Metagenome Family F051351

Overview

Basic Information

• Family ID: F051351
• Family Type: Metagenome
• Number of Sequences: 144
• Average Sequence Length: 38 residues
• Representative Sequence: VGLNPFRSQAKRSSDVVIVAVALVVIAALVLWAVFG
• Number of Associated Samples: 129
• Number of Associated Scaffolds: 144

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 40.52 %
• % of genes near scaffold ends (potentially truncated): 14.58 %
• % of genes from short scaffolds (< 2000 bps): 75.00 %
• Associated GOLD sequencing projects: 120
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (61.111 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.028 % of family members)
• Environment Ontology (ENVO): Unclassified (23.611 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (36.806 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 40.62%
  β-sheet: 0.00%
  Coil/Unstructured: 59.38%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 144 Family Scaffolds
PF00378	ECH_1	43.06
PF02021	UPF0102	17.36
PF02481	DNA_processg_A	4.17
PF12802	MarR_2	3.47
PF10611	DUF2469	3.47
PF01245	Ribosomal_L19	3.47
PF16113	ECH_2	2.08
PF01734	Patatin	2.08
PF13335	Mg_chelatase_C	1.39
PF13541	ChlI	0.69
PF00448	SRP54	0.69
PF00583	Acetyltransf_1	0.69
PF05057	DUF676	0.69
PF13407	Peripla_BP_4	0.69
PF00440	TetR_N	0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 144 Family Scaffolds
COG0792	Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 family	Replication, recombination and repair [L]	17.36
COG0758	Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake	Replication, recombination and repair [L]	8.33
COG0335	Ribosomal protein L19	Translation, ribosomal structure and biogenesis [J]	3.47
COG1752	Predicted acylesterase/phospholipase RssA, containd patatin domain	General function prediction only [R]	2.08
COG3621	Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR	General function prediction only [R]	2.08
COG4667	Predicted phospholipase, patatin/cPLA2 family	Lipid transport and metabolism [I]	2.08

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	61.11 %
Unclassified	root	N/A	38.89 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	61.11 %
Unclassified	root	N/A	38.89 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	61.11 %
Unclassified	root	N/A	38.89 %

Level 4

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	53.47 %
Unclassified	root	N/A	38.89 %

Level 5

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	52.78 %
Unclassified	root	N/A	38.89 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.89 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	27.08 %
Nitriliruptoria	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria	0.69 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.89 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	14.58 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	6.25 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	2.08 %
Nitriliruptoria	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria	0.69 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.89 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	11.11 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	6.25 %
Actinobacteria bacterium IMCC26256	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256	3.47 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	1.39 %
Nitriliruptoria	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria	0.69 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2040502000|ACOD_F64RS5002INT5U	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	508
2124908007|FWIRElOz_GKZ9IRQ01EB7FG	Not Available	530
2170459010|GIO7OMY01EO5EX	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	532
3300000364|INPhiseqgaiiFebDRAFT_104824880	Not Available	665
3300000956|JGI10216J12902_100248775	All Organisms → cellular organisms → Bacteria	1926
3300000956|JGI10216J12902_105925528	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1035
3300001686|C688J18823_10556628	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	733
3300003998|Ga0055472_10095168	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	827
3300004153|Ga0063455_100259109	Not Available	918
3300005093|Ga0062594_100697200	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	915
3300005179|Ga0066684_10271462	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1119
3300005337|Ga0070682_100615309	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	860
3300005434|Ga0070709_10233145	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1318
3300005539|Ga0068853_101615006	All Organisms → cellular organisms → Bacteria	628
3300005543|Ga0070672_101560718	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	592
3300005544|Ga0070686_101378238	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	591
3300005548|Ga0070665_102012371	All Organisms → cellular organisms → Bacteria	583
3300005548|Ga0070665_102167723	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	560
3300005618|Ga0068864_101906321	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	600
3300005718|Ga0068866_11336971	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	522
3300005764|Ga0066903_105313760	All Organisms → cellular organisms → Bacteria	681
3300005764|Ga0066903_108542806	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	522
3300005841|Ga0068863_102391460	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	538
3300005937|Ga0081455_10219013	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1412
3300006047|Ga0075024_100897589	Not Available	504
3300006057|Ga0075026_100038614	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2211
3300006057|Ga0075026_100976272	All Organisms → cellular organisms → Bacteria	525
3300006102|Ga0075015_100515035	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	691
3300006102|Ga0075015_101019936	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	507
3300006174|Ga0075014_100724514	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	581
3300006354|Ga0075021_10221532	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1158
3300006846|Ga0075430_100317683	All Organisms → cellular organisms → Bacteria	1288
3300006853|Ga0075420_100071118	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3081
3300006854|Ga0075425_100097936	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	3331
3300006881|Ga0068865_101598587	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	586
3300007076|Ga0075435_100743302	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	853
3300007769|Ga0102952_1228462	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	594
3300009012|Ga0066710_101113085	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1222
3300009094|Ga0111539_11460980	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	793
3300009137|Ga0066709_101478352	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	982
3300009137|Ga0066709_103087375	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	609
3300009148|Ga0105243_11997673	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	614
3300009176|Ga0105242_12167920	Not Available	600
3300009551|Ga0105238_10744388	Not Available	994
3300009789|Ga0126307_11423494	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	562
3300009870|Ga0131092_10624073	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	936
3300010043|Ga0126380_11213985	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	651
3300010362|Ga0126377_10334938	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1504
3300010366|Ga0126379_12935619	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	571
3300010373|Ga0134128_11238336	Not Available	823
3300010398|Ga0126383_11987586	Not Available	669
3300010401|Ga0134121_12497739	Not Available	559
3300011119|Ga0105246_11574682	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	620
3300012212|Ga0150985_103757404	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	585
3300012356|Ga0137371_11191106	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	569
3300012905|Ga0157296_10334302	Not Available	543
3300012925|Ga0137419_11015302	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	688
3300012958|Ga0164299_10577524	Not Available	764
3300012960|Ga0164301_11483525	Not Available	558
3300012986|Ga0164304_11720036	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	524
3300013308|Ga0157375_11000309	Not Available	976
3300013772|Ga0120158_10158660	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria	1239
3300013772|Ga0120158_10205739	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1023
3300014267|Ga0075313_1230849	Not Available	500
3300014320|Ga0075342_1060928	Not Available	934
3300014325|Ga0163163_10904051	Not Available	946
3300015371|Ga0132258_10043085	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256	10270
3300015372|Ga0132256_101927538	All Organisms → cellular organisms → Bacteria	698
3300015373|Ga0132257_102451098	Not Available	677
3300015374|Ga0132255_100839197	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1371
3300017974|Ga0187777_11172103	Not Available	561
3300018468|Ga0066662_10818635	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	906
3300018469|Ga0190270_11282360	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	774
3300018469|Ga0190270_11412255	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	742
3300018476|Ga0190274_12451101	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	619
3300018482|Ga0066669_10593447	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	970
3300021445|Ga0182009_10564778	Not Available	606
3300025615|Ga0210086_1163740	Not Available	647
3300025913|Ga0207695_11167718	Not Available	650
3300025921|Ga0207652_10276865	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1514
3300025932|Ga0207690_10363127	All Organisms → cellular organisms → Bacteria	1147
3300025932|Ga0207690_11023395	All Organisms → cellular organisms → Bacteria	687
3300025935|Ga0207709_10850168	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	739
3300026041|Ga0207639_11994190	All Organisms → cellular organisms → Bacteria → Terrabacteria group	541
3300026089|Ga0207648_11754339	Not Available	582
3300027894|Ga0209068_10002597	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	8675
3300027894|Ga0209068_10111938	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1450
3300027894|Ga0209068_10171507	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1183
3300027911|Ga0209698_10853549	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	685
3300027915|Ga0209069_10010838	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256	4404
3300028381|Ga0268264_11100261	Not Available	803
3300028597|Ga0247820_10693194	Not Available	709
3300028654|Ga0265322_10074503	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	963
3300028679|Ga0302169_10015919	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1746
3300028714|Ga0307309_10218746	Not Available	508
3300028741|Ga0302256_10020780	All Organisms → cellular organisms → Bacteria	1600
3300028802|Ga0307503_10801552	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	538
3300028878|Ga0307278_10404439	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	600
3300030006|Ga0299907_10613241	Not Available	845
3300030294|Ga0311349_10248535	All Organisms → cellular organisms → Bacteria	1676
3300031228|Ga0299914_10578608	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	962
3300031251|Ga0265327_10011584	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256	6052
3300031251|Ga0265327_10015481	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256	4918
3300031543|Ga0318516_10069437	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1951
3300031543|Ga0318516_10243542	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256	1040
3300031572|Ga0318515_10586824	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	593
3300031679|Ga0318561_10354940	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	804
3300031748|Ga0318492_10782074	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	513
3300031751|Ga0318494_10175875	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1213
3300031890|Ga0306925_11847021	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	577
3300032010|Ga0318569_10252897	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	819
3300032163|Ga0315281_10685634	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1069
3300032782|Ga0335082_11691245	Not Available	507
3300033489|Ga0299912_10795434	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	724
3300034129|Ga0370493_0217931	Not Available	640
3300034165|Ga0364942_0293921	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	532

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	70.83%
Host-Associated	Host-Associated	28.47%
Engineered	Engineered	0.69%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	53.47%
Plants	Host-Associated → Plants	27.78%
Aquatic	Environmental → Aquatic	17.36%
Arthropoda	Host-Associated → Arthropoda	0.69%
Wastewater	Engineered → Wastewater	0.69%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	47.92%
Rhizosphere	Host-Associated → Plants → Rhizosphere	18.06%
Sediment	Environmental → Aquatic → Sediment	9.03%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.03%
Peat	Environmental → Terrestrial → Peat	4.86%
Freshwater	Environmental → Aquatic → Freshwater	2.78%
Marine	Environmental → Aquatic → Marine	2.78%
Thermal Springs	Environmental → Aquatic → Thermal Springs	2.78%
Floodplain	Environmental → Terrestrial → Floodplain	0.69%
Symbiotic Fungal Gardens And Galleries	Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries	0.69%
Roots	Host-Associated → Plants → Roots	0.69%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.69%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	37.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	11.81%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	9.03%
Loam	Environmental → Terrestrial → Soil → Loam	6.25%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.25%
Soil	Host-Associated → Plants → Rhizosphere → Soil	6.25%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	4.86%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	4.17%
Lake	Environmental → Aquatic → Freshwater → Lake	2.78%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.78%
Coastal	Environmental → Aquatic → Marine → Coastal	1.39%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.39%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	1.39%
Sediment	Environmental → Aquatic → Thermal Springs → Sediment	1.39%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.69%
Fungus Garden	Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden	0.69%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.69%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.69%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	18.75%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	11.81%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	9.03%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	8.33%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.25%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	6.25%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	5.56%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	4.86%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.17%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.78%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.78%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.08%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	1.39%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.39%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	1.39%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.39%
Unclassified	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified	1.39%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.39%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.39%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	1.39%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.39%
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	0.69%
Neutral	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral	0.69%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.69%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.69%
Unclassified	Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified	0.69%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.69%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.69%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	9.03%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	8.33%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.86%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	4.86%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.17%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.47%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.47%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.08%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.08%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.08%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.08%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	2.08%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	1.39%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	1.39%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.39%
Hot Spring Sediment	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment	1.39%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.39%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.39%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.39%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.39%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	1.39%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.39%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	1.39%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.39%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.39%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.39%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.39%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.39%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.39%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.39%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.69%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.69%
Hot Spring Phototrophic Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat	0.69%
Hot Spring Fe-Si Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment	0.69%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.69%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.69%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.69%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.69%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.69%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.69%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.69%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.69%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.69%
Fungus Garden	Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden	0.69%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.69%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.69%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.69%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.69%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.69%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.69%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.69%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.69%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2040502000	Fungus garden microbial communities from Atta colombica in Panama - dump bottom	Host-Associated
2124908007	Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2	Environmental
2170459010	Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)	Environmental
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental
3300001686	Grasslands soil microbial communities from Hopland, California, USA	Environmental
3300003998	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2	Environmental
3300004153	Grasslands soil microbial communities from Hopland, California, USA (version 2)	Environmental
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental
3300006102	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013	Environmental
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental
3300006354	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012	Environmental
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300006865	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG	Environmental
3300006875	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA	Environmental
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated
3300007769	Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D1_MG	Environmental
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental
3300009870	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant	Engineered
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300010885	northern Canada Lakes Co-assembly	Environmental
3300010938	Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117	Environmental
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental
3300012905	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2	Environmental
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated
3300013772	Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M	Environmental
3300014267	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1	Environmental
3300014320	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1	Environmental
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300015372	Soil combined assembly	Host-Associated
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated
3300015374	Col-0 rhizosphere combined assembly	Host-Associated
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental
3300020109	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m	Environmental
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental
3300025310	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)	Environmental
3300025615	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 (SPAdes)	Environmental
3300025732	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)	Environmental
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated
3300027911	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)	Environmental
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental
3300028597	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14	Environmental
3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Host-Associated
3300028679	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3	Environmental
3300028714	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196	Environmental
3300028741	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4	Environmental
3300028743	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4	Environmental
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental
3300028865	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_4	Environmental
3300028878	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117	Environmental
3300029990	I_Fen_N2 coassembly	Environmental
3300030006	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67	Environmental
3300030114	I_Fen_E2 coassembly	Environmental
3300030294	II_Fen_E3 coassembly	Environmental
3300031228	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57	Environmental
3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Host-Associated
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental
3300031572	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19	Environmental
3300031679	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23	Environmental
3300031748	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22	Environmental
3300031751	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24	Environmental
3300031812	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-BottomLayer	Environmental
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental
3300032010	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22	Environmental
3300032163	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0	Environmental
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental
3300033489	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214	Environmental
3300034129	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16	Environmental
3300034165	Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ACODB_7283950	2040502000	Fungus Garden	YRSGVGLNPFRSQTTRASDVAIVVVALVVVAALVLWAMFG
FWIRElOz_06488870	2124908007	Soil	VGLNPFRSQAKRSSDIVIVAVALVVIAALVLWAVFG
F62_01489070	2170459010	Grass Soil	MGLNPFRAQAKRGSDLAIVAVALVVIAALVLWALFG
INPhiseqgaiiFebDRAFT_1048248803	3300000364	Soil	MGLNPFRAQAXRGSDLAIVXVALVVIAALVLWALFG*
JGI10216J12902_1002487753	3300000956	Soil	VGLNPFRSQAKRGSDVVIVAVALVVIAALVLWALFG*
JGI10216J12902_1059255281	3300000956	Soil	MGLNPFRAQAKRGTDLVIVAIALAVVAALVLWAVLG*
C688J18823_105566282	3300001686	Soil	VGLNPFRSQTKRASDLVIVVAALVVVAALVLWAVFG*
Ga0055472_100951681	3300003998	Natural And Restored Wetlands	RDATVNDVGFNPFRARAKRGTDLLVVAAAFVVIAALVLWAVFG*
Ga0063455_1002591091	3300004153	Soil	MGRYRSGVGLNPFRSQAKRSSDVVIVAIALVVIAALVLWALFG*
Ga0062594_1006972002	3300005093	Soil	MGRYRSGVGLNPFRSQAKRSSDVVIVAVALVVIAALVLWAVFG*
Ga0066684_102714622	3300005179	Soil	MSRYRSGVGLNPFRSQAKRGSDVVIVAVALVVIAALVLWAVFG*
Ga0070682_1006153094	3300005337	Corn Rhizosphere	DIGRYRSGVGLNPFRSQAKRSSDVVIVAVALVVIAALVLWAVFG*
Ga0070709_102331452	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MDRYRSGVGLNPFRSQAKRSSDVVIVAVALVVIAALVLWAVFG*
Ga0068853_1016150062	3300005539	Corn Rhizosphere	MGLNPFRAQAKRGTDLVIVAIALAVVAALVLWAVGMTHDAA
Ga0070672_1015607183	3300005543	Miscanthus Rhizosphere	RYRSGVGLNPFRSQAKRGTDVVIVVVALAVVAALVLWAVFG*
Ga0070686_1013782382	3300005544	Switchgrass Rhizosphere	MGRYRSGVGLNPFRSQTKRTSDVVIVVAALVVVAALVLWAVFG*
Ga0070665_1020123712	3300005548	Switchgrass Rhizosphere	VGLNPFRSQTKRASDVVIVVAALVVVAALVLWAVFG*
Ga0070665_1021677233	3300005548	Switchgrass Rhizosphere	DIGRYRSGVGLNPFRSQAKRGTDVVIVVIALVVVGALVLWAVFG*
Ga0068864_1019063212	3300005618	Switchgrass Rhizosphere	LNPFRAQAKRGSDLAIVAVALVVIAALVLWALFG*
Ga0066905_1008052683	3300005713	Tropical Forest Soil	VGLNPFRSRVHRRTDLVVVVVAFVVIALLVLWGLFG*
Ga0068866_113369712	3300005718	Miscanthus Rhizosphere	VGLNPFRSQTKRSSDVVIVVAALVVVAALVLWAVFG*
Ga0066903_1053137602	3300005764	Tropical Forest Soil	VGFNPFRAHASRRTDLLIVAAAFLVIAVLVLWAVFG*
Ga0066903_1085428062	3300005764	Tropical Forest Soil	MGRYRSGVGLNPFRSQAKRGSDIVIVAVALVVIGALVLWAVFG*
Ga0068863_1023914602	3300005841	Switchgrass Rhizosphere	MGLNPFRSQTKRASDVVIVAAALVVVAALVLWAVFG*
Ga0081455_102190133	3300005937	Tabebuia Heterophylla Rhizosphere	MGRYRSGVGLNPFRSQAKRGSDVVIVAVALVVIAALVLWAVLG*
Ga0066652_1000808192	3300006046	Soil	VGFNPFRAHASRRTDLVIVAAAFVVIAALVVWAVFG*
Ga0066652_1001136032	3300006046	Soil	VGFNPFRSRVERRTDIVVVICAFVVIMALVVWAFFG*
Ga0075024_1008975892	3300006047	Watersheds	VGLNPFRSQAKRSSDVVIVAVALVVIAALVLWAVFG*
Ga0075026_1000386143	3300006057	Watersheds	MGRYRSGVGLNPFRSQAKRSSDIVIVAVALVVIAALVLWAVFG*
Ga0075026_1009762722	3300006057	Watersheds	MGLNPFRAQAKRGTDLVIVAIALVVVAALVLWAVFG*
Ga0075015_1005150352	3300006102	Watersheds	VGLNPFRSQAKRSSDIVIVAVALVVIAALVLWAVFG*
Ga0075015_1010199362	3300006102	Watersheds	VSGRYRSGVGLNPYRAQAKRRSDVIIVAVALVVVAALVLWALFG*
Ga0075014_1007245142	3300006174	Watersheds	VGLNPFRAQEKRTADVVIVVAALVVVAALVLWAVFGG*
Ga0075021_102215323	3300006354	Watersheds	VGLNPFRSQEKRRADIVIVVAALVVVAALVLWAVLGG*
Ga0075421_1019124502	3300006845	Populus Rhizosphere	VGFNPFRSRVDRRTDIVVVIVAFVVIAALLVWAFLG*
Ga0075430_1003176832	3300006846	Populus Rhizosphere	VGLNPFRSQVRRTTDYVVVAVALIVIAALVLWALFG*
Ga0075420_1000711183	3300006853	Populus Rhizosphere	VGLNPFRSQVRRTTDYVVVAAALIVIAALVLWALFG*
Ga0075425_1000979363	3300006854	Populus Rhizosphere	MGRYRSGVGLNPFRSQAKRSSDVVIVAVALVVITALVLWAVFG*
Ga0073934_100286343	3300006865	Hot Spring Sediment	VGLNPFRSRVERRTDIVVVAVALVVILALVLWAFFGS*
Ga0075473_100339092	3300006875	Aqueous	VGLNPFRSRVERRTDIIVVVAALVVIAALVMWGLFGG*
Ga0068865_1015985872	3300006881	Miscanthus Rhizosphere	MGLNPFRAQAKRGSDLAIVAVALVVIAALVLWALFG*
Ga0075435_1007433023	3300007076	Populus Rhizosphere	GRYRSGVGLNPFRSQAKRSSDVVIVAVALVVITALVLWAVFG*
Ga0102952_12284622	3300007769	Soil	VGLNPFRSQVNRRSDIVIVAVALVVVLALVLWGLFG*
Ga0066710_1011130852	3300009012	Grasslands Soil	MARYRSGVGLNPFRSQAKRGSDIVIVAVALVVIAALVLWAVFG
Ga0111539_114609802	3300009094	Populus Rhizosphere	VGLNPFRSQAKRSSDVVIVAVALVVITALVLWAVFG*
Ga0105247_104244862	3300009101	Switchgrass Rhizosphere	VGFNPFRSRVDRRTDIVVVAVAFVVIAALVIWAFLG*
Ga0066709_1014783522	3300009137	Grasslands Soil	MARYRSGVGLNPFRSQAKRGSDVVIVAVALVVIAALVLWAVFG*
Ga0066709_1030873751	3300009137	Grasslands Soil	LNPFRAHARRASDVVIVAAAFLVIVLLVLWAVFG*
Ga0114129_105848883	3300009147	Populus Rhizosphere	VGFNPFRSRVDRRTDIVVVVVAFVVIAALLVWAFLG*
Ga0105243_107030583	3300009148	Miscanthus Rhizosphere	VGLNPFRSRVERRTDLVVVAVAFVVIAALVLWALLG*
Ga0105243_119976732	3300009148	Miscanthus Rhizosphere	MGLNPFRAQAKRGSDLVIVAVALVVIAALVLWALFG*
Ga0105242_121679202	3300009176	Miscanthus Rhizosphere	MGLNPFRAQAKRGSDLAIVVVALVVIAALVLWALFG*
Ga0105238_107443882	3300009551	Corn Rhizosphere	VGLNPFRSQTKRASDVVILVAALVVVAALVLWAVFG*
Ga0126307_114234942	3300009789	Serpentine Soil	VGLNPFRSQTKRASDVVIVVVALAVVAALVLWAVFG*
Ga0131092_106240732	3300009870	Activated Sludge	MGLNPFREQTKRTSDVVIVVVALAITIALVLWAIFG*
Ga0126312_108311121	3300010041	Serpentine Soil	ALDENVSHGRYRSAVGLNPFRSRVARRTDAIVVAVAFVVIFALVLWALFG*
Ga0126380_112139852	3300010043	Tropical Forest Soil	MGRYRSGVGLNPFRSQAKRSSDVVIVAVALVVIGALVLWAVFG*
Ga0126372_130389082	3300010360	Tropical Forest Soil	VGLNPFRSRVHRRTDLVVVAVAFVVIALLVLWGLFG*
Ga0126377_103349385	3300010362	Tropical Forest Soil	GVARYGELVGLNPFRARAKRSTDVLIVAAALVIVAALVLWAVFG*
Ga0126379_129356192	3300010366	Tropical Forest Soil	VGFNPFRSQAKRSSDIVIVVAALVVVAALVLWAVFG*
Ga0134128_112383361	3300010373	Terrestrial Soil	MGRYRSGVGLNPFRSQAKRSSDVVIVAVALVVIAALVLW
Ga0126383_119875862	3300010398	Tropical Forest Soil	VGFNPFRAHASRRTDLLIVAAAFLVIAALVLWAVFG*
Ga0134121_124977391	3300010401	Terrestrial Soil	MDRYRSGVGLNPFRSQTKRASDVVIVVVALAVVAALVLW
Ga0133913_101901158	3300010885	Freshwater Lake	VGLNPFRSRVSRRTDVVVVAAAFVVIAVLVVWAFVG*
Ga0137716_1001964713	3300010938	Hot Spring Fe-Si Sediment	MGRYRSGVGLNPFRSRVARRTDAIVVAVALVVIAALVAWALFGG*
Ga0105246_115746822	3300011119	Miscanthus Rhizosphere	MGLNPFRARAKRGTDVLVVAIALVVVALLVYWAMFG*
Ga0150985_1037574042	3300012212	Avena Fatua Rhizosphere	AALPISGMGRYRSGVGLNPFRSQAKRSSDVVIVAVALVVIAALVLWAVFG*
Ga0137371_111911061	3300012356	Vadose Zone Soil	VGLNPFRAHARRASDVVIVAAAFLVIVLLVLWAVFG*
Ga0157296_103343022	3300012905	Soil	VGLNPFRSQTKRTSDVVIVVAALVVVAALVLWAVFG*
Ga0137419_110153023	3300012925	Vadose Zone Soil	VGLNPFRSHTSRPTDIAIVVGALVVIAALVLWGLFG*
Ga0164299_105775243	3300012958	Soil	VGLNPFRSQAKRGTDVVIVAVALVVVAALVLWAVFG*
Ga0164301_114835252	3300012960	Soil	MGRYRSGVGLNPFRSQAKRSSDVVIVAVALVVIAAL
Ga0164304_117200362	3300012986	Soil	GVGLNPFRSQAKRSSDVVIVAVALVVIAALVLWAVFG*
Ga0157375_110003092	3300013308	Miscanthus Rhizosphere	VGLNPFRSQTKRASDVVIVAAALVVVAALVLWAVFG*
Ga0120158_101586601	3300013772	Permafrost	CKSGKAGRYRSGMGLNPFRAQAKRGSDLAIVAVALVVIAALVLWALFG*
Ga0120158_102057391	3300013772	Permafrost	RMGLNPFRAQAKRGTDLVIVAVALAVVAALVLWAVFG*
Ga0075313_12308492	3300014267	Natural And Restored Wetlands	VNDVGFNPFRARAKRGTDLLVVAAAFVVIAALVLWAVFG*
Ga0075342_10609281	3300014320	Natural And Restored Wetlands	VAGVGLNPFRSQVKRTTDYVIVAVALVVIAALVLWGLFG*
Ga0163163_109040511	3300014325	Switchgrass Rhizosphere	VGLNPFRSQAKRGSDVAIVVAALVVVAALVLWAVFG*
Ga0132258_100430858	3300015371	Arabidopsis Rhizosphere	VGFNPFRAHGARRTDLLIVAAAFLVILALVLWAVFG*
Ga0132256_1019275382	3300015372	Arabidopsis Rhizosphere	VGLNPFRAQAKRGTDLVIVAIALAVVAALVLWAVLG*
Ga0132257_1024510983	3300015373	Arabidopsis Rhizosphere	MGLNPFRAQAKRGTDLVIVAVALAVVAALVLWAVFG*
Ga0132255_1008391972	3300015374	Arabidopsis Rhizosphere	VGFNPFRAHAARRTDLLIVAAAFLVILALVLWAVFG*
Ga0190266_104001262	3300017965	Soil	VGLNPFRSRVSRRTDIVVVAAAFVVIAGLVVWAFLGG
Ga0187777_111721031	3300017974	Tropical Peatland	VGLNPFRSQERRRTDVVVVAAALVVVAALVIWAIFGG
Ga0066662_108186352	3300018468	Grasslands Soil	VGLNPFRSQAKRGTDVVIVVVALTVVAALVLWAVFG
Ga0190270_112823603	3300018469	Soil	VGLNPFRAQEKRGTDVVIVAVALVVIAALVLWGLFG
Ga0190270_114122552	3300018469	Soil	VGLNPFRSQAKRSSDIVIVVVALVVTAALVLWAVFG
Ga0190274_124511012	3300018476	Soil	MGLNPFRYQTKRTSDYVIVGAALVVIAALVLWGLFG
Ga0190271_129734032	3300018481	Soil	MGFNPFRSRVDRRTDIVIVIAAAAVILALVAWAFFGG
Ga0066669_105934472	3300018482	Grasslands Soil	MGLNPFRARAKRGTDVLVVAVALVIVALLVYWAMFG
Ga0194112_103479064	3300020109	Freshwater Lake	EFAARYRGAVGLNPFRSRVERRTDVIVVIAALVVIAALVVWGLFGG
Ga0182009_105647782	3300021445	Soil	VGLNPFRSQAKRGSDVAIVVAALVVVAALVLWAIFG
Ga0126371_121463122	3300021560	Tropical Forest Soil	VGLNPFRSRVHRRTDLVVVVVAFVVIALLVLWGLFG
Ga0222622_108959482	3300022756	Groundwater Sediment	VGFNPFRSRVNRRTDIVVVVVAFVVIAALVMWAFFG
Ga0209172_100238584	3300025310	Hot Spring Sediment	VGLNPFRSRVERRTDIVVVAVALVVILALVLWAFFGS
Ga0210086_11637402	3300025615	Natural And Restored Wetlands	VGLNPFRSQVNRRSDIVIVAVALVVVLALVLWGLFG
Ga0208784_10380572	3300025732	Aqueous	VGLNPFRSRVERRTDIIVVVAALVVIAALVMWGLFGG
Ga0207695_111677181	3300025913	Corn Rhizosphere	VGLNPFRSQTKRASDVVIVVAALVVVAALVLWAVFG
Ga0207652_102768654	3300025921	Corn Rhizosphere	VGLNPFRSQTKRASDVVILVAALVVVAALVLWAVFG
Ga0207690_103631272	3300025932	Corn Rhizosphere	MGRYRSGVGLNPFRSQTKRASDVVIVVAALVVVAALVLWAVFG
Ga0207690_110233952	3300025932	Corn Rhizosphere	MGLNPFRAQAKRGTDLVIVAIALAVVAALVLWAVLG
Ga0207709_108501682	3300025935	Miscanthus Rhizosphere	VGLNPFRSQTKRTSDVVIVVAALVVVAALVLWAVFG
Ga0207639_119941902	3300026041	Corn Rhizosphere	VGFNPFRAQTKRGSDIVLVAVALVVIAALVAWALFG
Ga0207648_117543393	3300026089	Miscanthus Rhizosphere	VGLNPFRSQAKRSSDIVIVAVALAVIAALVLWAVLG
Ga0209068_1000259713	3300027894	Watersheds	VGLNPFRSQAKRSSDVVIVAVALVVIAALVLWAVFG
Ga0209068_101119381	3300027894	Watersheds	RYRDRVGLNPFRSQVHRRTDLVVVGVALVVIAALVLWGLFG
Ga0209068_101715072	3300027894	Watersheds	VGLNPFRSQEKRRADIVIVVAALVVVAALVLWAVLGG
Ga0209382_114907012	3300027909	Populus Rhizosphere	VGFNPFRSRVDRRTDIVVVIVAFVVIAALLVWAFLG
Ga0209698_108535492	3300027911	Watersheds	VGLNPFRAQEKRTADVVIVVAALVVVAALVLWAVFGG
Ga0209069_100108384	3300027915	Watersheds	VGLNPFRSQAKRSSDLVIVAVALTVIAALVLWAVFG
Ga0268264_111002612	3300028381	Switchgrass Rhizosphere	MGLNPFRSQTKRASDVVIVVAALVVVAALVLWAVFG
Ga0247822_111922262	3300028592	Soil	VGFNPFRSRVNRRTDIVVVIVAFVVIAALLAWAFFG
Ga0247820_106931942	3300028597	Soil	VGLNPFRSQTKRTSDVVIVVAALAVVAALVLWAVFG
Ga0265322_100745032	3300028654	Rhizosphere	VGLNPFRSQTRRASDVVIVAVALVVVAALVLWAVFG
Ga0302169_100159194	3300028679	Fen	MRVPYRGVGLNPFRAQEKRTADVVIVVAALVVVAALVLWAVFGG
Ga0307309_102187461	3300028714	Soil	VGLNPFRSQTKRASDVVIVVVALAVVAALVLWAVFG
Ga0302256_100207803	3300028741	Fen	VGLNPFRAQEKRSADVVIVVAALVVVAALVLWAVFGG
Ga0302262_100414412	3300028743	Fen	VGLNPFRSRVNRRADVIVVAAALVVIAALVIWAVFGG
Ga0307503_108015521	3300028802	Soil	VGFNPFRTHTNHTSDIVIVVTALVVVAALVLWAVFG
Ga0302291_100243542	3300028865	Fen	VGLNPFRSRVSRRTDIVVVAAAFVAIAALLVWAVFGG
Ga0307278_104044392	3300028878	Soil	MGLNPFRARAKRGTDALVVAIALVVIALLVYWAMFG
Ga0311336_102747484	3300029990	Fen	RYRGSVGLNPFRSRVSRRTDIVVVAAAFVAIAALLVWAVFGG
Ga0299907_106132411	3300030006	Soil	VGFNPFRPGKGPRPSDVVILVAALVIVIALVAWAAFGG
Ga0311333_106833381	3300030114	Fen	VGLNPFRSRVNRRTDVIVVAAAFVVITALVVWAVFGG
Ga0311349_102485353	3300030294	Fen	MRVPYRDVGLNPFRAQEKRTADVVIVVAALVVVAALVLWAVFGG
Ga0299914_105786081	3300031228	Soil	VGFNPFRAHAKRTADYVIVAIALVVIAALVLWGLFG
Ga0265327_100115843	3300031251	Rhizosphere	MRVPYRGVGLNPFRSQEKRKADVVIVVAALVVVAALVLWAVFGG
Ga0265327_100154815	3300031251	Rhizosphere	VGLNPFRSQAKRGTDVVIVVAALVVVAALVLWAVFG
Ga0318516_100694372	3300031543	Soil	MGRYRSGVGLNPFRSQTKRGSDVVIVAVALVVIGALVLWAVFG
Ga0318516_102435422	3300031543	Soil	VGFNPFRAHASRRTDLLIVAAAFLVIAALVLWAVFG
Ga0318515_105868242	3300031572	Soil	MGFNPFRGQTRRRSDLVLVAVALVVIAALVAWALFG
Ga0318561_103549402	3300031679	Soil	MGRYRSGVGLNPFRSQTRRGSDVVIVAVALVVIGALVLWAVFG
Ga0318492_107820741	3300031748	Soil	GRYRSGVGLNPFRSQTKRGSDVVIVAVALVVIGALVLWAVFG
Ga0318494_101758751	3300031751	Soil	VGLNPFRSQTKRGSDVVIVAVALVVIGALVLWAVFG
Ga0308411_102747782	3300031812	Hot Spring Phototrophic Mat	MGRYRSGVGLNPFRSRVARRTDAIVVAVALVVIAALVAWALFGG
Ga0306925_118470211	3300031890	Soil	MGRYRSGVGLNPFRSQTRRGSDVVIVAVALVVIGALALWAVFG
Ga0318569_102528972	3300032010	Soil	VGLNPFRSQAKRRSDVIIVVAAFVVIAALVLWAVLG
Ga0315281_106856344	3300032163	Sediment	MGLNPFRAQAMRGSDLAIVAVALVVIAALVLWALFG
Ga0315287_113685483	3300032397	Sediment	MARYRSGVGLNPFRSRVNRRTDAIVVGAALMVVAALVLWAFFGG
Ga0335082_116912452	3300032782	Soil	VGLNPFRSQAKRGSDVAIVVAALVVVAALVLWAVFG
Ga0299912_107954342	3300033489	Soil	VGLNPFRTQQKNTTDIVMVVAALVVAAALVLWAVFG
Ga0370493_0217931_1_126	3300034129	Untreated Peat Soil	MRVPYRDVGLNPFRAQEKRAADVVIVVAALVVVAALVLWAVF
Ga0364942_0293921_91_201	3300034165	Sediment	VGLNPFRAQQKNATDIVIVVAALVVVAALVLWAVFG