| Basic Information | |
|---|---|
| Family ID | F051379 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 42 residues |
| Representative Sequence | GSAEDKQPIPAIGWFARCRDTEGNAFSLFQSDESVPAPGEG |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.69 % |
| % of genes near scaffold ends (potentially truncated) | 97.22 % |
| % of genes from short scaffolds (< 2000 bps) | 95.83 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.361 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (14.583 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.083 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.472 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 27.54% Coil/Unstructured: 72.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF04657 | DMT_YdcZ | 33.33 |
| PF01266 | DAO | 20.83 |
| PF02481 | DNA_processg_A | 9.03 |
| PF02738 | MoCoBD_1 | 4.17 |
| PF03721 | UDPG_MGDP_dh_N | 2.78 |
| PF00892 | EamA | 2.08 |
| PF00903 | Glyoxalase | 1.39 |
| PF13335 | Mg_chelatase_C | 0.69 |
| PF03793 | PASTA | 0.69 |
| PF04185 | Phosphoesterase | 0.69 |
| PF00370 | FGGY_N | 0.69 |
| PF07883 | Cupin_2 | 0.69 |
| PF01061 | ABC2_membrane | 0.69 |
| PF00378 | ECH_1 | 0.69 |
| PF01842 | ACT | 0.69 |
| PF07045 | DUF1330 | 0.69 |
| PF02588 | YitT_membrane | 0.69 |
| PF12399 | BCA_ABC_TP_C | 0.69 |
| PF01979 | Amidohydro_1 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG3238 | Uncharacterized membrane protein YdcZ, DUF606 family | Function unknown [S] | 33.33 |
| COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 18.06 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 2.78 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 2.78 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 2.78 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 2.78 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 2.78 |
| COG1284 | Uncharacterized membrane-anchored protein YitT, contains DUF161 and DUF2179 domains | Function unknown [S] | 0.69 |
| COG2364 | Uncharacterized membrane protein YczE | Function unknown [S] | 0.69 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.36 % |
| Unclassified | root | N/A | 7.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0572744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c1930746 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_13728729 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300000891|JGI10214J12806_11387104 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300000956|JGI10216J12902_101721654 | All Organisms → cellular organisms → Bacteria | 2281 | Open in IMG/M |
| 3300000956|JGI10216J12902_101833393 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300000956|JGI10216J12902_101839473 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300000956|JGI10216J12902_108845083 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300001538|A10PFW1_10386118 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300002568|C688J35102_118363590 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300002568|C688J35102_118414000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300002568|C688J35102_118499619 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300002568|C688J35102_118519812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300003324|soilH2_10302105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1494 | Open in IMG/M |
| 3300005093|Ga0062594_100417793 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300005093|Ga0062594_100837180 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300005172|Ga0066683_10066181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2155 | Open in IMG/M |
| 3300005172|Ga0066683_10613854 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300005180|Ga0066685_10527974 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300005183|Ga0068993_10380229 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005184|Ga0066671_10850473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
| 3300005186|Ga0066676_11094319 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005187|Ga0066675_11375052 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005329|Ga0070683_102197220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300005337|Ga0070682_101075091 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005338|Ga0068868_101694154 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005353|Ga0070669_100346620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1205 | Open in IMG/M |
| 3300005364|Ga0070673_100191228 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
| 3300005434|Ga0070709_11264573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300005437|Ga0070710_10872891 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005439|Ga0070711_101273384 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005440|Ga0070705_100687945 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300005445|Ga0070708_102187802 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005445|Ga0070708_102241288 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005455|Ga0070663_100567826 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300005458|Ga0070681_12027516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis vancoresmycina | 504 | Open in IMG/M |
| 3300005466|Ga0070685_11590044 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005526|Ga0073909_10601404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300005529|Ga0070741_10150693 | All Organisms → cellular organisms → Bacteria | 2338 | Open in IMG/M |
| 3300005529|Ga0070741_11118181 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005542|Ga0070732_10562739 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300005557|Ga0066704_10628742 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005564|Ga0070664_100313453 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300005575|Ga0066702_10947023 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005614|Ga0068856_100205227 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300005719|Ga0068861_101953033 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005764|Ga0066903_108764564 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005841|Ga0068863_101944030 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005874|Ga0075288_1058495 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005985|Ga0081539_10123928 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300006032|Ga0066696_10025755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3085 | Open in IMG/M |
| 3300006173|Ga0070716_101466463 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300006175|Ga0070712_100496197 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300006175|Ga0070712_101573199 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300006578|Ga0074059_10019175 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300006796|Ga0066665_10258222 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300006796|Ga0066665_11116075 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300006797|Ga0066659_11410626 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300006852|Ga0075433_10553225 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300006914|Ga0075436_100554542 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300007076|Ga0075435_100614484 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300007076|Ga0075435_101734713 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300009101|Ga0105247_10414954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 962 | Open in IMG/M |
| 3300009137|Ga0066709_101814303 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300009147|Ga0114129_11162503 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300009176|Ga0105242_12227191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300009177|Ga0105248_13234832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300009553|Ga0105249_13376140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300009840|Ga0126313_10736030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
| 3300009840|Ga0126313_11473743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
| 3300010036|Ga0126305_11091705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
| 3300010037|Ga0126304_10182667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1367 | Open in IMG/M |
| 3300010038|Ga0126315_10456734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 810 | Open in IMG/M |
| 3300010039|Ga0126309_10021325 | All Organisms → cellular organisms → Bacteria | 2834 | Open in IMG/M |
| 3300010044|Ga0126310_11294490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300010045|Ga0126311_10225038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1380 | Open in IMG/M |
| 3300010325|Ga0134064_10336253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
| 3300010366|Ga0126379_11382892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 810 | Open in IMG/M |
| 3300010366|Ga0126379_12030976 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300010373|Ga0134128_10593177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1233 | Open in IMG/M |
| 3300010373|Ga0134128_11688919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
| 3300010397|Ga0134124_10302973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1490 | Open in IMG/M |
| 3300010398|Ga0126383_12437093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
| 3300010398|Ga0126383_13342326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300010400|Ga0134122_10609488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1010 | Open in IMG/M |
| 3300010403|Ga0134123_11171881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 797 | Open in IMG/M |
| 3300011106|Ga0151489_1674194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300012212|Ga0150985_107241857 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300012351|Ga0137386_10945304 | Not Available | 615 | Open in IMG/M |
| 3300012356|Ga0137371_10067696 | All Organisms → cellular organisms → Bacteria | 2766 | Open in IMG/M |
| 3300012502|Ga0157347_1033148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
| 3300012530|Ga0136635_10055957 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300012902|Ga0157291_10253439 | Not Available | 587 | Open in IMG/M |
| 3300012912|Ga0157306_10466528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300012923|Ga0137359_11617652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300012927|Ga0137416_11423259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300012943|Ga0164241_10564888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 822 | Open in IMG/M |
| 3300012958|Ga0164299_10476508 | Not Available | 824 | Open in IMG/M |
| 3300012971|Ga0126369_13249258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300012988|Ga0164306_10375771 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300013102|Ga0157371_11183418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300013102|Ga0157371_11319472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300014058|Ga0120149_1052947 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300014487|Ga0182000_10350085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter | 636 | Open in IMG/M |
| 3300014969|Ga0157376_12860955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300015374|Ga0132255_102918675 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300017659|Ga0134083_10398140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
| 3300018071|Ga0184618_10279004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 709 | Open in IMG/M |
| 3300018076|Ga0184609_10350757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 689 | Open in IMG/M |
| 3300018083|Ga0184628_10434543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
| 3300018482|Ga0066669_12303226 | Not Available | 514 | Open in IMG/M |
| 3300018920|Ga0190273_10865203 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300019875|Ga0193701_1079771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
| 3300020015|Ga0193734_1045230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 815 | Open in IMG/M |
| 3300020215|Ga0196963_10232898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
| 3300021560|Ga0126371_12635639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300022756|Ga0222622_10228426 | Not Available | 1250 | Open in IMG/M |
| 3300023071|Ga0247752_1073957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
| 3300025146|Ga0209322_10383955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300025898|Ga0207692_10201049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1171 | Open in IMG/M |
| 3300025899|Ga0207642_10283006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 954 | Open in IMG/M |
| 3300025910|Ga0207684_10301242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1382 | Open in IMG/M |
| 3300025911|Ga0207654_10973013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300025919|Ga0207657_11471761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300025939|Ga0207665_10334430 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300025944|Ga0207661_11663872 | Not Available | 583 | Open in IMG/M |
| 3300026067|Ga0207678_10618440 | Not Available | 950 | Open in IMG/M |
| 3300026078|Ga0207702_10960692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 847 | Open in IMG/M |
| 3300027748|Ga0209689_1266593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 685 | Open in IMG/M |
| 3300027765|Ga0209073_10500164 | Not Available | 512 | Open in IMG/M |
| 3300027821|Ga0209811_10438112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300028710|Ga0307322_10236724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300028722|Ga0307319_10058988 | Not Available | 1209 | Open in IMG/M |
| 3300028793|Ga0307299_10067346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1326 | Open in IMG/M |
| 3300028807|Ga0307305_10305052 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300028811|Ga0307292_10347542 | Not Available | 626 | Open in IMG/M |
| 3300028819|Ga0307296_10478749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 681 | Open in IMG/M |
| 3300028884|Ga0307308_10480555 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300030993|Ga0308190_1134558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300031234|Ga0302325_10978686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1160 | Open in IMG/M |
| 3300031731|Ga0307405_11756857 | Not Available | 551 | Open in IMG/M |
| 3300031996|Ga0308176_11943022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300033551|Ga0247830_11414749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
| 3300034377|Ga0334931_163658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.33% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.17% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.47% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.08% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.08% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.39% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.39% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.39% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.69% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.69% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.69% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.69% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.69% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.69% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
| 3300025146 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034377 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 27HNS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_05727442 | 2228664022 | Soil | VREFGGKADDKTPIPHVGWFSHCVDTEGINFSLFESDESVTG |
| ICChiseqgaiiDRAFT_19307461 | 3300000033 | Soil | PIPQTGWFAKCKDTEGNAFSLFQADESVPGDFSES* |
| ICChiseqgaiiFebDRAFT_137287291 | 3300000363 | Soil | QPIPQTGWFAKCKDTEGNAFSLFQADESVPGDFSES* |
| JGI10214J12806_113871043 | 3300000891 | Soil | QPIPSIGWFARCRDTEGNEFSLFQADESVPAPGEG* |
| JGI10216J12902_1017216541 | 3300000956 | Soil | ARARELGGSAEDKQPIPGGGWFARCGDTEGNNFWLFQSDESVPAPTEG* |
| JGI10216J12902_1018333933 | 3300000956 | Soil | DKQPIPHVGWFARCKDNEGTEFSLFQSDESVQPPS* |
| JGI10216J12902_1018394731 | 3300000956 | Soil | DDKQPIPHVGWFARCKDPAGNAFSFFQSDESVQMPEGAETPGQ* |
| JGI10216J12902_1088450831 | 3300000956 | Soil | DDKQPIPSIGWFARCKDSEGNEFSLYQSDENAPMPEQ* |
| A10PFW1_103861183 | 3300001538 | Permafrost | KEPIPHVGWFARCKDTEGNPFSLFQSDESVAPPQ* |
| C688J35102_1183635902 | 3300002568 | Soil | GGQADEKQPIPGVGWFAGVTDPEGNHWSFFQSDESVAPPGADARER* |
| C688J35102_1184140001 | 3300002568 | Soil | LGGQAEDKQPIPHVGWFARCQDTEGNTFSLFQSDESVSAE* |
| C688J35102_1184996191 | 3300002568 | Soil | GGSADDKQPIPTIGWFARCVDTEGNRFSLFQPDDSVPAPGEA* |
| C688J35102_1185198121 | 3300002568 | Soil | ELGGNAEQKQPIPHVGWFARCQDTEGNPFSLFQTDESVAPPSQ* |
| soilH2_103021053 | 3300003324 | Sugarcane Root And Bulk Soil | ENGGRADDKQPIPHVGWFARCTDTEGNGFSLFQSDESVTG* |
| Ga0062594_1004177934 | 3300005093 | Soil | GGEADDKQPIPGIGWFSRCKDSEGNDFSLYQSDENAPGGE* |
| Ga0062594_1008371801 | 3300005093 | Soil | LGGRAEDKMPIPHVGWFTPCSDPEGNAFSLFQSDESVTG* |
| Ga0066683_100661811 | 3300005172 | Soil | GGKAEDRQPIPHVGWFARCEDTEGNKFSLFQSDESVPPPSA* |
| Ga0066683_106138541 | 3300005172 | Soil | GSAEDKQPIPTVGWFARCTDTEGNDFSLFQMDESVTVPG* |
| Ga0066685_105279741 | 3300005180 | Soil | ELGGDDGEKQPIPNIGWFARCKDSEGNEFSLFQSDESAPMPEGMPGQ* |
| Ga0068993_103802291 | 3300005183 | Natural And Restored Wetlands | EEKQPIPQTGWFARCKDTEGNSFSLFQSDESVPGSSLAFF* |
| Ga0066671_108504732 | 3300005184 | Soil | GQAEDKQPIPGVGWFAGCKDPEGNAFSLFQSDESIPAPSA* |
| Ga0066676_110943192 | 3300005186 | Soil | LGRVREFGGSAQEKQPIPTIGWFARCQDTEGNGFSLFQSDESVPMPG* |
| Ga0066675_113750521 | 3300005187 | Soil | ELGGQADDKQPIPGVGWFTAAKDPDGNEFSLFQADESAAPPAG* |
| Ga0070683_1021972202 | 3300005329 | Corn Rhizosphere | DDKQPIPGVGWFARCTDSEGNSFSLFQGDESVTMPEGAPGA* |
| Ga0070682_1010750911 | 3300005337 | Corn Rhizosphere | GSADDKQPIPSIGWFARCVDTEGNRFSLFQADESVPAPGEG* |
| Ga0068868_1016941541 | 3300005338 | Miscanthus Rhizosphere | GGSADDKQPIPSIGWFARCVDTEGNRFSLFQADESVPAPGEG* |
| Ga0070669_1003466201 | 3300005353 | Switchgrass Rhizosphere | LGGKADDKQPIPGVGWFARCTDSEGNSFSLFQGDESVTMPEGAPGA* |
| Ga0070673_1001912283 | 3300005364 | Switchgrass Rhizosphere | SIARARELGGSAEDKQPIPTIGWFARCVDTEGNPFSLFQPDDSVPAPGES* |
| Ga0070709_112645732 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ADEEQPIPAIGWFARCVDTEGNPFSLFQADESAPARDES* |
| Ga0070710_108728912 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | IGASISKVRELGGSADEEQPIPAIGWFARCVDTEGNPFSLFQADESAPARDES* |
| Ga0070711_1012733842 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | SISKVRELGGSADEEQPIPAIGWFARCVDTEGNPFSLFQADESAPARDES* |
| Ga0070705_1006879451 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RELGGSAEDKQPIPTIGWFARCVDTEGNPFSLFQPDDSVPAPGES* |
| Ga0070708_1021878021 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GGKAEDKQPIPTVGWFARGEDSEGNSFSLFQSDESVPMPS* |
| Ga0070708_1022412882 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RELGGSADDKQPIPSVGWFARCADTEGNDFSLFQSDESVPSPG* |
| Ga0070663_1005678261 | 3300005455 | Corn Rhizosphere | ELGGSAEDKQPIPTIGWFARCVDTEGNPFSLFQPDDSVPAPGES* |
| Ga0070681_120275161 | 3300005458 | Corn Rhizosphere | KQPIPGVGWFARCTDSEGNSFSLFQGDESVTMPEGAPGA* |
| Ga0070685_115900441 | 3300005466 | Switchgrass Rhizosphere | SIAKARELGGSADDKQPIPSIGWFARCVDPEGNRFSLFQPDESVPAPGEG* |
| Ga0073909_106014041 | 3300005526 | Surface Soil | EKQPIPQTGWFARCKDTEGNAFSLFQGDDSVPGDFS* |
| Ga0070741_101506931 | 3300005529 | Surface Soil | AGEKQPIPTIGWFARCKDTEGNAFSLFQADDSVPGDAGQG* |
| Ga0070741_111181811 | 3300005529 | Surface Soil | KQPIPTIGWFARCRDTEGNAFSLFQGDENAPGSFG* |
| Ga0070732_105627391 | 3300005542 | Surface Soil | GTSDDKQPIPHVGWFAHAKDTEGNAFSLFQSDESVAG* |
| Ga0066704_106287422 | 3300005557 | Soil | KQPIPHVGWFARCKDTEGNRFSLFQSDESVAPPQ* |
| Ga0070664_1003134533 | 3300005564 | Corn Rhizosphere | RDAGGSADEKQPIPQTGWFARCKDTEGNAFSLFQGDQSVPGDLG* |
| Ga0066702_109470232 | 3300005575 | Soil | EDREPIPHVGWFARCEDTEGNKFSLFQSDESVPPPSA* |
| Ga0068856_1002052271 | 3300005614 | Corn Rhizosphere | RARELGGSAEDKQPIPTIGWFARCVDTEGNPFSLFQPDDSVPAPGES* |
| Ga0068861_1019530332 | 3300005719 | Switchgrass Rhizosphere | RARELGGSAEDKQPIPAIGWFARCRDTEGNAFSLFQSDESVPAPGEG* |
| Ga0066903_1087645642 | 3300005764 | Tropical Forest Soil | AEDKMPIPHVGWFTHCVDTEGIKFSLFQSDESVTG* |
| Ga0068863_1019440302 | 3300005841 | Switchgrass Rhizosphere | DDKQPIPQTGWLARCKDTEGNTFSLYQSDESVPGDLSEG* |
| Ga0075288_10584952 | 3300005874 | Rice Paddy Soil | DDKQPIPTIGWFARCVDTEGNRFSLFQPDDSVPAPGES* |
| Ga0081539_101239284 | 3300005985 | Tabebuia Heterophylla Rhizosphere | GEAEDKQPIPSIGWFARCKDSEGNEFSLYQSDENAPGGS* |
| Ga0066696_100257551 | 3300006032 | Soil | PKIGWFARCKDSEGNEFSLFQSDENAPMPEGMPG* |
| Ga0070716_1014664632 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QAEDKQPIPGIGWFAGCKDPDGNSFSFFQSDESVAPPSG* |
| Ga0070712_1004961971 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VRELGGEAEDKQPIPGVGWFSGCKDSEGNEFSLFQGDESAPPPAS* |
| Ga0070712_1015731991 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AKVRELGGEADDKQPIPHTGWFARCKDGEGNPFSLFQSDESVAPPQ* |
| Ga0074059_100191752 | 3300006578 | Soil | PIPGIGWFARCTDSEGNSFSLFQGDESVTMPEGAPPA* |
| Ga0066665_102582221 | 3300006796 | Soil | GEKQPIPNIGWFARCKDSEGNEFSLFQSDESAPMPEGMPGQ* |
| Ga0066665_111160752 | 3300006796 | Soil | GKAEDKMPIPHVGWFTPCSDTDGNAFSLFQSDESVTG* |
| Ga0066659_114106261 | 3300006797 | Soil | AEEKQPIPHVGWFARCRDTEGNRFSLFQSDESVAPPQ* |
| Ga0075433_105532253 | 3300006852 | Populus Rhizosphere | RAESKQPIPQIGWFARAWDTEGNPFSLFQSDESVAPG* |
| Ga0075436_1005545421 | 3300006914 | Populus Rhizosphere | ARVNELGGRAESKQPIPQIGWFARAWDTEGNPFSLFQSDESVAPG* |
| Ga0075435_1006144841 | 3300007076 | Populus Rhizosphere | EAEDKQPIPSVGWFARCKDSEGNPFSIFQSDESVQMPS* |
| Ga0075435_1017347131 | 3300007076 | Populus Rhizosphere | DIGKVRELGGEAEDKQPIPGVGWFSGCKDSEGNEFSLFQGDESAPPPAS* |
| Ga0105247_104149542 | 3300009101 | Switchgrass Rhizosphere | IPGIGWFARCTDSEGNSFSLFQGDESVTMPEGAPGA* |
| Ga0066709_1018143033 | 3300009137 | Grasslands Soil | AEDKMPIPHVGWFTPCSDTDGNAFSLFQSDESVTG* |
| Ga0114129_111625033 | 3300009147 | Populus Rhizosphere | SADDKQPIPNVGWFTHCKDTEGNAFSLFQSNESAGG* |
| Ga0105242_122271911 | 3300009176 | Miscanthus Rhizosphere | DEKQPIPQTGWFARCKDTEGNAFSLFQGDQSVPGDLG* |
| Ga0105248_132348321 | 3300009177 | Switchgrass Rhizosphere | ELGGEAEDKQPIPGVGWFSGCKDSEGNEFSLFQGDESAPPPAS* |
| Ga0105249_133761401 | 3300009553 | Switchgrass Rhizosphere | GSADDKQPIPQTGWLARCKDTEGNTFSLYQSDESVPGDLSEG* |
| Ga0126313_107360303 | 3300009840 | Serpentine Soil | DDKQPIPHVGWFARCKDTEGNAFSLFQSDESVQLPT* |
| Ga0126313_114737431 | 3300009840 | Serpentine Soil | KQPIPGVGWFARAWDTEGNSFSLFQSDESVAPPGS* |
| Ga0126305_110917051 | 3300010036 | Serpentine Soil | GSAEDKQPIPGIGWFARCEDTEGNPFSIFQADDSVAIPAETQNREISN* |
| Ga0126304_101826671 | 3300010037 | Serpentine Soil | LGGQADDKMPIPEIGWFTHCTDTEGIAFSLFQSDESVSPPEG* |
| Ga0126315_104567341 | 3300010038 | Serpentine Soil | IPGVGWFSNCTDTEGNKFGLFQTDESIAPPAAPGPS* |
| Ga0126309_100213251 | 3300010039 | Serpentine Soil | GRAEDKQPIPSIGWFARCWDTEGNSFSLYQNDENAG* |
| Ga0126310_112944902 | 3300010044 | Serpentine Soil | ADDKQPIPSVGWFARCKDTEGNPFSLFQSDESVQPH* |
| Ga0126311_102250381 | 3300010045 | Serpentine Soil | AEDKQPIPSIGWFARCWDTEGNSFSLYQNDENAA* |
| Ga0134064_103362532 | 3300010325 | Grasslands Soil | GGHAEDKQPIPGVGWFAGCKDPEGNSFSFFQGDESVPPPTQ* |
| Ga0126379_113828921 | 3300010366 | Tropical Forest Soil | EKQPIPHIGWFARAKDSEGNPFSLFQTDESAAPPA* |
| Ga0126379_120309763 | 3300010366 | Tropical Forest Soil | IAKVRELGGKAEDKMPIPHVGWFTHCVDTEGINFSLFQSDESVTG* |
| Ga0134128_105931771 | 3300010373 | Terrestrial Soil | LGGSADDKQPIPSIGWFARCVDTEGNRFSLFQADESVPAPGEG* |
| Ga0134128_116889192 | 3300010373 | Terrestrial Soil | SKVRELGGSADEEQPIPAIGWFARCVDTEGNPFSLFQADESAPARDES* |
| Ga0134124_103029734 | 3300010397 | Terrestrial Soil | ELGGSADEEQPIPAIGWFARCVDTEGNPFSLFQADESAPARDES* |
| Ga0126383_124370932 | 3300010398 | Tropical Forest Soil | EEHPIPGIGWFARCVDTEGNPFSLFQADESAPSPDESEPAEADRS* |
| Ga0126383_133423261 | 3300010398 | Tropical Forest Soil | VRELGGSADEKQPIPTIGWYARCRDTEGNAFSLFQGDDSVTG* |
| Ga0134122_106094883 | 3300010400 | Terrestrial Soil | QPIPGIGWFARCKDSEGNSFSLFQGDESVTMPEGAPGG* |
| Ga0134123_111718813 | 3300010403 | Terrestrial Soil | ADDKQPIPGIGWFARCKDSEGNSFSLFQGDESVTMPEGAPGA* |
| Ga0151489_16741941 | 3300011106 | Soil | LGGKADDKQPIPGIGWFARCTDSEGNSFSLFQGDESVTMPEGAPGA* |
| Ga0150985_1072418571 | 3300012212 | Avena Fatua Rhizosphere | QPIPKIGWFARCKDSEGNDFSLFQSDENAPMPEGMPGS* |
| Ga0137386_109453041 | 3300012351 | Vadose Zone Soil | ARVRELGGSTEDKQPIPTVGWFARCTDTEGNDFSLFQMDESVTVPG* |
| Ga0137371_100676961 | 3300012356 | Vadose Zone Soil | EDKQPIPTVGWFARCTDTEGNDFSLFQMDESVTAPG* |
| Ga0157347_10331481 | 3300012502 | Arabidopsis Rhizosphere | DIGASISKVRELGGSADEEQPIPAIGWFARCVDTEGNPFSLFQADESAPARDES* |
| Ga0136635_100559571 | 3300012530 | Polar Desert Sand | EDKQPIPGIGWFARCEDTEGNPFSIFQPDDSVPIPAEMQGREISN* |
| Ga0157291_102534391 | 3300012902 | Soil | HGGRADDKQPIPHVGWFTSCTDTEGNDFSLFQSDESVTG* |
| Ga0157306_104665283 | 3300012912 | Soil | GEAEDKTPIPHVGWFSHCTDTEGIAFSLFQSDESVQPG* |
| Ga0137359_116176522 | 3300012923 | Vadose Zone Soil | GDKQPIPHVGWFTHCTDTEGNDFSLYQSDESVAG* |
| Ga0137416_114232593 | 3300012927 | Vadose Zone Soil | SGDKQPIPHVGWFTHCTDTEGNDFSLYQSDESVAG* |
| Ga0164241_105648882 | 3300012943 | Soil | EDKMPIPHVGWFTHCSDPEGNDFSLFQSDEAVTG* |
| Ga0164299_104765082 | 3300012958 | Soil | ADDKQPIPSIGWFARCMDTEGNRFSLFQADESVPAPGEG* |
| Ga0126369_132492581 | 3300012971 | Tropical Forest Soil | AKVRELGGEAEDKQPIPSVGWFAGCKDSEGNEFALFQGDESAQPA* |
| Ga0164306_103757713 | 3300012988 | Soil | SGEAEDKQSIPGIGWFSGCKDSEGNGFSLFQSDENAPPPAS* |
| Ga0157371_111834182 | 3300013102 | Corn Rhizosphere | ADDKQPIPQTGWFARCKDTEGNAFSLFQTDESVPGDFSES* |
| Ga0157371_113194722 | 3300013102 | Corn Rhizosphere | ELGGSADDKQPIPAIGWFARCRDTEGNAFSLFQSDESVPAPGEG* |
| Ga0120149_10529471 | 3300014058 | Permafrost | AEGKEPIPHVGWFARCKDTEGNPFSLFQSDESVAPPQ* |
| Ga0182000_103500852 | 3300014487 | Soil | VVPWSIAKVRELGGKADDKNPIPHVGWFARCSDPDGNSFSLFQGDEGAGA* |
| Ga0157376_128609551 | 3300014969 | Miscanthus Rhizosphere | GEAGEKQPIPQTGWFARCKDTEGNTFSLFQGDDSVPGDFS* |
| Ga0132255_1029186751 | 3300015374 | Arabidopsis Rhizosphere | DADLAKVRELGGNADDKQPIPHVGWFARCKDGEGNSFSLFQSDESVAPPQ* |
| Ga0134083_103981401 | 3300017659 | Grasslands Soil | ELGGTAAQKEPIPHVGWFARCQDTEGNPFSLFQSDESVAPPSQ |
| Ga0184618_102790041 | 3300018071 | Groundwater Sediment | EPIPTIGWFARCKDSEGNEFSLFQSDESVTMPEGAPQD |
| Ga0184609_103507571 | 3300018076 | Groundwater Sediment | ASVERVNELGGSAEDKQAIPATGWYARCEDTEGNQFSIFQADDSVPIPAELQSRENSN |
| Ga0184628_104345431 | 3300018083 | Groundwater Sediment | SIAKVRELGGEAEDKTPIPHVGWFSHCTDTEGIAFSLFQSDESVQPG |
| Ga0066669_123032262 | 3300018482 | Grasslands Soil | RELGGKAEDKQPIPGVGWVAGCSDTGGNAFSLFQGDESVPAPG |
| Ga0190273_108652031 | 3300018920 | Soil | ESDDVDASIERVNELGGSAEDKQPIPGTGWYARCEDTEGNPFSIFQADDSVPIPAELQSRENSN |
| Ga0193701_10797712 | 3300019875 | Soil | LGGSAEDKQPIPGIGWFARCVDTEGNKFSLFQGDESVAAPDET |
| Ga0193734_10452303 | 3300020015 | Soil | QPIPGIGWFARCKDSEGNSFSLFQSDESVTMPEGAPGT |
| Ga0196963_102328981 | 3300020215 | Soil | VRELGGEADEKQPIPEFGWFARCRDPEGNAFSLFQSDESVPAA |
| Ga0126371_126356391 | 3300021560 | Tropical Forest Soil | KCDDKSPIPHVGWYTRCVDTEGIDFSLFQSDETVTP |
| Ga0222622_102284261 | 3300022756 | Groundwater Sediment | KARELGGSADDKQPIPSIGWFARCVDPEGNRFSLFQPDESVPAPGES |
| Ga0247752_10739571 | 3300023071 | Soil | AEDKTPIPHVGWFSHCTDTEGIAFSLFQSDESVQPG |
| Ga0209322_103839553 | 3300025146 | Soil | PPIPEIGWFARCHDTEGNAFSIFQADASVPVPDAGQT |
| Ga0207692_102010491 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | PIPGVGWFARCTDSEGNSFSLFQGDESVTMPEGAPGA |
| Ga0207642_102830062 | 3300025899 | Miscanthus Rhizosphere | KQPIPAIGWFARCRDTEGNAFSLFQSDESVPAPDEG |
| Ga0207684_103012421 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | QPIPNIGWFARCKDSEGNDFSLFQGDESAPMPEGMPGQ |
| Ga0207654_109730131 | 3300025911 | Corn Rhizosphere | GSADEEQPIPAIGWFARCVDTEGNPFSLFQADESAPARDES |
| Ga0207657_114717612 | 3300025919 | Corn Rhizosphere | ELGGSAEDKQPIPAIGWFARCRDTEGNAFSLFQSDESVPAPDEG |
| Ga0207665_103344304 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | IPKIGWFSRCKDSEGNEFSLYQSDENAPMPEGMPGS |
| Ga0207661_116638722 | 3300025944 | Corn Rhizosphere | REHGGKADEKLPIPHVGWFTRCTDTEGNDFSLFQSDESVTG |
| Ga0207678_106184402 | 3300026067 | Corn Rhizosphere | ELGGSAEDKQPIPTIGWFARCVDTEGNPFSLFQPDDSVPAPGES |
| Ga0207702_109606921 | 3300026078 | Corn Rhizosphere | ASIARARELGGSAEDKQPIPTIGWFARCVDTEGNPFSLFQPDDSVPAPGES |
| Ga0209689_12665931 | 3300027748 | Soil | DEKQPIPGVGWFAGAKDSEGNAFSLFQSDESAAPPS |
| Ga0209073_105001641 | 3300027765 | Agricultural Soil | SVAKVRALGGSADEEQPIPKIGWYARCVDTEGNPFSLFQADESAPSPDQS |
| Ga0209811_104381122 | 3300027821 | Surface Soil | GSADDKQPIPSIGWFARCVDTEGNRFSLFQADESVPAPGEG |
| Ga0307322_102367242 | 3300028710 | Soil | GSAEDKQPIPAIGWFARCRDTEGNAFSLFQSDESVPAPGEG |
| Ga0307319_100589881 | 3300028722 | Soil | ADEKQPIPTIGWFARCRDTEGNEFSLFQADETVPAPGNEG |
| Ga0307299_100673462 | 3300028793 | Soil | EDRQPIPAIGWFARCRDTEGNAFSLFQSDESVPAPGEGQDR |
| Ga0307305_103050523 | 3300028807 | Soil | NKDPIPHVGWFARCKDTEGNSFSLFQSDESVAPPQ |
| Ga0307292_103475422 | 3300028811 | Soil | ARARELGSAEDKQPIPGVGWFARCSDTEGNDFSLFQSDESVPAPGEG |
| Ga0307296_104787492 | 3300028819 | Soil | EDKQPIPSIGWFARCKDSEGNDFSLYQSDENAPMPEGMPNQ |
| Ga0307308_104805551 | 3300028884 | Soil | GKAEGKEAIPHVGWFARCEDTEGNKFSFFQSDESVPAPSA |
| Ga0308190_11345581 | 3300030993 | Soil | NELGGSAEDKQAIPGIGWFARCEDTEGNPFSIFQADESVPIPTETQSREISD |
| Ga0302325_109786861 | 3300031234 | Palsa | SVARVRECGGGSDDPSPIPHVGWFARCTDTEGNSFRLFQSDESAGA |
| Ga0307405_117568571 | 3300031731 | Rhizosphere | TKVREHGGTADDKLPIPHVGWFTHCKDPEGNDFSLFQSEESASG |
| Ga0308176_119430222 | 3300031996 | Soil | IRGLGGQAEGKTAIPHVGWFARCEDTEGNTFSLFQSDESVSAE |
| Ga0247830_114147491 | 3300033551 | Soil | VNEHGGTADDKLPIPHVGWFTQCKDSEGNQFCLFQSDESVTG |
| Ga0334931_163658_384_533 | 3300034377 | Sub-Biocrust Soil | VRESGGEAEDKQPIPTIGWFAGCKDPDGIEFSLFQGDDSAPMPEGAPPA |
| ⦗Top⦘ |