_10671581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida606Open in IMG/M
3300032521|Ga0314680_10545789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida731Open in IMG/M
3300032615|Ga0314674_10414885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida700Open in IMG/M
3300032617|Ga0314683_10571321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida699Open in IMG/M
3300032650|Ga0314673_10381922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida722Open in IMG/M
3300032707|Ga0314687_10470006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida700Open in IMG/M
3300032711|Ga0314681_10649744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida585Open in IMG/M
3300032742|Ga0314710_10486841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida510Open in IMG/M
3300033984|Ga0334989_0266733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida922Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.06%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine13.89%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.50%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine10.42%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater6.94%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.86%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.17%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent4.17%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.47%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.47%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.78%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.78%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.08%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.39%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.39%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.39%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.69%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.69%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.69%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.69%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.69%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.69%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.69%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004241Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006056Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNAEngineeredOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007171Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007253Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A1 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009230Microbial communities of water from Amazon river, Brazil - RCM8EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012756Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018948Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809757-ERR1740124)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019085Metatranscriptome of marine microbial communities from Baltic Sea - GS670_3p0_dTEnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019282Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020193Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120mEnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300020200Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50mEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020222Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250mEnvironmentalOpen in IMG/M
3300020603Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150mEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300025451Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027226Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027789Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030575Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030584Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030591Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030595Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030604Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030609Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030621Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030630Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030632Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR004SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030635Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24766J26685_1011392013300002161Freshwater And SedimentMNNKSLLLQALRGRTFSHPLAVVSASRIGVHNRYKYDYACEDEYYEREMTILEARHLPLPLPEDWRHKTFPINEFMPAHINDVRFNFLPQNLDRRMFLHDNYMHMYDFQHDAAHTLGFPDEDLDYEMPDPQSAMHFKKKRSGAFAMLGALIAVGTLFGYPIF
Ga0065166_1007181523300004112Freshwater LakeMNNKSLLLQALRSRHLSQTQATIMASRIGVRNRYKYDYACEDEYFEREMTILEARHLPLPLPEDWRHKQIPINEIMPAHINDVRFNFLPQHLDRRMYLHDNYQHMYDFTHDAAHTLGYPDEDLDYEMPDPMTAMHFKKKRSGALS*
Ga0066604_1016290413300004241FreshwaterMTILEARHLPIPIPEDFRHKTPPMHEIMPPHWNDVRFNFLPQRIDRRMFLHDNYMNNYDFPHDAAHTLGYIDEDLDYELPDPQSAMHFKKKRSGAVAMLGAVIALGILIGYPIFGLKMPQRDNPFYWRKKYGTPSTITQFQALSLMEYGGK*
Ga0078894_1050822413300005662Freshwater LakeMTLLEARHLPLPLPIDWRHKQYPVNEIMPAHINDVRFNFLPQNLDRRMFLHDNQMHSYDFVHDAAHTLGYADEDLDYEMPDPQHAMHFKKKRSGAFSMLGAVAAVGLLFGYPIFGLKMPQKDNPFYWRKKYATPTTIEQF*
Ga0078894_1170828813300005662Freshwater LakeMGSRIGVRNRYKYDYACEDEYFEREMTILEARHLPMPLPEDWRHKQIPINEFMPAHWNDVRFNFLPQNLDRRMFLHDNYMHMYDFTHDAAHTLGYPDEDLDYEMPDPQTAMHFKKKRSGAVSILGAVISIGVLIGYPIFGLK
Ga0075158_1035086213300005987Wastewater EffluentMTSRIGVRNRYQYDYACEDDYFEREMTMLEARHLPLPLPEDFRHKSPPNHEIWPAHWNDVRFNFKPQNMDRRMFLHDNYMNAYDFPHDIAHTLGYYDEDLDYELPDPMTAMHFKKKRSGVVSSLGAIISLAVLIGYPIFGLKMPQKDNPFYYRKKYATPSTLE*
Ga0075160_1030985713300005988Wastewater EffluentMTLYDAKKLPLPIPTTFEHALHPDNEVWPSHWNDVRFNFKPQNLDRRMFIHDNMMNVYDIEHDFAHTTGYVDEDLDYELPDPINAMHYKKKRSGALMFLGAFIVVGATFLYPTAGLKIPQKDNPFYYRKKYASTTSI*
Ga0075465_1007568613300006037AqueousMTLYDAKHLPLPIPTTFEHALHPDNEVWPSHWNDVRFNFKPQHLDRRAFIHDNMMNVYNFEHDFAHTTGFVDEDLDYELPDPLPAMHYKKKRSGALMFLGAFISVGALLLYPTAGLKIPQKDNPFYYRKKYATSTSIQQFEKLAIMEYGAAVDKPPESSVMIT*
Ga0075163_1026532523300006056Wastewater EffluentMTSRIGVRNRYQYDYACEDDYFEREMTMLEARHLPLPLPEDFRHKSPPNHEIWPAHWNDVRFNFKPQNMDRRMFLHDNYMNAYDFPHDIAHTLGYYDEDLDYELPDPMTAMHFKKKRSGVVSSLGAIISLAVLIGYPIFGLKMP*
Ga0075443_1027092213300006165MarineMTLLEARTLPLPLPKDFRHAQHPDNEVWPAHWNDVRFNLRPERQDRRCFIHDNYMNAYDIAHDFAHTTGYVDEDMDFELPDPGVAMHFKLKRSQVTSFAGALILIAALIGYPIFGLKIPQKDNPFYYRKKYATSTSI
Ga0075502_159524313300006357AqueousNIAFARAFRLQKAITNPLVQQQAARIGVTNRYRWDYACEDEYFEREMTLLEARELPLPLPSDFKHADPPNHEIWPAHWNDVRFNFKPQNLDRRAFIHDNYMNFYNFKDDFMHTTGFVDEDLDYEVTDPADAMHFKKKRSQPITILGAFIAVGILFGYPICGLKIPQKDNPFYYRKKYASETFVRNFQ
Ga0075504_122093213300006383AqueousLVSAFRMQKSISHPYHLLRTQRIGVRNRYQWDYACEDEYFEKEMTMLEAKELPLPIPADMVHAKPTYDEIWPAHWNDVRFNFRPENIDRRCFIHDNMMNVYDFRHDFAHTTGFVDEDLDYEMPDPGSAMHFKKKRSGAVMFMGVFVCMGLLYLFPTCGLKIPQRDNP
Ga0075504_137432913300006383AqueousYDYACEDEYFEKPMTMLEARHLPLPLPKDFSHVIHPDNEVQPLHWNDVRFNFLPQRQDRRAFIHDNYMNFYNFEEDYAHSLGCEDEDLDFGVPDPASAMHFKKKRSNVLSFAGAFIAVAATIGYPIFGLKIPQKDNPFYYRKKYASIGTIQQHQEHAMGEYGNWSGSQMPMDRSS
Ga0075492_152636423300006394AqueousKSLSHPYALMRTARIGVVNRYQYDYACEDEYFQREMTLLEARALPLPLPKDFRHAQHPDNEVWPAHWNDVRFNLKPERQDRRCYIHDNYMNAYDFAHDFAHTTGYVDEDLDFELPDPGSAMHFKLKRSQVVSYLGAFITVGALIGYPIFGLKIPQKDNPFYYRKKYATSTSIG*
Ga0075493_144007113300006396AqueousMRSQQAVLSAFKLQKSLSHPYALMRTARIGVVNRYQYDYACEDEYFQREMTLLEARALPLPLPKDFRHAQHPDNEVWPAHWNDVRFNLKPERQDRRCYIHDNYMNAYDFAHDFAHTTGYVDEDLDFELPDPGSAMHFKLKRSQVVSYLGAFITVGALIGYPIFGLKIPQKDNPFYYRKKYATSTSIG*
Ga0075471_1028109213300006641AqueousMTLLEARSLPLPLPKDFRHAQHPDNEVWPAHWNDVRFNLRTERLDRRCFIHDNYMNAYDFAHDFAHTTGYVDEDLDYELPDPASAMHFKLKRSQVTSFAGAIILIAALIGYPVLGLKIPQKDNPFYYRKKYASSSSIA*
Ga0075467_1007623023300006803AqueousMFVCLQDYACEDEYFQREMTLLEARALPLPLPKDFRHAQHPDNEVWPAHWNDVRFNLKPERQDRRCYIHDNYMNAYDFAHDFAHTTGYVDEDLDFELPDPGSAMHFKLKRSQVVSYLGAFITVGALIGYPIFGLKIPQKDNPFYYRKKYATSTSIG*
Ga0075467_1013527723300006803AqueousMTLLEARALPLPLPKDFRHAQHPDNEVWPAHWNDVRFNLKPERQDRRCYIHDNYMNAYDFAHDFAHTTGYVDEDLDFELPDPGSAMHFKLKRSQVVSYLGAFITVGALIGYPIFGLKIPQKDNPFYYRKKYATSTSIG*
Ga0075467_1031345813300006803AqueousLTKSVSHPYHLLSTTRIGVKNRYKYDYACEDEYFEKQMTMLEARQLPLPLPKDFCHAIHPDNEVQPAHWNNVRFNFLPQRQDRRAFIHDNYMNFYNFETDFAHEADFIDESMDMELPDPAGAMHFKKKRSNVTSFFGAFILVFATFAYPIMGLKIPQKDNPFYYRKKYASAGSVVQF*
Ga0075467_1053237313300006803AqueousVSAFRLTKSVSHPYHLLSTTRIGVKNRYKYDYACEDEYFEKQMTMLEARQLPLPLPKDFCHAIHPDNEVQPAHWNNVRFNFLPQRQDRRVFIHDNYMNFYNFETDFAHEADFIDESMDMELPDPAGAMHFKKKRSNVTSFFGAFILVFATFAYPIMGLKIPQKDNPFYYRKKYASAGSVVQFQRIA
Ga0075464_1038178113300006805AqueousMTLYDAKHLPLPIPTTFEHALHPDNEVWPSHWNDVRFNFKPQHLDRRAFIHDNMMNVYNFEHDFAHTTGFVDEDLDYELPDPLPAMHYKKKRSGALMFLGAFISVGALLLYPTAGLKIPQKDNPFYYRKKYATTTSIQQFEKLAIMEYGAAVDKPPESSVMIT*
Ga0102977_116705943300007171Freshwater LakeMAQNRAFVSAFRLRSSLATPYHLLATARIGVRNRYEHDYACEDEYFEREMTLLDARNLPLPLPKDFIHAHPPDNEIFPAHFNDVRFNYKPQNLDRRCFIHDNYMNSYDFAHDLAHTTGFVDEDLDFELPDPYNAMHFKKKRSQVTHTIGIFIAVGMLIFLPILGLKLPQKDNPFYWRKKYATLTSLT*
Ga0075182_1038833513300007253Wastewater EffluentACEDDYFEREMTMLEARHLPLPLPEDFRHKSPPNHEIWPAHWNDVRFNFKPQNMDRRMFLHDNYMNAYDFPHDIAHTLGYYDEDLDYELPDPMTAMHFKKKRSGVISSLGSIIALAVLIGYPIFGLKMPQKDNPFYYRKKYATPSTLE*
Ga0105050_1089463813300007516FreshwaterMISKVVADTLRSRSGVTATQAVLIGSRIGVRNRYRYDYACEDEYFEREMTILEARHLPLPLPEDYRHKKVPINEIMPAHWNDVRFNYLPQNLDRRMFLHNNYMNMYDFRHDVAHTLGYPDEDLDYELPDPAIAMHFKKKRSGAVSMLGAVISIA
Ga0114340_107418113300008107Freshwater, PlanktonMTMYDARTLPLPLPKDFSHAQHPDNEVWPMHWNDVRFNFKPQNQDRRAFIHDNMMNAYDFHHDFAHTTGYIDEDLDQDMPDPYPAMHFKKKRSGALMFLGAFITVGAWLFFPTIGFKIPQKDNPFYYRKKYAQSSAIQQFQRFAMMEYGGNVPKHPESSVMI
Ga0114350_105074213300008116Freshwater, PlanktonVKNRYAYDYACEDEYFEREMTMYDARTLPLPLPKDFSHAQHPDNEVWPMHWNDVRFNFKPQNQDRRAFIHDNMMNAYDFHHDFAHTTGYIDEDLDQDMPDPYPAMHFKKKRSGALMFLGAFITVGAWLFFPTIGFKIPQKDNPFYYRKKYAQSSAIQQFQRFAMMEY
Ga0114351_115712113300008117Freshwater, PlanktonMTMYDARTLPLPLPKDFSHAQHPDNEVWPMHWNDVRFNFKPQNQDRRAFIHDNMMNAYDFHHDFAHTTGYIDEDLDQDMPDPYPAMHFKKKRSGALMFLGAFITVGAWLFFPTIGFKIPQKDNPFYYRKKYAQSSAIQQFQRFAMMEYGGNVPK
Ga0114968_1009255143300009155Freshwater LakeMSKTSSLLQNALRGRSFSQPLAVVSASRIGVRNRYKYDYACDDEYFEREMTILEARHLPLPLPPDWSHKQFPINEFMPAHINDVRFNFLPQNLDRRMFLHDNYMHLYDFTHDAAHTLGFPDEDLDYEMPDPMTAMHYKKKRSGALSIFGAV
Ga0114978_1028852023300009159Freshwater LakeMNNRSIVSAFRLSKSISHPYHVLATSRIGVKNRYAFDYACEDEYFEKEMTMLEARNLPLPIPKTFKHATPPDNEVQPAHWNAVQFNFLPQRLDRRAFIHDNYMNQYNFEHDFAHTTGYIDEDLDWEMPDPAGAMHFKKKRSGVIAFLGAFITVGALVGYPIFGLKIPQKDNPFFYRKKYATSTSIIQF*
Ga0103855_1012991413300009230River WaterAADYACEDEYFEREMTLLDSRNLPLPLPKDFTHAKPPVNEVWPAHWNDVRFNFKPQNLDRRCFIHDNYMNAYDFAHDLAHTTGFVDEDMDFELPDPYNAMHFKKKRSGAVMFLGAFVTVGALILYPICGFKIPQKDNPFYYRKKYATSSTVLQFQRLAMLEYGAAVPKSP
Ga0103872_104031013300009263Surface Ocean WaterGIKNRYAYDYACEDEYFEKEMTLLEAKHLPLPIPSDFTHAKPTYDEIWPAHWNDVRFNFRPENIDRRCFIHDNMMNVYNFEHDFAHTTGYVDEDLDWEQPDPYDSNHFKKKRSGAVMFLGAFVCVAGLYLLPTCGFKIPQKDNPFYYRKKYASVTSI*
Ga0115005_1070003023300009432MarineMNNRATLAKVFRMQKSIVHPHHLVNTARIGVINRYRFDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPSHWNDVRFNHQPQNLDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFMGVFIALGVFIFYPTCGLKIPQKDNPFYYRKKYATSSSI*
Ga0115008_1054667813300009436MarineMTLLEARALPLPMPKDFKHADPPDHEVWPAHWNDVRFNFKPQNLDRRMFIHDNYMNLYDFTHDFAHTTGFIDEDLDYEMPDPGSAMHFKKKRSGVTGFMGAIIAVGLLIGYPICGLKIPQKDNPFYYRKKYASAGSI*
Ga0115008_1104404813300009436MarineMTMLEAKELPLPIPADMVHAKPTYDEIWPAHWNDVRFNFRPENIDRRCFIHDNMMNVYDFRHDFAHTTGFVDEDLDYEMPDPGSAMHFKKKRSGAVMFMGVFVCMGLLYLFPTCGLKIPQRDNPFY
Ga0115102_1042261913300009606MarineTMLEAKELPLPIPADMVHAKPTYDEIWPAHWNDVRFNFRPENIDRRCFIHDNMMNVYDFRHDFAHTTGFVDEDLDYEMPDPGSAMHYKKKRSGAVMFMGVFVCMGLLYLFPTCGLKIPQRDNPFYYRKKYASPTSIQQFQKQALTEYGAAVPKYPDSNVMIT*
Ga0102890_106100613300010309EstuarineMTLLEARTLPLPLPKDFRHAQHPDNEVWPAHWNDVRFNLRPERQDRRCFIHDNYMNAYDIAHDFAHTTGYVDEDLDFELPDPGVAMHFKLKRSQVTSFAGAFILIAALVGYPIFGLKIPQKDNPFYYRKKYATSTSIGQMQKIAHMEYGA
Ga0133913_1330094323300010885Freshwater LakeMNNRSIVSAFRLSKSLSHPYHVLATSRIGVKNRYAFDYACEDEYFEKEMTMLEARNLPLPIPKTFKHATPPDNEVQPAHWNAVQFNFLPQRLDRRAFIHDNYMNQYNFEHDFAHTTGYIDEDLDWEMPDPAGAMHFKKKRSGVIAFLGAFITVGALVGYPIFGLKIPQKDNPFFYRKKYATSTSIIQF*
Ga0138265_110869413300012408Polar MarineNRALASVFRNQKSIATPFHLVNTARIGVRNRYKYDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPAHWNDVRFNHQPQNMDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFLGAFISVGVLLFYPTCGLKIPQKDNPFYYRKKYATSSSI*
Ga0138266_108432623300012412Polar MarineNNRALASVFRNQKSIATPFHLVNTARIGVRNRYKYDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPAHWNDVRFNHQPQNMDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFLGAFISVGVLLFYPTCGLKIPQKDNPFYYRKKYATSSSI*
Ga0138263_184235313300012415Polar MarineNRALASVFRNQKSIATPFHLVNTARIGVRNRYKYDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPAHWNDVRFNHQPQNMDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFLGAFISVGVLLFYPTCGLKIPQKDNPFYYRKKYRPPPPSNNSRNSL*
Ga0138259_151071013300012416Polar MarineMNNRALASVFRNQKSIATPFHLVNTARIGVRNRYKYDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPAHWNDVRFNHQPQNMDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFLGAFISVGVLLFYPTCGLKIPQKDNPFYYRKKYATSSSI*
Ga0129350_133011713300012523AqueousMRTSRIGVRNRYQWDYACEDEYFERDMTLLEARALPLPMPKDFRHADPPDHEVWPAHWNDVRFNFKPQNLDRRMFIHDNYMNLYDFTHDFAHTTGFVDEDLDYEMPDPGSAMHFKKKRSAVTGFLGAFIAIGALIGYPIMGLKIP*
Ga0138272_118581523300012756Freshwater LakeLATRIGVRNRYKWDYACEDEYYEREMTLLEARHLPLPLPIDWRHKQYPVNEIMPAHINDVRFNFLPQNLDRRMFLHDNQMHSYDFVHDAAHTLGYADEDLDYEMPDPQHAMHFKKKRSGAFSMLGAVAAVGLLFGYPIFGLKMPQKDNPFYWRKKYATPTTIEQF*
Ga0163180_1048223613300012952SeawaterMTLLEARSLPMPIPKDFRHAQHPDNEVWPAHWNDVRFNFKPQRQDRRCYIHDNYMNAYDFAHDFAHTTGYVDEDMDYELPDPAGAMHFKLKRSQVTSALGAVILIGALIGYPIFGLKIPQKDNPFYYRKKYATSSSIGQLQKQAHLEYGAGVPKPPCDSSGLIN*
Ga0129338_140675113300012970AqueousMTMLEARNLPLPLPKDFAHAHPPDNEIWPAHFNDVRFNFKPQNLDRRMFLHDNYMNQYDFAHDLAHPTGFVDEDLDSELPDPYNAMHFKKKRSQVTQTMGIFIAVGMLIFLPILGLKLPQKDNPFYWRK
Ga0181560_1036611713300018413Salt MarshSDYACEDEYFQREMTLLDSRNLPLPLPKDFNHKKTPANEIWPAHWNDVRFNYKPQNMDRRMFIYDNYMNAYDFAHDLAHTTGFVDEDMDFELPDPYNAMHFKKKRSQVTHAIGAVIAVAMLIGLPIFGLKLPQKDNPFFWRKKYGTVTSLSQH
Ga0192983_102740323300018684MarineMNNRALASVFRNQKSIATPFHLVNTARIGVRNRYKYDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPAHWNDVRFNHQPQNMDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFLGAFISVGVLLFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0192970_106019423300018848MarineKSLSHPYALMRTARIGVVNRYKYDYACEDEYFQREMTLLEARTLPLPLPKDFRHAQHPDNEVWPAHWNDVRFNLRPERQDRRCFIHDNYMNAYDIAHDFAHTTGYVDEDMDFELPDPGVAMHFKLKRSQVTSFAGALILIAALIGYPIFGLKIPQKDNPFYYRKKYATSTSIG
Ga0192978_107619913300018871MarineLASVFRNQKSIATPFHLVNTARIGVRNRYKYDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPAHWNDVRFNHQPQNMDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFLGAFISVGLLLFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0192977_106701513300018874MarineNNRALASVFRNQKSIATPFHLVNTARIGVRNRYKYDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPAHWNDVRFNHQPQNMDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFLGAFISVGVLLFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0193090_108951613300018899MarineRNQKSIATPFHLVNTARIGVRNRYKYDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPAHWNDVRFNHQPQNMDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFLGAFISVGVLLFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0192989_1014025113300018926MarineAKHLPLPIPSDFTHAKPTYDEIWPAHWNDVRFNFRPENIDRRCFIHDNMMNVYNFEHDFAHTTGYVDEDLDWEQPDPYDSNHFKKKRSGAVMFLGAFVAVAGLYLLPTCGFKIP
Ga0192985_117571323300018948MarineRALASVFRNQKSIATPFHLVNTARIGVRNRYKYDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPAHWNDVRFNHQPQNMDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFLGAFISVGVLLFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0192961_1023011113300018980MarineELPLPIPADMVHAKPTYDEIWPAHWNDVRFNFRPENIDRRCFIHDNMMNVYDFRHDFAHTTGFVDEDLDYEMPDPGSAMHFKKKRSGAVMFMGVFVCMGLLYLFPTCGLKIPQRDNPFYYRKKYASPTSIQQFQKQALTEYGAAVPKYPDSNVMIT
Ga0192968_1011335213300018981MarineMRTARIGVVNRYKYDYACEDEYFQREMTLLEARTLPLPLPKDFRHAQHPDNEVWPAHWNDVRFNLRPERQDRRCFIHDNYMNAYDIAHDFAHTTGYVDEDMDFELPDPGVAMHFKLKRSQVTSFAGALILIAALIGYPIFGLKIPQKDNPFYYRKKYATSTSIG
Ga0192947_1015097113300018982MarineMSLINNSAVVRAFRMQKSLAHPYHLMRASRIGVVNRYKYDYACDDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEIWPAHWNDPRFNFKPQNLDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDYELPDPGSAMHFKKKRSGVISFLGAFISVGLLLFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0192947_1021453713300018982MarineEMTMLEAKELPLPIPADMVHAKPTYDEIWPAHWNDVRFNFRPENIDRRCFIHDNMMNVYDFRHDFAHTTGFVDEDLDYEMPDPGSAMHFKKKRSGAVMFMGVFVCMGLLYLFPTCGLKIPQRDNPFYYRKKYASPTSIQQFQKQALTEYGAAVPKYPDSNVMIT
Ga0193514_1027513913300018999MarineMRSQRAVLSAFKLQKSLSHPYALMRGSRIGVVNRYRFDYACEDEYFEREMTFLEARSLPLPLPKDFRHAAHPDNEVWPAHWNDVRFNFKPERQDRRVYIHDNYMNAYDISHDFVHTTSYVDEDLDYEMPDPASAMHFKLKRSQVTSFFGAFIAVGALIFYPICGLKIPQKDNPFFYRKKY
Ga0192926_1046754413300019011MarineMAMNRTMLSAFRTQKSLSHPYHLLRASRIGVVNRYRFDYACEDEYFEREMTLLESRTLPLPLPSDMRHAVHDDNEVWPAHWNDVRFNFKPQNQDRRMFIHDNYMNAYDFAHDFAHTTGFVDEDLDFELPDPGTAMHFKKKRSQVMHFFGSLFLVGLLFFVPICGFK
Ga0193569_1018139213300019017MarineIYIRIETRLIMSAYRTTLSAFKMQKSLSHPYALMRASRIGVVNRYQYDYACEDEYFQREMTLLEARSLPMPLPKDFRHAQHPDNEVWPAHWNDVRFNLKPERQDRRCFIHDNYMNAYDFAHDFAHTTGYVDEDLDFELPDPATAMHFKLKRSQVTSFAGAFILIGALVGYPIFGLKIPQKDNPFYYRKKYASSTSIAQMQK
Ga0193569_1023743113300019017MarineHRTILSAFKLQKSLSHPYHVMRASRIGVVNRYKYDYACEDEYFQREMTLLESRTLPLPLPKDFRHAQHPDNEVWPAHWNDVRFNMRPERQDRRCFIHDNYMNAYDISHDFAHTTGYVDEDLDFELPDPGVAMHFKLKRSQVTSFAGAFILIGALIGYPIFGLKIPQKDNPFYYRKKYATSTTIGQM
Ga0192945_1022607713300019036MarineCDDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEIWPAHWNDPRFNFKPQNLDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDYELPDPGSAMHFKKKRSGVISFLGAFISVGLLLFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0192981_1023975023300019048MarineHGTARIGVRNRYKYDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPAHWNDVRFNHQPQNMDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFLGAFISVGVLLFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0188830_102227823300019085Freshwater LakePIPKDFSHALHPDNEVWPAHWNDVRFNFLPQRQDRRAFIHDNMMNVYNFEHDFAHTTGYVDEDLDWELPDPAGAMHYKKKRSGALMFLGAFISVGALILYPICGLKIPQKDNPFYYRKKYATSGSVL
Ga0192980_105272923300019123MarineMTLLEARNLPLPLPKDFKHADPPDHEVWPAHWNDVRFNHQPQNMDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFLGAFISVGVLLFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0182075_155849713300019282Salt MarshRNIAFARAFRLQKAITNPLVQQQAARIGVTNRYRWDYACEDEYFEREMTLLEARELPLPLPSDFKHADPPNHEIWPAHWNDVRFNFKPQNLDRRAFIHDNYMNFYNFKDDFMHTTGFVDEDLDYEVTDPADAMHFKKKRSQPITILGAFIAVGILFGYPICGLKIPQKDNPFYYRKKYA
Ga0211726_1036298213300020161FreshwaterMTLFEAKHLPLPIPKDFSHALHPDNEVWPAHWNDVRFNFLPQRQDRRAFIHDNMMNVYNFEHDFAHTTGYVDEDLDWELPDPAGAMHYKKKRSGALMFLGAFISVGALILYPICGLKIPQKDNPFYYRKKYATSGSVL
Ga0194131_1025616413300020193Freshwater LakeMLEARNLPLPVPKTFKHATPPDNEVQPAHWNAVQFNFLPQRLDRRVFINDNYMNQYNFEHDFAHTTGFVDEDMDWEMPDPYHANHFKKKRSGVIAFLGAFISVGALIGYPIFGMKIPQKDNPFYYRKKYATSTSVI
Ga0194128_1031708423300020197Freshwater LakeMLEARNLPLPIPKTFKHATPPDNEVQPAHWNAVQFNFLPQRLDRRAFIHDNYMNQYNFEHDFAHTTGFVDEDMDWECPDPYHANHFKKKRSGVTAFLGAFISIGLLIGYPIFGLKIPQKDNPFYYRKKYATSTSVI
Ga0194121_1054867213300020200Freshwater LakeTPPDNEVQPAHWNAVQFNFLPQRLDRRAFINDNYMNQYNFEHDFAHTTGFVDEDMDWEMPDPYHANHFKKKRSGVIAFLGAFISVGALIGYPIFGMKIPQKDNPFYYRKKYATSTSVI
Ga0211731_1081176713300020205FreshwaterMSKTSSLLQNALRGRGFSQPLAVVTASRIGVRNRYKYDYACDDEYFEREMTILEARHLPLPLPPDWSHKQFPINEFMPAHINDVRFNFLPQNLDRRMFLHDNYMHLYDFPHDAAHTLGFPDEDLDYEMPDPMTAMHYKKKRSGALSIFGAVIAVGVLFGYPILGLKMP
Ga0194127_1053728023300020221Freshwater LakeMLEARNLPLPIPKTFKHATPPDNEVQPAHWNAVQFNFLPQRLDRRAFIHDNYMNQYNFEHDFAHTTGFVDEDMDWECPDPYHANHFKKKRSGVIAFFGAFISVGLLIGYPIFGLKIPQKDNPFYYRKKYATSTSVI
Ga0194125_1070400923300020222Freshwater LakeLPIPKTFKHATPPDNEVQPAHWNAVQFNFLPQRLDRRAFIHDNYMNQYNFEHDFAHTTGFVDEDMDWECPDPYHANHFKKKRSGVIAFFGAFISVGLLIGYPIFGLKIPQKDNPFYYRKKYATSTSVI
Ga0194126_1046004223300020603Freshwater LakeMLEARNLPLPIPKTFKHATPPDNEVQPAHWNAVQFNFLPQRLDRRAFIHDNYMNQYNFEHDFAHTTGFVDEDMDWECPDPYHANHFKKKRSGVIAFLGAFISVGLLIGYPIFGLKIPQKDNPFYYRKKYATSTSVI
Ga0206687_164734513300021169SeawaterMTLLEAKHLPLPIPSDFTHAKPTYDEIWPAHWNDVRFNFRPENIDRRCFIHDNMMNVYNFEHDFAHTTGYVDEDLDWEQPDPYDSNHFKKKRSGAVMFLGAFVCVAGLYLLPICAFKIPQRDNPFYYRKKYASASSI
Ga0206692_125485413300021350SeawaterMTLLEAKHLPLPIPEDFRHVQAPNHEVFPAHINHVYFNYIPENLDRRAFIHDNMMNVYKFDDDYAHTTGYIDEDLDWEMPDPYDSNHFKKKRSGAIMFLGAFVCIAGFYLLPTCGFKIPQRDNPFFYRKKYAAPSSILQF
Ga0206692_125508213300021350SeawaterADFAHAKPTYDEIWPAHWNDVRFNFRPENIDRRCFIHDNMMNLYNFEHDFAHTTGYVDEDLDWEQPDPYDSNHFKKKRSGAVMFIGAVVCVAGLYLLPTCGFKIPQRDNPFYYRKKYASPTSILQF
Ga0206692_176167923300021350SeawaterALPLPMPKDFRHADPPDHEVWPAHWNDVRFNFQPQNLDRRMFIHDNYMNLYDFTHDFAHTTGFVDEDLDYELPDPGSAMHFKKKRSGVTGFMGAIIAVGLLIGYPICGLKIPQKDNPFYYRKKYASVGSI
Ga0206692_183203623300021350SeawaterNTARIGVRNRYKYDYACEDEYFQRDMTLLEARNLPLPLPKDFRHADPPDHEVWPAHWNDVRFNHQPQNMDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFLGAFISVGLLLFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0194117_1055064413300021424Freshwater LakeMRRGSQPTTLIMTARIGVRNRYKYDYACEDEYFEREMTILEARHLPLPFPDDWSHKKVPINEIMPPHWNDVRFNFLPQNMDRRMFLHDNYQNQYDFPHDASHTLGYADEDLDWEQPDPASMGHYNKVRSPALASLGWVIVL
Ga0063096_107187013300021925MarineMRTARIGVVNRYKYDYACEDEYFQREMTLLEARSLPMPLPKDFRHAQHPDNEVWPAHWNDVRFNLRTERLDRRCFIHDNYMNAYDFAHDFAHTTGYVDEDLDYELPDPHSAMHFKLKRSQVSSFMGAIIVVGALVGYPIFGLKIPQKDNPFYYRKKYASSSSIG
Ga0063103_102816813300021927MarineMMRTSRIGVRNRYQWDYACEDEYFERDMTLLEARALPLPMPKDFKHADPPDHEVWPAHWNDVRFNFKPQNLDRRMFIHDNYMNLYDFTHDFAHTTGFIDEDLDYELPDPGSAMHFKKKRSGVTGFMGAIIAVGLLIGYPICGLKLPQKDNPFYYRKKYASAGSI
Ga0063101_106462813300021950MarineEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPSHWNDVRFNHQPQNLDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFMGVFIALGVFIFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0222712_1066459123300021963Estuarine WaterKALPLPLPDNFQHVLHPDNEVWPAHWNDVRFNFKPQKQDRRCFIHDNMMNVYNIQDDFAHTTGYVDEDLDYELPDPYTAMHFKKKRSGAIMFFGAFITVGAFFLYPTFGLKIPQRDNPFFYRKKYATPSSISQF
Ga0208426_106041513300025451AqueousPKDFAHAHPPDNEVWPAHFNDVRFNFKPQNLDRRVFIHDNYMNAYDFAHDLAHTTGFVDEDLDFELPDPYNAMHFKKKRSQVTHAFGIIIAVGLLIFMPILGLKLPQKDNPFYWRKKYATVTSIHQHQKVAMLEYGAWVPKGPDTTVMITKDGFT
Ga0208005_109779323300025848AqueousMTLLEARSLPLPLPKDFRHAQHPDNEVWPAHWNDVRFNLRTERLDRRCFIHDNYMNAYDFAHDFAHTTGYVDEDLDYELPDPASAMHFKLKRSQVTSFAGAIILIAALIGYPVLGLKIPQKDNPFYYRKKYASSSSIA
Ga0208544_1015588123300025887AqueousMFVCLQDYACEDEYFQREMTLLEARALPLPLPKDFRHAQHPDNEVWPAHWNDVRFNLKPERQDRRCYIHDNYMNAYDFAHDFAHTTGYVDEDLDFELPDPGSAMHFKLKRSQVVSYLGAFITVGALIGYPIFGLKIPQKDNPFYYRKKYATSTSIG
Ga0208544_1030151313300025887AqueousVSAFRLTKSVSHPYHLLSTTRIGVKNRYKYDYACEDEYFEKQMTMLEARQLPLPLPKDFCHAIHPDNEVQPAHWNNVRFNFLPQRQDRRAFIHDNYMNFYNFETDFAHEADFIDESMDMELPDPAGAMHFKKKRSNVTSFFGAFILVFATFAYPIMGLKIPQKDNPFYYRKKYASAGSVVQFQRIA
Ga0207641_1246958913300026088Switchgrass RhizospherePKTPKPLLLRISDYFIIIKMNSKIMLAQTLRRQGMTHTQALMVASRIGIRNRYKYDYACEDEYFEREMTILEARSLPMPLPVDWRHKQLPLNEIFPAHWNDVRFNFKPENMDRRMFLHDNYMHMYDFKNDAAHTTGFPDEDLDYEMPDPMTAMHFKKKRSGAFSMLGAVVAV
Ga0208309_103155813300027226EstuarinePLPLPKDFRHAQHPDNEVWPAHWNDVRFNLRPERQDRRCFIHDNYMNAYDIAHDFAHTTGYVDEDLDFELPDPGVAMHFKLKRSQVTSFAGAFILIAALVGYPIFGLKIP
Ga0209770_1002453853300027769Freshwater LakeMNNKSLLLQALRSRHLSQTQATIMASRIGVRNRYKYDYACEDEYFEREMTILEARHLPLPLPEDWRHKQIPINEIMPAHINDVRFNFLPQHLDRRMYLHDNYQHMYDFTHDAAHTLGYPDEDLDYEMPDPMTAMHFKKKRSGALS
Ga0209175_1019644513300027781Wastewater EffluentMTLYDAKKLPLPIPTTFEHALHPDNEVWPSHWNDVRFNFKPQNLDRRMFIHDNMMNVYDIEHDFAHTTGYVDEDLDYELPDPINAMHYKKKRSGALMFLGAFIVVGATFLYPTAGLKIPQKDNPFYYRKKYASTTSI
Ga0209500_1022734113300027782Freshwater LakeMNNRSIVSAFRLSKSLSHPYHVLATSRIGVKNRYAFDYACEDEYFEKEMTMLEARNLPLPIPKTFKHATPPDNEVQPAHWNAVQFNFLPQRLDRRAFIHDNYMNQYNFEHDFAHTTGYIDEDLDWEMPDPAGAMHFKKKRSGVIAFLGAFITVGALVGYPIFGLKIPQKDNPFFYRKKYATSTSIIQF
Ga0209174_1017144813300027789Wastewater EffluentMTSRIGVRNRYQYDYACEDDYFEREMTMLEARHLPLPLPEDFRHKSPPNHEIWPAHWNDVRFNFKPQNMDRRMFLHDNYMNAYDFPHDIAHTLGYYDEDLDYELPDPMTAMHFKKKRSGVISSLGSIIALAVLIGYPIFGLKMPQKDNPFYYRKKYATPSTLE
Ga0210256_1068459313300030564SoilMTLLEAKKLPLPLPADFKHKSPPFHEIFPAHWNDVRFNFIPGNLDRRMFLHDNYMNLYDFEHDYIHTTGFIDEDHDGEVPDPMTAMHWKKKRSAPMAVIGGIVAVGIFLFYPTMGLKFPQKDNPFYWRKKYGSSGTLH
Ga0210288_110406933300030575SoilYKYDYACEDEYFEKEMTLLEARKLPLPLPTTYRHKQYPMDEIMPAHWNDVRFNFKPQNIDRRMFVHDNYMNMYDFKHDFAHTMGYVDEDLDGEMPDPYSANHFKKKRSGPVAVIAGIIAVGMFILYPTVGLKMP
Ga0247658_111909913300030584SoilETFRHKQLPIHEIYVPHWNDVRFNLKLENIDRRMFLHENYMNNYDFAHDFAHTTGYVDEDLDYELPDPVVAMHFNKNRSTGLAMFGAVIAVGLLLGYPTLGLKMPQKDNPFYYRKKYGSATTLH
Ga0247626_111910813300030591SoilSVFRPRSIAHSRSILQSARIGVNNRYKYDYACEDEYFEKEMTLLEARKLPLPIPTTFKHKSPPVNEIYPPHWNDVRFNFLPQRLDRRMYLHDNMMNAYDFHHDFAHTTGYVDEDLDYELPDPMVGMHFKKKRSGPMAALGIIIVFGMLFGYPMFGLKMPQRDNPFYYRKKYGTPSTMQ
Ga0210276_1029988413300030595SoilGVRNRYKYDYACEDEYFEKHMTMLEARKLPLPLPEDFKHKTIPYHEIYPAHWNDVRFNFKPQHMDRRMFLHDNYMNAYDFHHDFAHTTGYVDEDLDWEMPDPMSAMHFKKKRSGPMAMLGAIFAVGLLFCYPAFGLKMP
Ga0247637_111512013300030604SoilMTLLEARHLPLPMDENFKHKSPPTNEIYPAHWNDVRFNYIPTNLDRRMFLHNNMMNQYDFPHDYAHTTGYIDEDLDWELPDPMTAMHFKKKRSGPMASLGIIIIFGLLFGYPMFGLKFPQRDNPFYYRKKFGTPSTIEQF
Ga0247634_1033018013300030609SoilRYQYDYACEDEYFERDMTLLEARHLPLPMDENFKHKSPPTNEIYPAHWNDVRFNFIPTNLDRRMFLHNNMMNQYDFPHDYAHTTGYIDEDLDWELPDPMTAMHFKKKRSGPMAMIGALIAVGVFIGYPIFGLKMP
Ga0247634_1046351513300030609SoilHMTLLEARKLPLPIPEDFKHKQMPVNEIFPAHINDVRFNFLPQNLDRRMFLHENYMNMYDFLHDHAHTTGYIDEDLDWENGDPMSAMHFKKKRSGPMAIIGGFIAVGLLIFYPTVGMKMP
Ga0247655_1010273413300030621SoilPRSISFSTVERAARIGVHNRYKYDYACEDEYFEKEMTLLEARKLPLPLPPTFKHKEYPMDEIMPAHWNDVRFNFKPENIDRRMYVHANLMNAYDFKHDFPHTMGFVDEDLDGEMPDPYASNHFKKKRSGPVAIIGGVIAVALLILFPTVGLKMPQRDNPFYYRKKYGTPGTIH
Ga0210259_1139950113300030625SoilACEDEYFERSMTMLEARHLPLPLPVDFRHKFPPINEIWPAHWNDVRFNFLPQRLDRRMFIHDNYMNMYDFPHDAAHTTGYYDEDLDYELPDPMSAMHFKKKRSGPVAMMGALIAIGMLVLFPTVGLKMPQKDNPFYFRKKFGTGSTVH
Ga0210282_1016948613300030630SoilAVLLTSRIGVRNRYAYDYACEDEYFEKEMTMLEARHLPLPIPSDFKHNSPPDNEVRPAHWNDVRFNFLPQFQDRRMYMHDNYMNAYDFPHDFAHTTGFIDEDLDYELPDPMKAMHYKKKRSGPMAMIGAVIAVGALLFYPTLGLKMP
Ga0210250_1191640813300030632SoilEDEYFEKHMTMLEARKLPLPLPEDFKHKTIPYHEIYPAHWNDVRFNFKPQHMDRRMFLHDNYMNAYDFHHDFAHTTGYVDEDLDWEMPDPMSAMHFKKKRSGPMAMLGAIFAVGLLFCYPAFGLKMP
Ga0247627_1028751013300030635SoilHEIYPAHWNDVRFNFKPQNLDRRMFMHSNMMNAYDFPHDFAHTTGYVDEDLDYELPDPMTAMHFKKKRSGVTGMLGAVIAVGLFVGYPIFGMKMPQKDNPFYFRKKYGTPTTVEQFQGLALLEYGATV
Ga0247627_1031832113300030635SoilPTSFKHKSPPVHEIWPAHWNDVRFNFLPQRLDRRMYLHDNMMNYYDFHHDFAHTTGYVDEDLDYELPDPMVAMHFKKKRSGPMASLGIIIVFGLLFGYPMFGLKMPQRDNPFYYRKKYGTATTIEQF
Ga0307402_1062465023300030653MarineFHLVNTARIGVRNRYKYDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPAHWNDVRFNHQPQNMDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFLGAFISVGVLLFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0307398_1067785813300030699MarineMMRASRIGVRNRYQWDYACEDEYFERDMTLLEARALPLPMPKDFRHADPPDHEVWPAHWNDVRFNFKPQNLDRRMFIHDNYMNLYDFTHDFAHTTGFIDEDLDYELPDPGSAMHFKKKRSGVTGFMGAIIAVGLLIGYPICGLKVPQKDNPFYYRKKYASAGSI
Ga0307399_1043222213300030702MarineINNSAVVRAFRMQKSLAHPYHLMRASRIGVVNRYKYDYACDDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEIWPAHWNDPRFNFKPQNLDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDYELPDPGSAMHFKKKRSGVISFLGAFISVGLLLFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0265462_1130964513300030738SoilEKEMTLLEARKLPLPLPTTYRHKQYPMDEIMPAHWNDVRFNFKPQNIDRRMFVHDNYMNMYDFKHDFAHTMGYVDEDLDGEMPDPYSANHFKKKRSGPVAVIAGIIAVGMFILYPTVGLKMP
Ga0265462_1254988813300030738SoilMSKSSELASRIGVHNRYKYDYACEDEYFEREMTMLESRKLPLPLPVTFKHKSLPYHEIWPAHINDVRYNYHPERMDRRMHLPTNLMNHYDFMHDFSHTTGYVDEDLDYELPDPYSSNHFKKKRSGPMAMIGAVIAVGTLLFYPTLGLKMPQKDNPF
Ga0265460_1115472123300030740SoilASKLRPRSLSSSRVIISASRIGVRNRYKYDYACEDEYFEKHMTMLEARKLPLPLPEDFKHKTIPYHEIYPAHWNDVRFNFKPQHMDRRMFLHDNYMNAYDFHHDFAHTTGYVDEDLDWEMPDPMSAMHFKKKRSGPMAMLGAIFAVGLLFCYPAFGLKMP
Ga0265460_1212475713300030740SoilMTMLEARKLPLPLPDDFRHKMPPNHEIWPAHWNDVRYNFLPQNLDRRMMLHDNYMNAYDFPHDLAHTTGFVDEDLDFELTDPYNAMHFKKKRSGPMAMIGALIAVGALFAYPIFGLKMP
Ga0265459_1140341813300030741SoilMASRIGVHNRYQYDYACEDEYFEREMTMLEARKLPLPLPDDFRHKMPPNHEIWPAHWNDVRYNFLPQNLDRRMMLHDNYMNAYDFPHDLAHTTGFVDEDLDFELPDPYNAMHFKKKRSGPMAMIGALIAVGALFAYPIFGLKMP
Ga0265459_1165583113300030741SoilRSLSSSRVIISASRIGVRNRYKYDYACEDEYFEKHMTMLEARKLPLPLPEDFKHKTIPYHEIYPAHWNDVRFNFKPQHMDRRMFLHDNYMNAYDFHHDFAHTTGYVDEDLDWEMPDPMSAMHFKKKRSGPMAMLGAIFAVGLLFCYPAFGLKMP
Ga0265459_1188754313300030741SoilSSIEQATRIGVHNRYKYDYACEDEYFEKEMTLLEARKLPLPLPTTYRHKQYPMDEIMPAHWNDVRFNFKPQNIDRRMFVHDNYMNMYDFKHDFAHTMGYVDEDLDGEMPDPYSANHFKKKRSGPVAVIAGIIAVGMFILYPTVGLKMP
Ga0265459_1293483313300030741SoilCEDEYFERSMTMLEARHLPLPLPVDFRHKFPPINEIWPAHWNDVRFNFLPQRLDRRMFIHDNYMNMYDFPHDAAHTTGYYDEDLDYELPDPMSAMHFKKKRSGPVAMMGALIAIGMLVLFPTVGLKMPQKDNPFYFRKKFGTGSTVH
Ga0265459_1354235413300030741SoilHINDVRYNYLPQRLDRRMYLHANYMNHYDFIHDFSHTTGYVDEDLDYEMPDPYSSNHFKKKRSGPMAMVGALIAVGTLLFYPSLGLKMPQKDNPFYYRKKYGDAVTVH
Ga0265461_1133677613300030743SoilPRSLSSSRVIISASRIGVRNRYKYDYACEDEYFEKHMTMLEARKLPLPLPEDFKHKTIPYHEIYPAHWNDVRFNFKPQHMDRRMFLHDNYMNAYDFHHDFAHTTGYVDEDLDWEMPDPMSAMHFKKKRSGPMAMLGAIFAVGLLFCYPAFGLKMP
Ga0265461_1227399423300030743SoilVTFKHKSLPYHALWPAHINDVRYNYLPQRLDRRMYLHANYMNHYDFIHDFSHTTGYVDEDLDYEMPDPYSSNHFKKKRSGPMAMVGALIAVGTLLFYPSLGLKMPQKDNPFYYRKKYGDAVTVH
Ga0265461_1344778113300030743SoilAVLLTSRIGVRNRYAYDYACEDEYFEKEMTMLEARHLPLPIPSDFKHKSPPDNEVRPAHWNDVRFNFLPQFQDRRMYMHDNYMNAYDFPHDFAHTTGFIDEDLDYELPDPMKAMHYKKKRSGPMAMIGAVIAVGALLFYPTLGLKMP
Ga0170824_11216459613300031231Forest SoilREMTLLEAKKLPLPLPADFKHKSPPFHEIFPAHWNDVRFNFIPGNLDRRMFLHDNYMNLYDFEHDYIHTTGFIDEDHDGEVPDPMTAMHWKKKRSAPMAVIGGIVAVGIFLFYPTMGLKFPQKDNPFYWRKKYGSSGTLH
Ga0170824_11658415413300031231Forest SoilRNRYKYDYACEDEYFEKEMTMLEARHLPLPLPVTFKHKVVPLHEIWPAHWNDVRFNFKPHFLDRRMFLHDNYQAGYDFEKDFTHTIGYPDEDLDCELPDPITAMHYKRKRSGAFALLGSAVCLGILFGFPILGMKMPQKDNPFYFRKKYATPGTI
Ga0170824_12521839013300031231Forest SoilMTMLEARHLPLPLPSDFKHKTPPNHEVYPTHWNDVRFNFKPENMDRRMFLHDNLMNAYDFQHDMAHTTGYVDEDLDYELPDPMSAMHFKRKRSGPMAIIGAFLAVGLLLFYPTVGLKMPQKDNPLFYRKKYGTGQTVR
Ga0170820_1716661713300031446Forest SoilRNRYKYDYACEDEYFEKEMTMLEARHLPLPLPVTFKHKVVPLHEIWPAHWNDVRFNFKPHFLDRRMFLHDNYQAGYDFEKDFTHTIGYPDEDLDYELPDPITAMHYKRKRSGAFALLGSAVCLGILFGFPILGMKMPQKDNPFYFRKKYATPGTI
Ga0307386_1041897323300031710MarineMTLLEARALPLPLPKDFKHAEPPDHEVWPAHWNDVRFNFIPQNIDRRMFIHDNYMNLYDFHHDFAHTTGFVDEDLDYELPDPGSAMHFKKKRSAVTGFMGAFVALGVLILYPICGLKVP
Ga0307396_1037319423300031717MarineMTLLEARALPLPLPKDFRHAEPPDHEIWPAHWNDVRFNFIPQNIDRRMFIHDNYMNLYDFPHDFAHTTGFVDEDLDYELPDPLAAMHFKKKRSPVTGFLGVFVALGVLIIYPICGLKVPQKDNPFYYRKKYASETSIT
Ga0307391_1044678423300031729MarineATLAKVFRMQKSIVHPHHLVNTARIGVINRYRFDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPSHWNDVRFNHQPQNLDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFMGVFVALGVFIFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0307391_1045859123300031729MarineMTLLEARALPLPLPKDFRHAAPPDHEVWPAHWNDVRFNFIPQNIDRRMFIHDNYMNLYDFPHDFAHTTGFVDEDLDYELPDPLAAMHFKKKRSPVTGFMGAFVALGILILYPICGLKVPQKDNPFYYRKKYASETSIT
Ga0307387_1097971313300031737MarineLINNSAVVRAFRMQKSLAHPYHLMRASRIGVVNRYKYDYACDDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEIWPAHWNDPRFNFKPQNLDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDYELPDPGSAMHFKKKRSGVISFLGAFISVGLLLFYPTCGLKIPQKDNPFYYRKK
Ga0307404_1035656713300031752MarineLASVFRNQKSIATPFHLVNTARIGVRNRYKYDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPAHWNDVRFNHQPQNMDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFLGAFISVGVLLFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0314684_1086013113300032463SeawaterPLPLPKDFKHADPPDHEVWPSHWNDVRFNHQPQNLDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFMGVFIALGVFIFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0314689_1047705313300032518SeawaterRATLAKVFRMQKSIVHPHHLVNTARIGVINRYRFDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPSHWNDVRFNHQPQNLDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFMGVFIALGVFIFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0314676_1067158123300032519SeawaterFDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPSHWNDVRINHQPQNLDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFMGVFIALGVFIFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0314680_1054578923300032521SeawaterNNRATLAKVFRMQKSIVHPHHLVNTARIGVINRYRFDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPSHWNDVRFNHQPQNLDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFMGVFIALGVFIFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0314674_1041488513300032615SeawaterVFRMQKSIVHPHHLVNTARIGVINRYRFDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPSHWNDVRFNHQPQNLDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFMGVFIALGVFIFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0314683_1057132113300032617SeawaterRATLAKVFRMQKSIVHPHHLVNTARIGVINRYRFDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPSHWNDVRFNHQPQNLDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFMGVFIALGVFIFYPTCGLKIPQKDNPSTTERSTLLPLPSNNSRSWL
Ga0314673_1038192223300032650SeawaterNRATLAKVFRMQKSIVHPHHLVNTARIGVINRYRFDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPSHWNDVRFNHQPQNLDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFMGVFIALGVFIFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0314687_1047000623300032707SeawaterATLAKVFRMQKSIVHPHHLVNTARIGVINRYRFDYACEDEYFQRDMTLLEARNLPLPLPKDFKHADPPDHEVWPSHWNDVRFNHQPQNLDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFMGVFIALGVFIFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0314681_1064974413300032711SeawaterLPLPLPKDFKHADPPDHEVWPSHWNDVRFNHQPQNLDRRMFLNDNYMNLYDFPHDFAHTTGFVDEDLDFELPDPGSAMHFKKKRSGVISFMGVFIALGVFIFYPTCGLKIPQKDNPFYYRKKYATSSSI
Ga0314710_1048684113300032742SeawaterVNRNLTGLFRVGRSMSHPYSLLRTTRIGVENRYKYDYACEDEYFQRDMTLLEARHLPLPLPKDFRHVSPPDHEVWPAHWNDVRFNFKPQNLDRRAFIHDNYMNMYDFQHDFAHTTGFVDEDLDYELPDPGSAMHFKKKRSGPIMFMGAIIWVGVLFFVPTMGFKIPQKDN
Ga0334989_0266733_212_6223300033984FreshwaterMLEAKHLPLPIPKDFSHALHPDNEVWPAHWNDVRFNFIPQNQDRRAFIHDNYMNVYDFEHDFAHTTGFVDEDLDWELPDPAGAMHFKKKRSGALMFLGAFITVGAFVLYPICGLKVPQKDNPFFYRKKYATSTSIL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.