| Basic Information | |
|---|---|
| Family ID | F051351 |
| Family Type | Metagenome |
| Number of Sequences | 144 |
| Average Sequence Length | 38 residues |
| Representative Sequence | VGLNPFRSQAKRSSDVVIVAVALVVIAALVLWAVFG |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 40.52 % |
| % of genes near scaffold ends (potentially truncated) | 14.58 % |
| % of genes from short scaffolds (< 2000 bps) | 75.00 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.111 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.028 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.611 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.806 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.62% β-sheet: 0.00% Coil/Unstructured: 59.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF00378 | ECH_1 | 43.06 |
| PF02021 | UPF0102 | 17.36 |
| PF02481 | DNA_processg_A | 4.17 |
| PF12802 | MarR_2 | 3.47 |
| PF10611 | DUF2469 | 3.47 |
| PF01245 | Ribosomal_L19 | 3.47 |
| PF16113 | ECH_2 | 2.08 |
| PF01734 | Patatin | 2.08 |
| PF13335 | Mg_chelatase_C | 1.39 |
| PF13541 | ChlI | 0.69 |
| PF00448 | SRP54 | 0.69 |
| PF00583 | Acetyltransf_1 | 0.69 |
| PF05057 | DUF676 | 0.69 |
| PF13407 | Peripla_BP_4 | 0.69 |
| PF00440 | TetR_N | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG0792 | Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 family | Replication, recombination and repair [L] | 17.36 |
| COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 8.33 |
| COG0335 | Ribosomal protein L19 | Translation, ribosomal structure and biogenesis [J] | 3.47 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 2.08 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 2.08 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 2.08 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.11 % |
| Unclassified | root | N/A | 38.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502000|ACOD_F64RS5002INT5U | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 2124908007|FWIRElOz_GKZ9IRQ01EB7FG | Not Available | 530 | Open in IMG/M |
| 2170459010|GIO7OMY01EO5EX | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 532 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104824880 | Not Available | 665 | Open in IMG/M |
| 3300000956|JGI10216J12902_100248775 | All Organisms → cellular organisms → Bacteria | 1926 | Open in IMG/M |
| 3300000956|JGI10216J12902_105925528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1035 | Open in IMG/M |
| 3300001686|C688J18823_10556628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
| 3300003998|Ga0055472_10095168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 827 | Open in IMG/M |
| 3300004153|Ga0063455_100259109 | Not Available | 918 | Open in IMG/M |
| 3300005093|Ga0062594_100697200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 915 | Open in IMG/M |
| 3300005179|Ga0066684_10271462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1119 | Open in IMG/M |
| 3300005337|Ga0070682_100615309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 860 | Open in IMG/M |
| 3300005434|Ga0070709_10233145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1318 | Open in IMG/M |
| 3300005539|Ga0068853_101615006 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005543|Ga0070672_101560718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 592 | Open in IMG/M |
| 3300005544|Ga0070686_101378238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
| 3300005548|Ga0070665_102012371 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005548|Ga0070665_102167723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 560 | Open in IMG/M |
| 3300005618|Ga0068864_101906321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 600 | Open in IMG/M |
| 3300005718|Ga0068866_11336971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300005764|Ga0066903_105313760 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300005764|Ga0066903_108542806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 522 | Open in IMG/M |
| 3300005841|Ga0068863_102391460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300005937|Ga0081455_10219013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1412 | Open in IMG/M |
| 3300006047|Ga0075024_100897589 | Not Available | 504 | Open in IMG/M |
| 3300006057|Ga0075026_100038614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2211 | Open in IMG/M |
| 3300006057|Ga0075026_100976272 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300006102|Ga0075015_100515035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 691 | Open in IMG/M |
| 3300006102|Ga0075015_101019936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300006174|Ga0075014_100724514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
| 3300006354|Ga0075021_10221532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1158 | Open in IMG/M |
| 3300006846|Ga0075430_100317683 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300006853|Ga0075420_100071118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3081 | Open in IMG/M |
| 3300006854|Ga0075425_100097936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3331 | Open in IMG/M |
| 3300006881|Ga0068865_101598587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
| 3300007076|Ga0075435_100743302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 853 | Open in IMG/M |
| 3300007769|Ga0102952_1228462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
| 3300009012|Ga0066710_101113085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1222 | Open in IMG/M |
| 3300009094|Ga0111539_11460980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 793 | Open in IMG/M |
| 3300009137|Ga0066709_101478352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 982 | Open in IMG/M |
| 3300009137|Ga0066709_103087375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300009148|Ga0105243_11997673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
| 3300009176|Ga0105242_12167920 | Not Available | 600 | Open in IMG/M |
| 3300009551|Ga0105238_10744388 | Not Available | 994 | Open in IMG/M |
| 3300009789|Ga0126307_11423494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300009870|Ga0131092_10624073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 936 | Open in IMG/M |
| 3300010043|Ga0126380_11213985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
| 3300010362|Ga0126377_10334938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1504 | Open in IMG/M |
| 3300010366|Ga0126379_12935619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300010373|Ga0134128_11238336 | Not Available | 823 | Open in IMG/M |
| 3300010398|Ga0126383_11987586 | Not Available | 669 | Open in IMG/M |
| 3300010401|Ga0134121_12497739 | Not Available | 559 | Open in IMG/M |
| 3300011119|Ga0105246_11574682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300012212|Ga0150985_103757404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
| 3300012356|Ga0137371_11191106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300012905|Ga0157296_10334302 | Not Available | 543 | Open in IMG/M |
| 3300012925|Ga0137419_11015302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 688 | Open in IMG/M |
| 3300012958|Ga0164299_10577524 | Not Available | 764 | Open in IMG/M |
| 3300012960|Ga0164301_11483525 | Not Available | 558 | Open in IMG/M |
| 3300012986|Ga0164304_11720036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300013308|Ga0157375_11000309 | Not Available | 976 | Open in IMG/M |
| 3300013772|Ga0120158_10158660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria | 1239 | Open in IMG/M |
| 3300013772|Ga0120158_10205739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1023 | Open in IMG/M |
| 3300014267|Ga0075313_1230849 | Not Available | 500 | Open in IMG/M |
| 3300014320|Ga0075342_1060928 | Not Available | 934 | Open in IMG/M |
| 3300014325|Ga0163163_10904051 | Not Available | 946 | Open in IMG/M |
| 3300015371|Ga0132258_10043085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 10270 | Open in IMG/M |
| 3300015372|Ga0132256_101927538 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300015373|Ga0132257_102451098 | Not Available | 677 | Open in IMG/M |
| 3300015374|Ga0132255_100839197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1371 | Open in IMG/M |
| 3300017974|Ga0187777_11172103 | Not Available | 561 | Open in IMG/M |
| 3300018468|Ga0066662_10818635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
| 3300018469|Ga0190270_11282360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 774 | Open in IMG/M |
| 3300018469|Ga0190270_11412255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 742 | Open in IMG/M |
| 3300018476|Ga0190274_12451101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
| 3300018482|Ga0066669_10593447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 970 | Open in IMG/M |
| 3300021445|Ga0182009_10564778 | Not Available | 606 | Open in IMG/M |
| 3300025615|Ga0210086_1163740 | Not Available | 647 | Open in IMG/M |
| 3300025913|Ga0207695_11167718 | Not Available | 650 | Open in IMG/M |
| 3300025921|Ga0207652_10276865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1514 | Open in IMG/M |
| 3300025932|Ga0207690_10363127 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300025932|Ga0207690_11023395 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300025935|Ga0207709_10850168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 739 | Open in IMG/M |
| 3300026041|Ga0207639_11994190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 541 | Open in IMG/M |
| 3300026089|Ga0207648_11754339 | Not Available | 582 | Open in IMG/M |
| 3300027894|Ga0209068_10002597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8675 | Open in IMG/M |
| 3300027894|Ga0209068_10111938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1450 | Open in IMG/M |
| 3300027894|Ga0209068_10171507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1183 | Open in IMG/M |
| 3300027911|Ga0209698_10853549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 685 | Open in IMG/M |
| 3300027915|Ga0209069_10010838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 4404 | Open in IMG/M |
| 3300028381|Ga0268264_11100261 | Not Available | 803 | Open in IMG/M |
| 3300028597|Ga0247820_10693194 | Not Available | 709 | Open in IMG/M |
| 3300028654|Ga0265322_10074503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 963 | Open in IMG/M |
| 3300028679|Ga0302169_10015919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1746 | Open in IMG/M |
| 3300028714|Ga0307309_10218746 | Not Available | 508 | Open in IMG/M |
| 3300028741|Ga0302256_10020780 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
| 3300028802|Ga0307503_10801552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300028878|Ga0307278_10404439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
| 3300030006|Ga0299907_10613241 | Not Available | 845 | Open in IMG/M |
| 3300030294|Ga0311349_10248535 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300031228|Ga0299914_10578608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 962 | Open in IMG/M |
| 3300031251|Ga0265327_10011584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 6052 | Open in IMG/M |
| 3300031251|Ga0265327_10015481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 4918 | Open in IMG/M |
| 3300031543|Ga0318516_10069437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1951 | Open in IMG/M |
| 3300031543|Ga0318516_10243542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 1040 | Open in IMG/M |
| 3300031572|Ga0318515_10586824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
| 3300031679|Ga0318561_10354940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 804 | Open in IMG/M |
| 3300031748|Ga0318492_10782074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300031751|Ga0318494_10175875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1213 | Open in IMG/M |
| 3300031890|Ga0306925_11847021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300032010|Ga0318569_10252897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
| 3300032163|Ga0315281_10685634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1069 | Open in IMG/M |
| 3300032782|Ga0335082_11691245 | Not Available | 507 | Open in IMG/M |
| 3300033489|Ga0299912_10795434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
| 3300034129|Ga0370493_0217931 | Not Available | 640 | Open in IMG/M |
| 3300034165|Ga0364942_0293921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.03% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 8.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.86% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.08% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.08% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.08% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.08% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.08% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.39% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.39% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.39% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.39% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.39% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.39% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.39% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.39% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.39% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.39% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.69% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.69% |
| Hot Spring Phototrophic Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat | 0.69% |
| Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment | 0.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.69% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.69% |
| Fungus Garden | Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden | 0.69% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.69% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502000 | Fungus garden microbial communities from Atta colombica in Panama - dump bottom | Host-Associated | Open in IMG/M |
| 2124908007 | Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2 | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007769 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D1_MG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010938 | Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025615 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Host-Associated | Open in IMG/M |
| 3300028679 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028741 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028865 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031812 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-BottomLayer | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| 3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ACODB_7283950 | 2040502000 | Fungus Garden | YRSGVGLNPFRSQTTRASDVAIVVVALVVVAALVLWAMFG |
| FWIRElOz_06488870 | 2124908007 | Soil | VGLNPFRSQAKRSSDIVIVAVALVVIAALVLWAVFG |
| F62_01489070 | 2170459010 | Grass Soil | MGLNPFRAQAKRGSDLAIVAVALVVIAALVLWALFG |
| INPhiseqgaiiFebDRAFT_1048248803 | 3300000364 | Soil | MGLNPFRAQAXRGSDLAIVXVALVVIAALVLWALFG* |
| JGI10216J12902_1002487753 | 3300000956 | Soil | VGLNPFRSQAKRGSDVVIVAVALVVIAALVLWALFG* |
| JGI10216J12902_1059255281 | 3300000956 | Soil | MGLNPFRAQAKRGTDLVIVAIALAVVAALVLWAVLG* |
| C688J18823_105566282 | 3300001686 | Soil | VGLNPFRSQTKRASDLVIVVAALVVVAALVLWAVFG* |
| Ga0055472_100951681 | 3300003998 | Natural And Restored Wetlands | RDATVNDVGFNPFRARAKRGTDLLVVAAAFVVIAALVLWAVFG* |
| Ga0063455_1002591091 | 3300004153 | Soil | MGRYRSGVGLNPFRSQAKRSSDVVIVAIALVVIAALVLWALFG* |
| Ga0062594_1006972002 | 3300005093 | Soil | MGRYRSGVGLNPFRSQAKRSSDVVIVAVALVVIAALVLWAVFG* |
| Ga0066684_102714622 | 3300005179 | Soil | MSRYRSGVGLNPFRSQAKRGSDVVIVAVALVVIAALVLWAVFG* |
| Ga0070682_1006153094 | 3300005337 | Corn Rhizosphere | DIGRYRSGVGLNPFRSQAKRSSDVVIVAVALVVIAALVLWAVFG* |
| Ga0070709_102331452 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRYRSGVGLNPFRSQAKRSSDVVIVAVALVVIAALVLWAVFG* |
| Ga0068853_1016150062 | 3300005539 | Corn Rhizosphere | MGLNPFRAQAKRGTDLVIVAIALAVVAALVLWAVGMTHDAA |
| Ga0070672_1015607183 | 3300005543 | Miscanthus Rhizosphere | RYRSGVGLNPFRSQAKRGTDVVIVVVALAVVAALVLWAVFG* |
| Ga0070686_1013782382 | 3300005544 | Switchgrass Rhizosphere | MGRYRSGVGLNPFRSQTKRTSDVVIVVAALVVVAALVLWAVFG* |
| Ga0070665_1020123712 | 3300005548 | Switchgrass Rhizosphere | VGLNPFRSQTKRASDVVIVVAALVVVAALVLWAVFG* |
| Ga0070665_1021677233 | 3300005548 | Switchgrass Rhizosphere | DIGRYRSGVGLNPFRSQAKRGTDVVIVVIALVVVGALVLWAVFG* |
| Ga0068864_1019063212 | 3300005618 | Switchgrass Rhizosphere | LNPFRAQAKRGSDLAIVAVALVVIAALVLWALFG* |
| Ga0066905_1008052683 | 3300005713 | Tropical Forest Soil | VGLNPFRSRVHRRTDLVVVVVAFVVIALLVLWGLFG* |
| Ga0068866_113369712 | 3300005718 | Miscanthus Rhizosphere | VGLNPFRSQTKRSSDVVIVVAALVVVAALVLWAVFG* |
| Ga0066903_1053137602 | 3300005764 | Tropical Forest Soil | VGFNPFRAHASRRTDLLIVAAAFLVIAVLVLWAVFG* |
| Ga0066903_1085428062 | 3300005764 | Tropical Forest Soil | MGRYRSGVGLNPFRSQAKRGSDIVIVAVALVVIGALVLWAVFG* |
| Ga0068863_1023914602 | 3300005841 | Switchgrass Rhizosphere | MGLNPFRSQTKRASDVVIVAAALVVVAALVLWAVFG* |
| Ga0081455_102190133 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MGRYRSGVGLNPFRSQAKRGSDVVIVAVALVVIAALVLWAVLG* |
| Ga0066652_1000808192 | 3300006046 | Soil | VGFNPFRAHASRRTDLVIVAAAFVVIAALVVWAVFG* |
| Ga0066652_1001136032 | 3300006046 | Soil | VGFNPFRSRVERRTDIVVVICAFVVIMALVVWAFFG* |
| Ga0075024_1008975892 | 3300006047 | Watersheds | VGLNPFRSQAKRSSDVVIVAVALVVIAALVLWAVFG* |
| Ga0075026_1000386143 | 3300006057 | Watersheds | MGRYRSGVGLNPFRSQAKRSSDIVIVAVALVVIAALVLWAVFG* |
| Ga0075026_1009762722 | 3300006057 | Watersheds | MGLNPFRAQAKRGTDLVIVAIALVVVAALVLWAVFG* |
| Ga0075015_1005150352 | 3300006102 | Watersheds | VGLNPFRSQAKRSSDIVIVAVALVVIAALVLWAVFG* |
| Ga0075015_1010199362 | 3300006102 | Watersheds | VSGRYRSGVGLNPYRAQAKRRSDVIIVAVALVVVAALVLWALFG* |
| Ga0075014_1007245142 | 3300006174 | Watersheds | VGLNPFRAQEKRTADVVIVVAALVVVAALVLWAVFGG* |
| Ga0075021_102215323 | 3300006354 | Watersheds | VGLNPFRSQEKRRADIVIVVAALVVVAALVLWAVLGG* |
| Ga0075421_1019124502 | 3300006845 | Populus Rhizosphere | VGFNPFRSRVDRRTDIVVVIVAFVVIAALLVWAFLG* |
| Ga0075430_1003176832 | 3300006846 | Populus Rhizosphere | VGLNPFRSQVRRTTDYVVVAVALIVIAALVLWALFG* |
| Ga0075420_1000711183 | 3300006853 | Populus Rhizosphere | VGLNPFRSQVRRTTDYVVVAAALIVIAALVLWALFG* |
| Ga0075425_1000979363 | 3300006854 | Populus Rhizosphere | MGRYRSGVGLNPFRSQAKRSSDVVIVAVALVVITALVLWAVFG* |
| Ga0073934_100286343 | 3300006865 | Hot Spring Sediment | VGLNPFRSRVERRTDIVVVAVALVVILALVLWAFFGS* |
| Ga0075473_100339092 | 3300006875 | Aqueous | VGLNPFRSRVERRTDIIVVVAALVVIAALVMWGLFGG* |
| Ga0068865_1015985872 | 3300006881 | Miscanthus Rhizosphere | MGLNPFRAQAKRGSDLAIVAVALVVIAALVLWALFG* |
| Ga0075435_1007433023 | 3300007076 | Populus Rhizosphere | GRYRSGVGLNPFRSQAKRSSDVVIVAVALVVITALVLWAVFG* |
| Ga0102952_12284622 | 3300007769 | Soil | VGLNPFRSQVNRRSDIVIVAVALVVVLALVLWGLFG* |
| Ga0066710_1011130852 | 3300009012 | Grasslands Soil | MARYRSGVGLNPFRSQAKRGSDIVIVAVALVVIAALVLWAVFG |
| Ga0111539_114609802 | 3300009094 | Populus Rhizosphere | VGLNPFRSQAKRSSDVVIVAVALVVITALVLWAVFG* |
| Ga0105247_104244862 | 3300009101 | Switchgrass Rhizosphere | VGFNPFRSRVDRRTDIVVVAVAFVVIAALVIWAFLG* |
| Ga0066709_1014783522 | 3300009137 | Grasslands Soil | MARYRSGVGLNPFRSQAKRGSDVVIVAVALVVIAALVLWAVFG* |
| Ga0066709_1030873751 | 3300009137 | Grasslands Soil | LNPFRAHARRASDVVIVAAAFLVIVLLVLWAVFG* |
| Ga0114129_105848883 | 3300009147 | Populus Rhizosphere | VGFNPFRSRVDRRTDIVVVVVAFVVIAALLVWAFLG* |
| Ga0105243_107030583 | 3300009148 | Miscanthus Rhizosphere | VGLNPFRSRVERRTDLVVVAVAFVVIAALVLWALLG* |
| Ga0105243_119976732 | 3300009148 | Miscanthus Rhizosphere | MGLNPFRAQAKRGSDLVIVAVALVVIAALVLWALFG* |
| Ga0105242_121679202 | 3300009176 | Miscanthus Rhizosphere | MGLNPFRAQAKRGSDLAIVVVALVVIAALVLWALFG* |
| Ga0105238_107443882 | 3300009551 | Corn Rhizosphere | VGLNPFRSQTKRASDVVILVAALVVVAALVLWAVFG* |
| Ga0126307_114234942 | 3300009789 | Serpentine Soil | VGLNPFRSQTKRASDVVIVVVALAVVAALVLWAVFG* |
| Ga0131092_106240732 | 3300009870 | Activated Sludge | MGLNPFREQTKRTSDVVIVVVALAITIALVLWAIFG* |
| Ga0126312_108311121 | 3300010041 | Serpentine Soil | ALDENVSHGRYRSAVGLNPFRSRVARRTDAIVVAVAFVVIFALVLWALFG* |
| Ga0126380_112139852 | 3300010043 | Tropical Forest Soil | MGRYRSGVGLNPFRSQAKRSSDVVIVAVALVVIGALVLWAVFG* |
| Ga0126372_130389082 | 3300010360 | Tropical Forest Soil | VGLNPFRSRVHRRTDLVVVAVAFVVIALLVLWGLFG* |
| Ga0126377_103349385 | 3300010362 | Tropical Forest Soil | GVARYGELVGLNPFRARAKRSTDVLIVAAALVIVAALVLWAVFG* |
| Ga0126379_129356192 | 3300010366 | Tropical Forest Soil | VGFNPFRSQAKRSSDIVIVVAALVVVAALVLWAVFG* |
| Ga0134128_112383361 | 3300010373 | Terrestrial Soil | MGRYRSGVGLNPFRSQAKRSSDVVIVAVALVVIAALVLW |
| Ga0126383_119875862 | 3300010398 | Tropical Forest Soil | VGFNPFRAHASRRTDLLIVAAAFLVIAALVLWAVFG* |
| Ga0134121_124977391 | 3300010401 | Terrestrial Soil | MDRYRSGVGLNPFRSQTKRASDVVIVVVALAVVAALVLW |
| Ga0133913_101901158 | 3300010885 | Freshwater Lake | VGLNPFRSRVSRRTDVVVVAAAFVVIAVLVVWAFVG* |
| Ga0137716_1001964713 | 3300010938 | Hot Spring Fe-Si Sediment | MGRYRSGVGLNPFRSRVARRTDAIVVAVALVVIAALVAWALFGG* |
| Ga0105246_115746822 | 3300011119 | Miscanthus Rhizosphere | MGLNPFRARAKRGTDVLVVAIALVVVALLVYWAMFG* |
| Ga0150985_1037574042 | 3300012212 | Avena Fatua Rhizosphere | AALPISGMGRYRSGVGLNPFRSQAKRSSDVVIVAVALVVIAALVLWAVFG* |
| Ga0137371_111911061 | 3300012356 | Vadose Zone Soil | VGLNPFRAHARRASDVVIVAAAFLVIVLLVLWAVFG* |
| Ga0157296_103343022 | 3300012905 | Soil | VGLNPFRSQTKRTSDVVIVVAALVVVAALVLWAVFG* |
| Ga0137419_110153023 | 3300012925 | Vadose Zone Soil | VGLNPFRSHTSRPTDIAIVVGALVVIAALVLWGLFG* |
| Ga0164299_105775243 | 3300012958 | Soil | VGLNPFRSQAKRGTDVVIVAVALVVVAALVLWAVFG* |
| Ga0164301_114835252 | 3300012960 | Soil | MGRYRSGVGLNPFRSQAKRSSDVVIVAVALVVIAAL |
| Ga0164304_117200362 | 3300012986 | Soil | GVGLNPFRSQAKRSSDVVIVAVALVVIAALVLWAVFG* |
| Ga0157375_110003092 | 3300013308 | Miscanthus Rhizosphere | VGLNPFRSQTKRASDVVIVAAALVVVAALVLWAVFG* |
| Ga0120158_101586601 | 3300013772 | Permafrost | CKSGKAGRYRSGMGLNPFRAQAKRGSDLAIVAVALVVIAALVLWALFG* |
| Ga0120158_102057391 | 3300013772 | Permafrost | RMGLNPFRAQAKRGTDLVIVAVALAVVAALVLWAVFG* |
| Ga0075313_12308492 | 3300014267 | Natural And Restored Wetlands | VNDVGFNPFRARAKRGTDLLVVAAAFVVIAALVLWAVFG* |
| Ga0075342_10609281 | 3300014320 | Natural And Restored Wetlands | VAGVGLNPFRSQVKRTTDYVIVAVALVVIAALVLWGLFG* |
| Ga0163163_109040511 | 3300014325 | Switchgrass Rhizosphere | VGLNPFRSQAKRGSDVAIVVAALVVVAALVLWAVFG* |
| Ga0132258_100430858 | 3300015371 | Arabidopsis Rhizosphere | VGFNPFRAHGARRTDLLIVAAAFLVILALVLWAVFG* |
| Ga0132256_1019275382 | 3300015372 | Arabidopsis Rhizosphere | VGLNPFRAQAKRGTDLVIVAIALAVVAALVLWAVLG* |
| Ga0132257_1024510983 | 3300015373 | Arabidopsis Rhizosphere | MGLNPFRAQAKRGTDLVIVAVALAVVAALVLWAVFG* |
| Ga0132255_1008391972 | 3300015374 | Arabidopsis Rhizosphere | VGFNPFRAHAARRTDLLIVAAAFLVILALVLWAVFG* |
| Ga0190266_104001262 | 3300017965 | Soil | VGLNPFRSRVSRRTDIVVVAAAFVVIAGLVVWAFLGG |
| Ga0187777_111721031 | 3300017974 | Tropical Peatland | VGLNPFRSQERRRTDVVVVAAALVVVAALVIWAIFGG |
| Ga0066662_108186352 | 3300018468 | Grasslands Soil | VGLNPFRSQAKRGTDVVIVVVALTVVAALVLWAVFG |
| Ga0190270_112823603 | 3300018469 | Soil | VGLNPFRAQEKRGTDVVIVAVALVVIAALVLWGLFG |
| Ga0190270_114122552 | 3300018469 | Soil | VGLNPFRSQAKRSSDIVIVVVALVVTAALVLWAVFG |
| Ga0190274_124511012 | 3300018476 | Soil | MGLNPFRYQTKRTSDYVIVGAALVVIAALVLWGLFG |
| Ga0190271_129734032 | 3300018481 | Soil | MGFNPFRSRVDRRTDIVIVIAAAAVILALVAWAFFGG |
| Ga0066669_105934472 | 3300018482 | Grasslands Soil | MGLNPFRARAKRGTDVLVVAVALVIVALLVYWAMFG |
| Ga0194112_103479064 | 3300020109 | Freshwater Lake | EFAARYRGAVGLNPFRSRVERRTDVIVVIAALVVIAALVVWGLFGG |
| Ga0182009_105647782 | 3300021445 | Soil | VGLNPFRSQAKRGSDVAIVVAALVVVAALVLWAIFG |
| Ga0126371_121463122 | 3300021560 | Tropical Forest Soil | VGLNPFRSRVHRRTDLVVVVVAFVVIALLVLWGLFG |
| Ga0222622_108959482 | 3300022756 | Groundwater Sediment | VGFNPFRSRVNRRTDIVVVVVAFVVIAALVMWAFFG |
| Ga0209172_100238584 | 3300025310 | Hot Spring Sediment | VGLNPFRSRVERRTDIVVVAVALVVILALVLWAFFGS |
| Ga0210086_11637402 | 3300025615 | Natural And Restored Wetlands | VGLNPFRSQVNRRSDIVIVAVALVVVLALVLWGLFG |
| Ga0208784_10380572 | 3300025732 | Aqueous | VGLNPFRSRVERRTDIIVVVAALVVIAALVMWGLFGG |
| Ga0207695_111677181 | 3300025913 | Corn Rhizosphere | VGLNPFRSQTKRASDVVIVVAALVVVAALVLWAVFG |
| Ga0207652_102768654 | 3300025921 | Corn Rhizosphere | VGLNPFRSQTKRASDVVILVAALVVVAALVLWAVFG |
| Ga0207690_103631272 | 3300025932 | Corn Rhizosphere | MGRYRSGVGLNPFRSQTKRASDVVIVVAALVVVAALVLWAVFG |
| Ga0207690_110233952 | 3300025932 | Corn Rhizosphere | MGLNPFRAQAKRGTDLVIVAIALAVVAALVLWAVLG |
| Ga0207709_108501682 | 3300025935 | Miscanthus Rhizosphere | VGLNPFRSQTKRTSDVVIVVAALVVVAALVLWAVFG |
| Ga0207639_119941902 | 3300026041 | Corn Rhizosphere | VGFNPFRAQTKRGSDIVLVAVALVVIAALVAWALFG |
| Ga0207648_117543393 | 3300026089 | Miscanthus Rhizosphere | VGLNPFRSQAKRSSDIVIVAVALAVIAALVLWAVLG |
| Ga0209068_1000259713 | 3300027894 | Watersheds | VGLNPFRSQAKRSSDVVIVAVALVVIAALVLWAVFG |
| Ga0209068_101119381 | 3300027894 | Watersheds | RYRDRVGLNPFRSQVHRRTDLVVVGVALVVIAALVLWGLFG |
| Ga0209068_101715072 | 3300027894 | Watersheds | VGLNPFRSQEKRRADIVIVVAALVVVAALVLWAVLGG |
| Ga0209382_114907012 | 3300027909 | Populus Rhizosphere | VGFNPFRSRVDRRTDIVVVIVAFVVIAALLVWAFLG |
| Ga0209698_108535492 | 3300027911 | Watersheds | VGLNPFRAQEKRTADVVIVVAALVVVAALVLWAVFGG |
| Ga0209069_100108384 | 3300027915 | Watersheds | VGLNPFRSQAKRSSDLVIVAVALTVIAALVLWAVFG |
| Ga0268264_111002612 | 3300028381 | Switchgrass Rhizosphere | MGLNPFRSQTKRASDVVIVVAALVVVAALVLWAVFG |
| Ga0247822_111922262 | 3300028592 | Soil | VGFNPFRSRVNRRTDIVVVIVAFVVIAALLAWAFFG |
| Ga0247820_106931942 | 3300028597 | Soil | VGLNPFRSQTKRTSDVVIVVAALAVVAALVLWAVFG |
| Ga0265322_100745032 | 3300028654 | Rhizosphere | VGLNPFRSQTRRASDVVIVAVALVVVAALVLWAVFG |
| Ga0302169_100159194 | 3300028679 | Fen | MRVPYRGVGLNPFRAQEKRTADVVIVVAALVVVAALVLWAVFGG |
| Ga0307309_102187461 | 3300028714 | Soil | VGLNPFRSQTKRASDVVIVVVALAVVAALVLWAVFG |
| Ga0302256_100207803 | 3300028741 | Fen | VGLNPFRAQEKRSADVVIVVAALVVVAALVLWAVFGG |
| Ga0302262_100414412 | 3300028743 | Fen | VGLNPFRSRVNRRADVIVVAAALVVIAALVIWAVFGG |
| Ga0307503_108015521 | 3300028802 | Soil | VGFNPFRTHTNHTSDIVIVVTALVVVAALVLWAVFG |
| Ga0302291_100243542 | 3300028865 | Fen | VGLNPFRSRVSRRTDIVVVAAAFVAIAALLVWAVFGG |
| Ga0307278_104044392 | 3300028878 | Soil | MGLNPFRARAKRGTDALVVAIALVVIALLVYWAMFG |
| Ga0311336_102747484 | 3300029990 | Fen | RYRGSVGLNPFRSRVSRRTDIVVVAAAFVAIAALLVWAVFGG |
| Ga0299907_106132411 | 3300030006 | Soil | VGFNPFRPGKGPRPSDVVILVAALVIVIALVAWAAFGG |
| Ga0311333_106833381 | 3300030114 | Fen | VGLNPFRSRVNRRTDVIVVAAAFVVITALVVWAVFGG |
| Ga0311349_102485353 | 3300030294 | Fen | MRVPYRDVGLNPFRAQEKRTADVVIVVAALVVVAALVLWAVFGG |
| Ga0299914_105786081 | 3300031228 | Soil | VGFNPFRAHAKRTADYVIVAIALVVIAALVLWGLFG |
| Ga0265327_100115843 | 3300031251 | Rhizosphere | MRVPYRGVGLNPFRSQEKRKADVVIVVAALVVVAALVLWAVFGG |
| Ga0265327_100154815 | 3300031251 | Rhizosphere | VGLNPFRSQAKRGTDVVIVVAALVVVAALVLWAVFG |
| Ga0318516_100694372 | 3300031543 | Soil | MGRYRSGVGLNPFRSQTKRGSDVVIVAVALVVIGALVLWAVFG |
| Ga0318516_102435422 | 3300031543 | Soil | VGFNPFRAHASRRTDLLIVAAAFLVIAALVLWAVFG |
| Ga0318515_105868242 | 3300031572 | Soil | MGFNPFRGQTRRRSDLVLVAVALVVIAALVAWALFG |
| Ga0318561_103549402 | 3300031679 | Soil | MGRYRSGVGLNPFRSQTRRGSDVVIVAVALVVIGALVLWAVFG |
| Ga0318492_107820741 | 3300031748 | Soil | GRYRSGVGLNPFRSQTKRGSDVVIVAVALVVIGALVLWAVFG |
| Ga0318494_101758751 | 3300031751 | Soil | VGLNPFRSQTKRGSDVVIVAVALVVIGALVLWAVFG |
| Ga0308411_102747782 | 3300031812 | Hot Spring Phototrophic Mat | MGRYRSGVGLNPFRSRVARRTDAIVVAVALVVIAALVAWALFGG |
| Ga0306925_118470211 | 3300031890 | Soil | MGRYRSGVGLNPFRSQTRRGSDVVIVAVALVVIGALALWAVFG |
| Ga0318569_102528972 | 3300032010 | Soil | VGLNPFRSQAKRRSDVIIVVAAFVVIAALVLWAVLG |
| Ga0315281_106856344 | 3300032163 | Sediment | MGLNPFRAQAMRGSDLAIVAVALVVIAALVLWALFG |
| Ga0315287_113685483 | 3300032397 | Sediment | MARYRSGVGLNPFRSRVNRRTDAIVVGAALMVVAALVLWAFFGG |
| Ga0335082_116912452 | 3300032782 | Soil | VGLNPFRSQAKRGSDVAIVVAALVVVAALVLWAVFG |
| Ga0299912_107954342 | 3300033489 | Soil | VGLNPFRTQQKNTTDIVMVVAALVVAAALVLWAVFG |
| Ga0370493_0217931_1_126 | 3300034129 | Untreated Peat Soil | MRVPYRDVGLNPFRAQEKRAADVVIVVAALVVVAALVLWAVF |
| Ga0364942_0293921_91_201 | 3300034165 | Sediment | VGLNPFRAQQKNATDIVIVVAALVVVAALVLWAVFG |
| ⦗Top⦘ |