| Basic Information | |
|---|---|
| Family ID | F051403 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MLVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 77.08 % |
| % of genes near scaffold ends (potentially truncated) | 17.36 % |
| % of genes from short scaffolds (< 2000 bps) | 85.42 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.167 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.111 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.472 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.861 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF01230 | HIT | 25.00 |
| PF03640 | Lipoprotein_15 | 5.56 |
| PF01544 | CorA | 4.17 |
| PF00274 | Glycolytic | 4.17 |
| PF14329 | DUF4386 | 1.39 |
| PF09851 | SHOCT | 1.39 |
| PF03793 | PASTA | 1.39 |
| PF00849 | PseudoU_synth_2 | 0.69 |
| PF13378 | MR_MLE_C | 0.69 |
| PF02894 | GFO_IDH_MocA_C | 0.69 |
| PF10031 | DUF2273 | 0.69 |
| PF07690 | MFS_1 | 0.69 |
| PF07883 | Cupin_2 | 0.69 |
| PF08044 | DUF1707 | 0.69 |
| PF00082 | Peptidase_S8 | 0.69 |
| PF11987 | IF-2 | 0.69 |
| PF00528 | BPD_transp_1 | 0.69 |
| PF01566 | Nramp | 0.69 |
| PF03448 | MgtE_N | 0.69 |
| PF13360 | PQQ_2 | 0.69 |
| PF13396 | PLDc_N | 0.69 |
| PF05746 | DALR_1 | 0.69 |
| PF00188 | CAP | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 5.56 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 4.17 |
| COG3588 | Fructose-bisphosphate aldolase class 1 | Carbohydrate transport and metabolism [G] | 4.17 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.69 |
| COG0751 | Glycyl-tRNA synthetase, beta subunit | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.69 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.69 |
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.17 % |
| Unclassified | root | N/A | 20.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559006|FI_contig16901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 777 | Open in IMG/M |
| 2170459019|G14TP7Y01C178X | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 690 | Open in IMG/M |
| 2170459021|G14TP7Y02JS374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 2170459022|GZEQPF101ANBDH | Not Available | 525 | Open in IMG/M |
| 2199352024|deeps_contig36658.23277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1924 | Open in IMG/M |
| 3300001686|C688J18823_10056795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2712 | Open in IMG/M |
| 3300001686|C688J18823_10107885 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
| 3300005181|Ga0066678_11089390 | Not Available | 514 | Open in IMG/M |
| 3300005332|Ga0066388_101639884 | Not Available | 1134 | Open in IMG/M |
| 3300005435|Ga0070714_100078283 | All Organisms → cellular organisms → Bacteria | 2873 | Open in IMG/M |
| 3300005456|Ga0070678_100045206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3149 | Open in IMG/M |
| 3300005538|Ga0070731_10306812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1054 | Open in IMG/M |
| 3300005540|Ga0066697_10187292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1229 | Open in IMG/M |
| 3300005553|Ga0066695_10620981 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300005563|Ga0068855_102028207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 581 | Open in IMG/M |
| 3300005564|Ga0070664_100260980 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300005574|Ga0066694_10206478 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300005578|Ga0068854_100141103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1849 | Open in IMG/M |
| 3300005598|Ga0066706_11509127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300005614|Ga0068856_100184907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2097 | Open in IMG/M |
| 3300005764|Ga0066903_100009339 | All Organisms → cellular organisms → Bacteria | 9205 | Open in IMG/M |
| 3300005764|Ga0066903_100116143 | All Organisms → cellular organisms → Bacteria | 3696 | Open in IMG/M |
| 3300005764|Ga0066903_101092547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1469 | Open in IMG/M |
| 3300005764|Ga0066903_101924465 | Not Available | 1133 | Open in IMG/M |
| 3300005764|Ga0066903_103753106 | Not Available | 817 | Open in IMG/M |
| 3300005764|Ga0066903_104571874 | Not Available | 737 | Open in IMG/M |
| 3300005764|Ga0066903_108006960 | Not Available | 542 | Open in IMG/M |
| 3300005764|Ga0066903_108968861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 507 | Open in IMG/M |
| 3300005893|Ga0075278_1038545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 698 | Open in IMG/M |
| 3300005899|Ga0075271_10100908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300006028|Ga0070717_10020668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5181 | Open in IMG/M |
| 3300006028|Ga0070717_10232243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1624 | Open in IMG/M |
| 3300006028|Ga0070717_10492944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1107 | Open in IMG/M |
| 3300006028|Ga0070717_11046085 | Not Available | 743 | Open in IMG/M |
| 3300006028|Ga0070717_11420244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300006032|Ga0066696_10098531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1752 | Open in IMG/M |
| 3300006058|Ga0075432_10519972 | Not Available | 533 | Open in IMG/M |
| 3300006059|Ga0075017_100053535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2719 | Open in IMG/M |
| 3300006173|Ga0070716_100617377 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300006173|Ga0070716_100622625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 815 | Open in IMG/M |
| 3300006173|Ga0070716_100651675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300006576|Ga0074047_10101302 | Not Available | 509 | Open in IMG/M |
| 3300006578|Ga0074059_11413552 | Not Available | 683 | Open in IMG/M |
| 3300006578|Ga0074059_11776702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1196 | Open in IMG/M |
| 3300006580|Ga0074049_12992896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
| 3300006804|Ga0079221_10217378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1060 | Open in IMG/M |
| 3300006806|Ga0079220_10085173 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300006806|Ga0079220_10579045 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 791 | Open in IMG/M |
| 3300006806|Ga0079220_11902009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300009098|Ga0105245_10355737 | Not Available | 1452 | Open in IMG/M |
| 3300009137|Ga0066709_102468026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 703 | Open in IMG/M |
| 3300009174|Ga0105241_10805273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 866 | Open in IMG/M |
| 3300009792|Ga0126374_11373004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
| 3300010048|Ga0126373_11153490 | Not Available | 841 | Open in IMG/M |
| 3300010154|Ga0127503_10005032 | Not Available | 577 | Open in IMG/M |
| 3300010154|Ga0127503_10883418 | All Organisms → cellular organisms → Bacteria | 2603 | Open in IMG/M |
| 3300010154|Ga0127503_11115328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1723 | Open in IMG/M |
| 3300010320|Ga0134109_10392951 | Not Available | 553 | Open in IMG/M |
| 3300010333|Ga0134080_10082752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1302 | Open in IMG/M |
| 3300010335|Ga0134063_10157270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1057 | Open in IMG/M |
| 3300010335|Ga0134063_10541082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300010358|Ga0126370_11133117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 723 | Open in IMG/M |
| 3300010358|Ga0126370_11750308 | Not Available | 600 | Open in IMG/M |
| 3300010360|Ga0126372_10154501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1840 | Open in IMG/M |
| 3300010362|Ga0126377_12091514 | Not Available | 642 | Open in IMG/M |
| 3300010373|Ga0134128_12776168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 540 | Open in IMG/M |
| 3300010376|Ga0126381_100656585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1497 | Open in IMG/M |
| 3300010376|Ga0126381_100987163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 1215 | Open in IMG/M |
| 3300010398|Ga0126383_13419601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
| 3300011106|Ga0151489_1620555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300012199|Ga0137383_11188503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
| 3300012211|Ga0137377_10112442 | All Organisms → cellular organisms → Bacteria | 2588 | Open in IMG/M |
| 3300012349|Ga0137387_10311255 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300012914|Ga0157297_10238116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 652 | Open in IMG/M |
| 3300012915|Ga0157302_10332958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 602 | Open in IMG/M |
| 3300012951|Ga0164300_10169389 | Not Available | 1042 | Open in IMG/M |
| 3300012955|Ga0164298_10728024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 700 | Open in IMG/M |
| 3300012957|Ga0164303_10336171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 906 | Open in IMG/M |
| 3300012958|Ga0164299_11570355 | Not Available | 517 | Open in IMG/M |
| 3300012960|Ga0164301_10626128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 798 | Open in IMG/M |
| 3300012977|Ga0134087_10109164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1167 | Open in IMG/M |
| 3300012977|Ga0134087_10340526 | Not Available | 714 | Open in IMG/M |
| 3300012984|Ga0164309_10723942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 792 | Open in IMG/M |
| 3300012986|Ga0164304_10842621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 712 | Open in IMG/M |
| 3300012989|Ga0164305_10565778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 907 | Open in IMG/M |
| 3300013105|Ga0157369_10400997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1423 | Open in IMG/M |
| 3300015358|Ga0134089_10164834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 880 | Open in IMG/M |
| 3300015371|Ga0132258_12580876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1270 | Open in IMG/M |
| 3300015373|Ga0132257_100857813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1136 | Open in IMG/M |
| 3300017947|Ga0187785_10070892 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300017959|Ga0187779_10039459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2738 | Open in IMG/M |
| 3300018032|Ga0187788_10549908 | Not Available | 505 | Open in IMG/M |
| 3300018433|Ga0066667_10299107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1250 | Open in IMG/M |
| 3300018468|Ga0066662_10494093 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300018482|Ga0066669_11634252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 589 | Open in IMG/M |
| 3300019362|Ga0173479_10867672 | Not Available | 507 | Open in IMG/M |
| 3300020069|Ga0197907_11405396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 909 | Open in IMG/M |
| 3300020070|Ga0206356_11297712 | Not Available | 503 | Open in IMG/M |
| 3300020080|Ga0206350_10010368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1183 | Open in IMG/M |
| 3300021478|Ga0210402_11831544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300021560|Ga0126371_11641844 | Not Available | 768 | Open in IMG/M |
| 3300022467|Ga0224712_10193940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
| 3300022467|Ga0224712_10387914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 664 | Open in IMG/M |
| 3300024055|Ga0247794_10065704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1024 | Open in IMG/M |
| 3300024347|Ga0179591_1193728 | Not Available | 2878 | Open in IMG/M |
| 3300025910|Ga0207684_10854814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300025922|Ga0207646_10000502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 52324 | Open in IMG/M |
| 3300025927|Ga0207687_11212318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
| 3300025929|Ga0207664_10007435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 7595 | Open in IMG/M |
| 3300025929|Ga0207664_10607413 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300025929|Ga0207664_12011576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300026034|Ga0208773_1033203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 666 | Open in IMG/M |
| 3300026078|Ga0207702_11133269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 776 | Open in IMG/M |
| 3300026109|Ga0208774_1070129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300027765|Ga0209073_10128276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 920 | Open in IMG/M |
| 3300027869|Ga0209579_10133396 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300027907|Ga0207428_10349343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1088 | Open in IMG/M |
| 3300031057|Ga0170834_101618642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 635 | Open in IMG/M |
| 3300031199|Ga0307495_10059499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
| 3300031226|Ga0307497_10394056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 660 | Open in IMG/M |
| 3300031226|Ga0307497_10409513 | Not Available | 650 | Open in IMG/M |
| 3300031543|Ga0318516_10418524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
| 3300031544|Ga0318534_10011090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4530 | Open in IMG/M |
| 3300031572|Ga0318515_10427687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 708 | Open in IMG/M |
| 3300031858|Ga0310892_11130056 | Not Available | 556 | Open in IMG/M |
| 3300031938|Ga0308175_100069914 | All Organisms → cellular organisms → Bacteria | 3122 | Open in IMG/M |
| 3300031938|Ga0308175_100200561 | All Organisms → cellular organisms → Bacteria | 1964 | Open in IMG/M |
| 3300031939|Ga0308174_10084330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2242 | Open in IMG/M |
| 3300031939|Ga0308174_10787253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 798 | Open in IMG/M |
| 3300032001|Ga0306922_12080138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 551 | Open in IMG/M |
| 3300032076|Ga0306924_12222713 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300032180|Ga0307471_101553951 | Not Available | 819 | Open in IMG/M |
| 3300032261|Ga0306920_100513930 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
| 3300032261|Ga0306920_103766795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
| 3300032770|Ga0335085_10024188 | All Organisms → cellular organisms → Bacteria | 8576 | Open in IMG/M |
| 3300032770|Ga0335085_10501120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1386 | Open in IMG/M |
| 3300032770|Ga0335085_12227696 | Not Available | 550 | Open in IMG/M |
| 3300032783|Ga0335079_10116042 | All Organisms → cellular organisms → Bacteria | 3025 | Open in IMG/M |
| 3300032893|Ga0335069_10042250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6065 | Open in IMG/M |
| 3300032893|Ga0335069_10850750 | Not Available | 1023 | Open in IMG/M |
| 3300032955|Ga0335076_10113725 | All Organisms → cellular organisms → Bacteria | 2632 | Open in IMG/M |
| 3300033004|Ga0335084_10222499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1959 | Open in IMG/M |
| 3300033412|Ga0310810_11313094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300033475|Ga0310811_11259000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.47% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.78% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.78% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.08% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.08% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.39% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.39% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.39% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 1.39% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.69% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 2170459022 | Grass soil microbial communities from Rothamsted Park, UK - FA2 (control condition) | Environmental | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
| 3300005899 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026034 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026109 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00060570 | 2166559006 | Grass Soil | MLVDVVAVLVLVLMAADVFRMLFVDTEPERDPVRRADRPERGG |
| 4MG_04176280 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MLVEVVAVLVLVLMGADVFRMLFLDTEPRRDPVRRNAPSG |
| 4NP_00292140 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | MLVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS |
| FA2_05226680 | 2170459022 | Grass Soil | MSVEVVAVLVLVLMAADVFRMVFIDTEPQREPVRRNDS |
| deeps_03948650 | 2199352024 | Soil | MLVDVVAVLVMVLMAGDVVRMLFVDSEPHGDPVRRNDS |
| C688J18823_100567952 | 3300001686 | Soil | MLVDVVAALVLVLMAADVFRMLFVDTETQRDPVRRNNS* |
| C688J18823_101078853 | 3300001686 | Soil | MAVDVVAVLVLVLMAADAFRMLFVDTEPQRDPVRRNDP* |
| Ga0066678_110893902 | 3300005181 | Soil | MDMLVEVVAVLVLVLMTADVLRMLFADSEPQRDPVRRRDS* |
| Ga0066388_1016398841 | 3300005332 | Tropical Forest Soil | YDESMLVQVVAVIVLVLMAADILRMLFADTEPQRDPVRRRNS* |
| Ga0070714_1000782833 | 3300005435 | Agricultural Soil | MHMLVDVVAVLVLVLMAADVFRMLLIDTEPHRDPARRDDS* |
| Ga0070678_1000452061 | 3300005456 | Miscanthus Rhizosphere | VAVDVVAALVLVLMAADVFRMLFVDTELQRDPVRRNDPSG* |
| Ga0070731_103068122 | 3300005538 | Surface Soil | VIVDVVAVLVLVLMGADVVRMLFVDPEPRHDPARRQDS* |
| Ga0066697_101872923 | 3300005540 | Soil | MAVEVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDP* |
| Ga0066695_106209812 | 3300005553 | Soil | MAVDLVAVLVLVLMAMDVFRMLFVDTEPQRDPVRRNDP* |
| Ga0068855_1020282072 | 3300005563 | Corn Rhizosphere | VAVDVVAALVLVLMAADVFRMLFVDTELQRDPVRRNDS* |
| Ga0070664_1002609804 | 3300005564 | Corn Rhizosphere | MLVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS* |
| Ga0066694_102064782 | 3300005574 | Soil | MAVDLVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDP* |
| Ga0068854_1001411033 | 3300005578 | Corn Rhizosphere | MLVDVVAVLVLALMAADVFRMLFVDTEPRRDPDRPNGS* |
| Ga0066706_115091271 | 3300005598 | Soil | VVAVLVLVLMAMDVFRMLFVDTEPQRDPVRRNDP* |
| Ga0068856_1001849075 | 3300005614 | Corn Rhizosphere | MLVEVVAVLVLVLMGADVFRMVFLDTEPRRDPVRRNDP* |
| Ga0066903_1000093393 | 3300005764 | Tropical Forest Soil | MLVQVVAVLVLVLMTADILRMLFADTEPQRDPVRRRDT* |
| Ga0066903_1001161436 | 3300005764 | Tropical Forest Soil | MLVQVVAVLVLVLMAADILRMLFADTEPQRDPVRRRDS* |
| Ga0066903_1010925472 | 3300005764 | Tropical Forest Soil | MAVDVVAVLVLVLMAADTFRMLFVDTEPQRDPARRRDA* |
| Ga0066903_1019244653 | 3300005764 | Tropical Forest Soil | MAVAVVAVLVLVLMAADTFRMLFIDTEPQRDPVRRRDS* |
| Ga0066903_1037531062 | 3300005764 | Tropical Forest Soil | VLVDVVAVLVLVLMAADVFRMLYLDDEPQRDPVRRDDS* |
| Ga0066903_1045718742 | 3300005764 | Tropical Forest Soil | MAVDVVAVLVLVLMAADTFRMLFIDTEPQRDPVRRRDS* |
| Ga0066903_1080069602 | 3300005764 | Tropical Forest Soil | MAVDVVAVLVLVLMAADVFRMLFIDTEPQHDPVRRRDS* |
| Ga0066903_1089688612 | 3300005764 | Tropical Forest Soil | MLVQVVAVIVLVLMAADILRMLFAEAEPERNPVRRRDS* |
| Ga0075278_10385452 | 3300005893 | Rice Paddy Soil | MAVDVVAVLVLLLMLGDVIRMLFDDAEPHRDPARRNGS* |
| Ga0075271_101009081 | 3300005899 | Rice Paddy Soil | VLVDVVAALVMLLMLGDVIRMLFVDPEPQRDPVRGNDS* |
| Ga0070717_100206684 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVDVVAVLVLVLMAADVFRMLFVDTEPPGDPARRRDS* |
| Ga0070717_102322431 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVEVVAVLVLVLMAADVFRMVFLDTDPQRDPVRRNDR* |
| Ga0070717_104929441 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVEVVAVLVLVLMGADVFRMLFLDTEPQRDPVRRNDP* |
| Ga0070717_110460852 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MHMLVDVVAVLVLVLMAADVFRMLFIDTEPQRDPARRDDS* |
| Ga0070717_114202441 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVDVVAALVLVLMAADVFRMLFIDTEPQRVETRRDPVRRGDS* |
| Ga0066696_100985314 | 3300006032 | Soil | MAVEVVAVLVLVLMAMDVFRMLFVDTEPQRDPVRRNDP* |
| Ga0075432_105199721 | 3300006058 | Populus Rhizosphere | VAVYVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS* |
| Ga0075017_1000535355 | 3300006059 | Watersheds | VLVDVVAVLVLVLMVADVFRMLFVDSGPQHDPVCRDDS* |
| Ga0070716_1006173772 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVDVVAALVLVLMAADVFRMLFVDTEPQRAPARRDDA* |
| Ga0070716_1006226252 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVDVVAVLVLVLMAADVFRMLFVDTELQRDPVRRNDS* |
| Ga0070716_1006516751 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DGAQGYDTAMLVDVVAVLVLVLMAADVFRMLFIDTEPQRDPARRDDS* |
| Ga0074047_101013021 | 3300006576 | Soil | DVVAVLVLVLMAADVFRMLFIDTEPQRDPARRDDS* |
| Ga0074059_114135522 | 3300006578 | Soil | MVEVVAVLVLVLMAADVLRMLFADAEPQRDPVRRRDS* |
| Ga0074059_117767022 | 3300006578 | Soil | MLVDVVAVVVMLLMLGDVIRMLFVDTEPEPQRDPVRRNDFQ* |
| Ga0074049_129928961 | 3300006580 | Soil | MYMLVDVVAVLVLVLMAADVFRMLFIDTEPQRDPARRDDS* |
| Ga0079221_102173782 | 3300006804 | Agricultural Soil | MLVDAVAVLVLVLMAADVFRMLFVDTEPERNPARRGDS* |
| Ga0079220_100851733 | 3300006806 | Agricultural Soil | MLVNAVAVLVLVLMAADVFRMLFVDTEPERNPARRNDS* |
| Ga0079220_105790453 | 3300006806 | Agricultural Soil | MAVDVVAVLVLVLMAADTFRMLFIDTEPQRDPARR |
| Ga0079220_119020091 | 3300006806 | Agricultural Soil | MAVDVVAVLVLVLMAADTFRMLFIDTEPQRDPARRRDS* |
| Ga0105245_103557374 | 3300009098 | Miscanthus Rhizosphere | RARGYDENVAVYVVAVLVLVLMAADVFRMLFVDTEPQHGPVRRNDS* |
| Ga0066709_1024680261 | 3300009137 | Grasslands Soil | MAVDVVAALVLLLMAADVFRMLFVDTEPQREPVRRRDS* |
| Ga0105241_108052732 | 3300009174 | Corn Rhizosphere | MLVDVVAVLVLVLMAADVFRMLFVDTEPQHGPVRRNDS* |
| Ga0126374_113730041 | 3300009792 | Tropical Forest Soil | MLVQVVAVIVLVLMAADILRMLFADAEPQRNPVRRRDS* |
| Ga0126373_111534901 | 3300010048 | Tropical Forest Soil | MLVDVVAVLVLVLMAADVFRMLFIDTEPQRDRAHRDNT* |
| Ga0127503_100050322 | 3300010154 | Soil | EHMLVDVVAVLVLLLMAADVFRMLFVDTEPQRDPVRRDDF* |
| Ga0127503_108834182 | 3300010154 | Soil | MLVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRADRPERGG* |
| Ga0127503_111153284 | 3300010154 | Soil | MLVDVVAVLVLLLMGADVFRMLFIDTEPQRDPVRRDDF* |
| Ga0134109_103929512 | 3300010320 | Grasslands Soil | MAVDLVAVLVLVLMAADVFRMLFVDTEPQRDPVRRND |
| Ga0134080_100827523 | 3300010333 | Grasslands Soil | MAVEVVAVLVLVLMAADVLRMLFVDTEPQRDPVRRNDP* |
| Ga0134063_101572702 | 3300010335 | Grasslands Soil | MLVDVVAVLVLVLMAADAFRMLFVDTEPQRDRVRRNNS* |
| Ga0134063_105410822 | 3300010335 | Grasslands Soil | YDENMAVEVVAVLVLVLMAMDVFRMLFVDTEPQRDPVRRNDP* |
| Ga0126370_111331172 | 3300010358 | Tropical Forest Soil | MLVQVVAVLVLVLMAADILRMLFADTEPQRDPVRRRNS* |
| Ga0126370_117503081 | 3300010358 | Tropical Forest Soil | VTVELVAVLVLVLMAADILRMLFADDEPQRNPVRRRDS* |
| Ga0126372_101545013 | 3300010360 | Tropical Forest Soil | MLVQVVAVIVLVLMAADILRMLFADTEPQRDPVRRRNS* |
| Ga0126377_120915141 | 3300010362 | Tropical Forest Soil | MLVDVVAVLVLVLMTADILRMLFADEEPQRHSVRRRDS* |
| Ga0134128_127761682 | 3300010373 | Terrestrial Soil | MVVDVVAALVLLLMAGDVLRMVFVDPEPRRDPVRRNDS* |
| Ga0126381_1006565851 | 3300010376 | Tropical Forest Soil | MLVDIVAVLVLVLMAADVFRMLYLDDEPQRDPVRRDDS* |
| Ga0126381_1009871633 | 3300010376 | Tropical Forest Soil | LRGYDKHMLVDVVAVLVLVLMAADVFRMLFIDTEPPRDPARRDHS* |
| Ga0126383_134196012 | 3300010398 | Tropical Forest Soil | MAVDVVAVLVLVLMAADTFRMLFIDTEAQRDPVRRRDS* |
| Ga0151489_16205552 | 3300011106 | Soil | MLVDVVAVLVLLLMLGDVIRMLFVDTEPEPQREPVRRNDSQ* |
| Ga0137383_111885032 | 3300012199 | Vadose Zone Soil | MLVDVVAVLVMLLMLGDVIRMLFVDTEPQRNPVRRSDSQ* |
| Ga0137377_101124424 | 3300012211 | Vadose Zone Soil | MLVDVVAVLVMLLMLGDVIRMLFVDTEPQRAPVRRSDSQ* |
| Ga0137387_103112553 | 3300012349 | Vadose Zone Soil | MLVDVVAVLVMLLMLGDVIRMLFVDTEPQRDPVRRNDS* |
| Ga0157297_102381162 | 3300012914 | Soil | VAVDVVAALVLVLMAADVFRMLFIDTEPQRDPVRRNDP* |
| Ga0157302_103329582 | 3300012915 | Soil | VAVDVVAALVLVLMAADVFRMLFVDTEQQRDPVRRNDS* |
| Ga0164300_101693892 | 3300012951 | Soil | VAVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS* |
| Ga0164298_107280242 | 3300012955 | Soil | MLVEVVAVLVMLLMLGDVIRMLFVDTEPQRDPVRRTDR* |
| Ga0164303_103361713 | 3300012957 | Soil | VAVDVVAVLVLVLMAADVFRMVVLDTEPRRDLARRDDS* |
| Ga0164299_115703552 | 3300012958 | Soil | VVVDVVAALVLVLMAADVFRMLFVDTEPQRGAVRRNDY* |
| Ga0164301_106261282 | 3300012960 | Soil | MLVEVVAVLVMLLMLGDVIRMLCVDTEPQRDPVRRTDR* |
| Ga0134087_101091641 | 3300012977 | Grasslands Soil | MAVDLVAVLVLVLMAMDVFRMLFVDTEPQRDPVRR |
| Ga0134087_103405261 | 3300012977 | Grasslands Soil | MAVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRRDS* |
| Ga0164309_107239421 | 3300012984 | Soil | MAVDVVASLVLLLMAADMFRMLFIDTELQRDPVRRHDSRL* |
| Ga0164304_108426211 | 3300012986 | Soil | VAVDVVAVLVLVLMAADVFRMLFVDTEPQRGAVRRNDY* |
| Ga0164305_105657782 | 3300012989 | Soil | MLVDVVAALVLGLMAADVFRMLFVDTEPQRAPARRDDA* |
| Ga0157369_104009973 | 3300013105 | Corn Rhizosphere | MLVEVVAVLVLVLMGADVFRMLFLDTEPRRDPVRRNDP* |
| Ga0134089_101648342 | 3300015358 | Grasslands Soil | MAVEVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNNS* |
| Ga0132258_125808763 | 3300015371 | Arabidopsis Rhizosphere | VAVDVVAVLVLVLMAADVFRMLFIDTEPQRDPVRRNDS* |
| Ga0132257_1008578132 | 3300015373 | Arabidopsis Rhizosphere | VAVDVVAVLVLVLMAADVFRMLFVDTEPERDPVRRNDS* |
| Ga0187785_100708921 | 3300017947 | Tropical Peatland | MLVQVVAVLVLVLMGADVLRMLFADPEPRRDPVRRRDS |
| Ga0187779_100394592 | 3300017959 | Tropical Peatland | MLVDVVAVVVLLLMAGDVFRMLFIDTEPQRDRVRRNDDS |
| Ga0187788_105499082 | 3300018032 | Tropical Peatland | MLVQVVAVVVLVLMGADVLRMLFADPEPQRDPVRRRDS |
| Ga0066667_102991071 | 3300018433 | Grasslands Soil | MLVDVVAVLVLVLMAADAFRMLFVDTEPQRDPVRRNNS |
| Ga0066662_104940933 | 3300018468 | Grasslands Soil | MAVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDP |
| Ga0066669_116342522 | 3300018482 | Grasslands Soil | MAVEVVAVLVLVLMAMDVFRMLFVDTEPQRDPVRRNDP |
| Ga0173479_108676721 | 3300019362 | Soil | VAVDVVAALVLVLMAADVFRMLFIDTELQRDPVRRNDS |
| Ga0197907_114053963 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | VDVVAALVLLLMAGDVLRMVFVDPEPRRDPVRRNDS |
| Ga0206356_112977121 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VSVDVGAALVLVLMAADVFRMLFVDTELQRDPVRRNDS |
| Ga0206350_100103683 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | DVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS |
| Ga0210402_118315442 | 3300021478 | Soil | MLVDVVAVVVMLLMLGDVIRMLFVDTEPEPQRDPVRRNDFQ |
| Ga0126371_116418442 | 3300021560 | Tropical Forest Soil | MLVDVVAVLVLVLMAADVFRMLFIDTEPQRDPARRDHS |
| Ga0224712_101939401 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVEVVAVLVLVLMGADVFRMLFLDTEPRRDPVRRNDP |
| Ga0224712_103879142 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVDVVAALVLVLMAADVFRMLFVDTELQRDPVRRNDS |
| Ga0247794_100657043 | 3300024055 | Soil | MTRNVAVDVVAVLVLVLMAADAFRMLLVDTEPRRDPARR |
| Ga0179591_11937284 | 3300024347 | Vadose Zone Soil | MAVDLVAALVLVLMAADVFRMLFVDTEPQRDPVRRNDS |
| Ga0207684_108548141 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVDVVAALVLVLMAADVFRMLFVDTEPQRDPVRRN |
| Ga0207646_1000050212 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVQVVAVLVLVLMLADIFRMLFADPEPQRAPVRRRDS |
| Ga0207687_112123181 | 3300025927 | Miscanthus Rhizosphere | TMLVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS |
| Ga0207664_100074351 | 3300025929 | Agricultural Soil | MLVEVVAVLVLVLMAADVFRMVFLDTDPQRDPVRRHDR |
| Ga0207664_106074132 | 3300025929 | Agricultural Soil | MHMLVDVVAVLVLVLMAADVFRMLLIDTEPHRDPARRDDS |
| Ga0207664_120115761 | 3300025929 | Agricultural Soil | VEVVAVLVLVLMGADVFRMLFLDTEPQRDPVRRNDP |
| Ga0208773_10332032 | 3300026034 | Rice Paddy Soil | MAVDVVAVLVLLLMLGDVIRMLFDDAEPHRDPARRNGS |
| Ga0207702_111332693 | 3300026078 | Corn Rhizosphere | MLVEVVAVLVLVLMGADVFRMLFLDTEPRRDPVRR |
| Ga0208774_10701291 | 3300026109 | Rice Paddy Soil | VTVAVVAVLVMLLMLGDVIRMLFDDAEPHRDPARRNGS |
| Ga0209073_101282762 | 3300027765 | Agricultural Soil | MLVNAVAVLVLVLMAADVFRMLFVDTEPERNPARRGDS |
| Ga0209579_101333962 | 3300027869 | Surface Soil | VIVDVVAVLVLVLMGADVVRMLFVDPEPRHDPARRQDS |
| Ga0207428_103493432 | 3300027907 | Populus Rhizosphere | VAVYVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS |
| Ga0170834_1016186422 | 3300031057 | Forest Soil | MLVDVVAVLVLLLMAADTFRMLFVDTEPHRGPARRDDS |
| Ga0307495_100594992 | 3300031199 | Soil | VVVEVVAVLVLVLMAADVFRMLFIDTEPQRNPVRRNDS |
| Ga0307497_103940561 | 3300031226 | Soil | MVVEVVAVLVLVLMAADVFRMLFIDTEPQRNPVRRNDS |
| Ga0307497_104095133 | 3300031226 | Soil | VDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS |
| Ga0318516_104185243 | 3300031543 | Soil | YSTMLVDVVAVLVLVLMAADVFRMLFIDTEPQREPARRDDSRR |
| Ga0318534_100110903 | 3300031544 | Soil | MLVDVVAVLVLVLMAADVFRMLFIDTEPQREPARRDDSRR |
| Ga0318515_104276871 | 3300031572 | Soil | MLVDVVAVLVLVLMAADVFRMLFIDTEPQREPARRDDSR |
| Ga0310892_111300563 | 3300031858 | Soil | VAVDVVAVLVLVLMAADVFRMLFIDTEPQRDPVRRNDS |
| Ga0308175_1000699146 | 3300031938 | Soil | MLVDVVAALVLVLMAGDVLRMLFVDPEPHGDPVRRNDS |
| Ga0308175_1002005612 | 3300031938 | Soil | MAVDVVAVLVLVLMAADIFRMLFVDTELQRDPVRRRNDS |
| Ga0308174_100843304 | 3300031939 | Soil | MAVDLVAVLVLVLMAADVYRMLFVDTEPPRDAVRRDGS |
| Ga0308174_107872532 | 3300031939 | Soil | VKVLVDVVAVLVLVLMAGDVYRMLFVDTEPQHETARRGDS |
| Ga0306922_120801382 | 3300032001 | Soil | MLVDVVAVLVLVLMGADVFRMLFIDTEPQREPARRDDSRR |
| Ga0306924_122227132 | 3300032076 | Soil | MLVDVVAVLVLVLMGADVFRMLFIDTEPQRTSARRDDSRR |
| Ga0307471_1015539511 | 3300032180 | Hardwood Forest Soil | MLVDVVAVLVLLLMAGDVFRMLFIDTEPQHEHARRNDS |
| Ga0306920_1005139304 | 3300032261 | Soil | MLVDVVAVLVLVLMAADMFRMLFIDTEPQREPARRDDSRR |
| Ga0306920_1037667952 | 3300032261 | Soil | MLVEVVAVLVLVLMGADVLRMLFADAEPQRNPVRRRDSSR |
| Ga0335085_100241882 | 3300032770 | Soil | MLVDVVAVLVLLLMGADIFRMLFVDTEPHRNPVRRDDS |
| Ga0335085_105011202 | 3300032770 | Soil | MLVDVVAVLVLLLMAGDVFRMLFVDTEPQRNPVRRND |
| Ga0335085_122276961 | 3300032770 | Soil | VLVDVVAVLVLVLMGADVFRMLFIDTEPPRYAARRRDS |
| Ga0335079_101160423 | 3300032783 | Soil | VLVDLVAVLVLVLLAADVFRMLFVDTEPRRDPVRRHDS |
| Ga0335069_100422503 | 3300032893 | Soil | MLVDLVAVLVLLLMAGDVFRMLFVDTEPQRNPVRRND |
| Ga0335069_108507502 | 3300032893 | Soil | VLVDVVAVLVLVLMAADVFRMLFVDDEPHRSSVRRDDS |
| Ga0335076_101137251 | 3300032955 | Soil | VLVDLVAVLVLVLLAADVFRMLFVDTEPRHDPVRRHDS |
| Ga0335084_102224992 | 3300033004 | Soil | MLVDVVAAFVLVLMAADVFRMLFVDTEPQRAPARRDDT |
| Ga0310810_113130941 | 3300033412 | Soil | YDKTMLVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS |
| Ga0310811_112590002 | 3300033475 | Soil | GYDETMLVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS |
| ⦗Top⦘ |