| Basic Information | |
|---|---|
| Family ID | F051292 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MFGKPRQLETEAELYDVAVRALMRRAHSVHEMKQKLER |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.69 % |
| % of genes near scaffold ends (potentially truncated) | 97.92 % |
| % of genes from short scaffolds (< 2000 bps) | 91.67 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.472 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (35.417 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.917 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF00437 | T2SSE | 18.06 |
| PF04978 | DUF664 | 9.72 |
| PF13424 | TPR_12 | 5.56 |
| PF01451 | LMWPc | 1.39 |
| PF00230 | MIP | 1.39 |
| PF10518 | TAT_signal | 1.39 |
| PF00037 | Fer4 | 1.39 |
| PF08547 | CIA30 | 1.39 |
| PF00085 | Thioredoxin | 0.69 |
| PF12158 | DUF3592 | 0.69 |
| PF08281 | Sigma70_r4_2 | 0.69 |
| PF00583 | Acetyltransf_1 | 0.69 |
| PF14559 | TPR_19 | 0.69 |
| PF02371 | Transposase_20 | 0.69 |
| PF13432 | TPR_16 | 0.69 |
| PF13411 | MerR_1 | 0.69 |
| PF02631 | RecX | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 1.39 |
| COG2137 | SOS response regulatory protein OraA/RecX, interacts with RecA | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.47 % |
| Unclassified | root | N/A | 21.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02GKRF9 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300002914|JGI25617J43924_10296536 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10171452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 878 | Open in IMG/M |
| 3300004082|Ga0062384_100384655 | Not Available | 899 | Open in IMG/M |
| 3300004091|Ga0062387_101258913 | Not Available | 582 | Open in IMG/M |
| 3300005406|Ga0070703_10072422 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300005446|Ga0066686_11086319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300005586|Ga0066691_10650840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300005586|Ga0066691_10950889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 505 | Open in IMG/M |
| 3300005602|Ga0070762_10533218 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300005610|Ga0070763_10162004 | Not Available | 1175 | Open in IMG/M |
| 3300006050|Ga0075028_100941255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300006102|Ga0075015_100882991 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300006176|Ga0070765_100614161 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300006794|Ga0066658_10885657 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300006796|Ga0066665_10520706 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300006800|Ga0066660_10067920 | All Organisms → cellular organisms → Bacteria | 2405 | Open in IMG/M |
| 3300006904|Ga0075424_100691471 | Not Available | 1089 | Open in IMG/M |
| 3300009012|Ga0066710_100042075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5528 | Open in IMG/M |
| 3300009038|Ga0099829_10554806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 955 | Open in IMG/M |
| 3300009038|Ga0099829_10594035 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300009038|Ga0099829_11609698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300009088|Ga0099830_11782200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300009089|Ga0099828_11432871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300009090|Ga0099827_10478669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1069 | Open in IMG/M |
| 3300009090|Ga0099827_11204749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 658 | Open in IMG/M |
| 3300009143|Ga0099792_10483273 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300010048|Ga0126373_13090431 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010321|Ga0134067_10092774 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300010322|Ga0134084_10076055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 1034 | Open in IMG/M |
| 3300010343|Ga0074044_10503964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
| 3300010360|Ga0126372_11663496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300011120|Ga0150983_13939322 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300012096|Ga0137389_10592646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 952 | Open in IMG/M |
| 3300012096|Ga0137389_11821181 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300012189|Ga0137388_10431692 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300012189|Ga0137388_10990215 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300012189|Ga0137388_11856531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300012198|Ga0137364_10386056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1047 | Open in IMG/M |
| 3300012200|Ga0137382_10178112 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300012200|Ga0137382_11128723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300012202|Ga0137363_11276540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300012205|Ga0137362_10233362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1588 | Open in IMG/M |
| 3300012349|Ga0137387_10543347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300012349|Ga0137387_11203246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300012357|Ga0137384_10044413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3672 | Open in IMG/M |
| 3300012361|Ga0137360_10299898 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300012361|Ga0137360_10490316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1045 | Open in IMG/M |
| 3300012361|Ga0137360_10921081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300012362|Ga0137361_11898904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300012582|Ga0137358_10885930 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300012918|Ga0137396_10212561 | Not Available | 1423 | Open in IMG/M |
| 3300012918|Ga0137396_10230100 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300012922|Ga0137394_11138152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300012923|Ga0137359_10067731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3118 | Open in IMG/M |
| 3300012924|Ga0137413_10803618 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300012925|Ga0137419_10570169 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300012925|Ga0137419_10973142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300012927|Ga0137416_10497888 | Not Available | 1049 | Open in IMG/M |
| 3300012930|Ga0137407_11347331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300012944|Ga0137410_10023120 | All Organisms → cellular organisms → Bacteria | 4299 | Open in IMG/M |
| 3300012971|Ga0126369_12504954 | Not Available | 601 | Open in IMG/M |
| 3300012972|Ga0134077_10064589 | Not Available | 1371 | Open in IMG/M |
| 3300013832|Ga0120132_1089151 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300015054|Ga0137420_1085959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1401 | Open in IMG/M |
| 3300015054|Ga0137420_1181569 | Not Available | 967 | Open in IMG/M |
| 3300015054|Ga0137420_1261143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1057 | Open in IMG/M |
| 3300015264|Ga0137403_10183024 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
| 3300017822|Ga0187802_10228720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300017933|Ga0187801_10330387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300017955|Ga0187817_10351102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 940 | Open in IMG/M |
| 3300017975|Ga0187782_10779848 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300018058|Ga0187766_10594785 | Not Available | 754 | Open in IMG/M |
| 3300018433|Ga0066667_10068248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2235 | Open in IMG/M |
| 3300020199|Ga0179592_10252883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300020199|Ga0179592_10503114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300020579|Ga0210407_10020454 | All Organisms → cellular organisms → Bacteria | 4917 | Open in IMG/M |
| 3300020580|Ga0210403_10265419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1408 | Open in IMG/M |
| 3300020580|Ga0210403_11024451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300020581|Ga0210399_10709709 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300020583|Ga0210401_10288694 | Not Available | 1501 | Open in IMG/M |
| 3300020583|Ga0210401_11242772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300021168|Ga0210406_10436124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1045 | Open in IMG/M |
| 3300021170|Ga0210400_10079835 | All Organisms → cellular organisms → Bacteria | 2570 | Open in IMG/M |
| 3300021170|Ga0210400_10554287 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300021171|Ga0210405_11436351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300021178|Ga0210408_10917128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300021178|Ga0210408_11290587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium SDU3-3 | 554 | Open in IMG/M |
| 3300021180|Ga0210396_10246487 | All Organisms → cellular organisms → Bacteria | 1589 | Open in IMG/M |
| 3300021181|Ga0210388_10703062 | Not Available | 880 | Open in IMG/M |
| 3300021402|Ga0210385_11466601 | Not Available | 521 | Open in IMG/M |
| 3300021403|Ga0210397_11594382 | Not Available | 507 | Open in IMG/M |
| 3300021404|Ga0210389_10030512 | All Organisms → cellular organisms → Bacteria | 4144 | Open in IMG/M |
| 3300021432|Ga0210384_10458859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1147 | Open in IMG/M |
| 3300021432|Ga0210384_10748697 | Not Available | 873 | Open in IMG/M |
| 3300021474|Ga0210390_11452213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 544 | Open in IMG/M |
| 3300021477|Ga0210398_10091099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2475 | Open in IMG/M |
| 3300021478|Ga0210402_10238161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1678 | Open in IMG/M |
| 3300021559|Ga0210409_11647137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300021560|Ga0126371_11052541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300024330|Ga0137417_1185317 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300024330|Ga0137417_1347948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300024331|Ga0247668_1043329 | Not Available | 918 | Open in IMG/M |
| 3300026285|Ga0209438_1037605 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300026296|Ga0209235_1126613 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300026300|Ga0209027_1147662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300026310|Ga0209239_1234071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300026310|Ga0209239_1310974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300026314|Ga0209268_1190770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300026537|Ga0209157_1184080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 903 | Open in IMG/M |
| 3300026550|Ga0209474_10575711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300026552|Ga0209577_10522101 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300026557|Ga0179587_10111179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1670 | Open in IMG/M |
| 3300026557|Ga0179587_10859121 | Not Available | 598 | Open in IMG/M |
| 3300026557|Ga0179587_11128894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 516 | Open in IMG/M |
| 3300027645|Ga0209117_1081089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 908 | Open in IMG/M |
| 3300027655|Ga0209388_1073367 | Not Available | 986 | Open in IMG/M |
| 3300027684|Ga0209626_1020833 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300027729|Ga0209248_10244118 | Not Available | 524 | Open in IMG/M |
| 3300027775|Ga0209177_10273325 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300027795|Ga0209139_10000779 | All Organisms → cellular organisms → Bacteria | 11461 | Open in IMG/M |
| 3300027846|Ga0209180_10487558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300027862|Ga0209701_10333619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
| 3300027894|Ga0209068_10864952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300027908|Ga0209006_10849877 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300028536|Ga0137415_11385366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300028906|Ga0308309_10413329 | Not Available | 1158 | Open in IMG/M |
| 3300030056|Ga0302181_10408371 | Not Available | 585 | Open in IMG/M |
| 3300030991|Ga0073994_11944898 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300030991|Ga0073994_12159621 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300031128|Ga0170823_11132258 | Not Available | 1318 | Open in IMG/M |
| 3300031170|Ga0307498_10106838 | Not Available | 871 | Open in IMG/M |
| 3300031718|Ga0307474_10189934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1561 | Open in IMG/M |
| 3300031718|Ga0307474_10356240 | Not Available | 1134 | Open in IMG/M |
| 3300031724|Ga0318500_10568602 | Not Available | 573 | Open in IMG/M |
| 3300031753|Ga0307477_10278967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1155 | Open in IMG/M |
| 3300031823|Ga0307478_10652878 | Not Available | 881 | Open in IMG/M |
| 3300031823|Ga0307478_11660439 | Not Available | 527 | Open in IMG/M |
| 3300031912|Ga0306921_12148184 | Not Available | 590 | Open in IMG/M |
| 3300031962|Ga0307479_10391919 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300032895|Ga0335074_10347789 | Not Available | 1651 | Open in IMG/M |
| 3300032898|Ga0335072_10355505 | Not Available | 1601 | Open in IMG/M |
| 3300033158|Ga0335077_12162643 | Not Available | 512 | Open in IMG/M |
| 3300033806|Ga0314865_194180 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 35.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.47% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.08% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.08% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.08% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.69% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.69% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.69% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_08336690 | 2170459005 | Grass Soil | VFSRSRPRKLDTEEELYDVALRALMRRAHSVQEMK |
| JGI25617J43924_102965361 | 3300002914 | Grasslands Soil | MFGRPRQLETEEELYEVAVRALMRRAHSVHEMKRKLERRS |
| JGIcombinedJ51221_101714522 | 3300003505 | Forest Soil | MFGKPRQVETETELYEAAVRALMRRAYSVYEMKQLLGRRTEDDNLLRTVM |
| Ga0062384_1003846552 | 3300004082 | Bog Forest Soil | VFSKPRELETESELYDVALRALMRRAHSVHEMEKILERRTGNELLVQVV |
| Ga0062387_1012589131 | 3300004091 | Bog Forest Soil | MFGTQRKLDSEGELNDVAVRALMRRGHSVNEMQKLLTRRCAN |
| Ga0070703_100724221 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MFGKPRQVETETELYDAAVRALMRRAYSVYEMKQMLGRRTEDDNLLQ |
| Ga0066686_110863192 | 3300005446 | Soil | MFGKPRQLETEEEMYELALRALTRRAHSVHEMKQKLERRSNNKLLV |
| Ga0066691_106508401 | 3300005586 | Soil | MFSRLRQLETEAELYDVAVRALMRRAHSIHEMKQKLERRSD |
| Ga0066691_109508891 | 3300005586 | Soil | MFGKPRQLETESELYDVAVRALMRRAHSVHEMKQKLERRSD |
| Ga0070762_105332182 | 3300005602 | Soil | MFGKPRQVETETELYESAVRALMRRAYSVYEMKQLLGRRTEDDKLL |
| Ga0070763_101620041 | 3300005610 | Soil | MLLLVFSKPRKLDTESELYDVALRALMRRPHSVHEIRKLL |
| Ga0075028_1009412552 | 3300006050 | Watersheds | MFGKPRQLETEAEIYDVAVRALMRRAHSVHEMKKKLE |
| Ga0075015_1008829912 | 3300006102 | Watersheds | MFGTQRKLDSEDELYEVAVRALMRRGHSVNEMQKLLARRGENEL |
| Ga0070765_1006141612 | 3300006176 | Soil | VFGKPRQFESEAELYDASIKILMRRAHSVHEMKKALAR |
| Ga0066658_108856571 | 3300006794 | Soil | MFGKPCQLETEAELYDVALRALMRRAHSVDEMKQKLERRSENRLRVQV |
| Ga0066665_105207063 | 3300006796 | Soil | MFGRARQLETVAELYDVAVRALMRRAHSVHEMKQKLERRSNNKLL |
| Ga0066660_100679201 | 3300006800 | Soil | MLEKAHQVETESELYEVAVRALMRRAHSVHEMKEKLER |
| Ga0075424_1006914711 | 3300006904 | Populus Rhizosphere | MFSRGRPRQLETEEELYDVALRALMRRAHSAQEMQKKLARYTRN |
| Ga0066710_1000420757 | 3300009012 | Grasslands Soil | MFGKPRQLETEEEMYELALRALTRRAHSVHEMKQKLER |
| Ga0099829_105548062 | 3300009038 | Vadose Zone Soil | MFSRPRQLETESELYDVAVRALMRRAHSVYEMRKKLERHSD |
| Ga0099829_105940353 | 3300009038 | Vadose Zone Soil | MFGKPRQVETETELYEVAVRALMRRAHYVREMKQKLARRSD |
| Ga0099829_116096982 | 3300009038 | Vadose Zone Soil | MFGKPRKLDTEAELYDVALRALMRRAHSVHEMKRKL |
| Ga0099830_117822002 | 3300009088 | Vadose Zone Soil | MFGKRPRQLETEAELYDVAVRALMRRAHSVHEMKQKLERRSD |
| Ga0099828_114328711 | 3300009089 | Vadose Zone Soil | MFGKPRQLETEEEMYQAAVRALMRRAHSVHEMKQKLERR |
| Ga0099827_104786694 | 3300009090 | Vadose Zone Soil | VFSKPREIETESELYEVAVRALMRRAHSVHEMKKKLE |
| Ga0099827_112047491 | 3300009090 | Vadose Zone Soil | MFGKARQRETEEEMYDVAVRALMRRAHSVHEMKQK |
| Ga0099792_104832732 | 3300009143 | Vadose Zone Soil | MFGKPRQLETEAELYDVAVRALMRRAHSVHEMKKKLE |
| Ga0126373_130904311 | 3300010048 | Tropical Forest Soil | MFAKPRQLETEAQVYDTALRILMRRAHSIHEMKQAL |
| Ga0134067_100927741 | 3300010321 | Grasslands Soil | MFGKPRQLETEAELYDIAVRALMRRAHSIHEMKQKLEHRSDNKLLVQV |
| Ga0134084_100760551 | 3300010322 | Grasslands Soil | MFSRLRQLETEAELYDVAVRALMRRAHSIHEMKQKLERRSDNKLLVQ |
| Ga0074044_105039641 | 3300010343 | Bog Forest Soil | MFGKPRQVETETELYEAAVRALMRRAYSVYEMKQL |
| Ga0126372_116634961 | 3300010360 | Tropical Forest Soil | MFSRSRPRQLETEQDLHDVALRALMRRAHSVQEMKKKLS |
| Ga0150983_139393222 | 3300011120 | Forest Soil | MFGKLRQVETESELYESAVRALMRRAYSAYEMKQLLGR |
| Ga0137389_105926462 | 3300012096 | Vadose Zone Soil | MFGRRPHQLETEAELYDVAVRALMRRAHSVYEMKQKLER |
| Ga0137389_118211812 | 3300012096 | Vadose Zone Soil | MFGKRREVETEAELYEVAVRALMRRAHSVHEMKQKLERRS |
| Ga0137388_104316921 | 3300012189 | Vadose Zone Soil | VFSKPREIETESELYEVAVRALMRRAHSVHEMKKKL |
| Ga0137388_109902151 | 3300012189 | Vadose Zone Soil | MFGKPRQLETEAELYDVAVRALMRRAHSVHEMKQKLDRRSDNKLLVQVVMVG* |
| Ga0137388_118565311 | 3300012189 | Vadose Zone Soil | MFGRPRQLETEEELYDVAVRALMRRAHSVHEMKKK |
| Ga0137364_103860562 | 3300012198 | Vadose Zone Soil | VIAKPQQIETEAELYDVAVRALMRRALSVHEMRQKLERRS |
| Ga0137382_101781121 | 3300012200 | Vadose Zone Soil | MFGKPCQLETEAELYDVALRALMRRAHSVHEMKQKLERRSDNKLLVQVVMAR |
| Ga0137382_111287231 | 3300012200 | Vadose Zone Soil | MFEKARQLETVAELYDVAVRALMRRAHSGHEMKQKLERRS |
| Ga0137363_112765401 | 3300012202 | Vadose Zone Soil | MFGKPGKLETEEEMYEVAVQALMRRAHSVHEIKQKLERRSDNK |
| Ga0137362_102333623 | 3300012205 | Vadose Zone Soil | MFGRRPHQLETEAELYDVAVRALMRRAHSIHEMKQKLERR |
| Ga0137387_105433471 | 3300012349 | Vadose Zone Soil | MFGKPRQLETEEEMYELALRALTRRAHSVHEMKQKLERRSNNKLLVQV |
| Ga0137387_112032461 | 3300012349 | Vadose Zone Soil | MFGKPRQVETESELYEVAVRALMRRAHSVHEMKKKL |
| Ga0137384_100444133 | 3300012357 | Vadose Zone Soil | VFSKPPQIETESELYEVAVRALMRRAHSVHEMKKKLECLF* |
| Ga0137360_102998981 | 3300012361 | Vadose Zone Soil | MFRKPRQLETEEELYEVAVRALMRRAHSVHEMKQKL |
| Ga0137360_104903161 | 3300012361 | Vadose Zone Soil | VFSKPPQLETEEELYDVAVRALMRRAHSVHEMKKKLERRSDNKLLVQLVMA |
| Ga0137360_109210811 | 3300012361 | Vadose Zone Soil | MFGRPRKLDTEEELYDVALRALMRRAHSVHEMKQK |
| Ga0137361_118989042 | 3300012362 | Vadose Zone Soil | VFSKPPQLETEEELYDVAVRALMRRAHSVHEMKKKLERR |
| Ga0137358_108859302 | 3300012582 | Vadose Zone Soil | MFGKLRQLETESELYDVAVRALMRRAHSVHEMKRKLERRSDDKLLVQLVMA |
| Ga0137396_102125613 | 3300012918 | Vadose Zone Soil | MFGKPRQLETEAELYDAALRVLLRRAHSVHEMKKK |
| Ga0137396_102301001 | 3300012918 | Vadose Zone Soil | MFGKTRKLETEAELYDVAVRALMRRPHSVHEMKQKLERRSDNKLLVQVVMA |
| Ga0137394_111381521 | 3300012922 | Vadose Zone Soil | MFGKPRQLETEAELYDVAVRALMRRAHSVHEMKRKLERRSDDK |
| Ga0137359_100677311 | 3300012923 | Vadose Zone Soil | MFGKPRQLETEAEMYDVAVRALMRRAHSVHEMKQKLERRSDNKLLVQVVMA |
| Ga0137413_108036181 | 3300012924 | Vadose Zone Soil | VFSRPRKLDTEQDLYDYALRILMRRAHSVHEMKTKLMRRAESEL |
| Ga0137419_105701692 | 3300012925 | Vadose Zone Soil | MFGKSRRLESEAELYDVAVRALMRRAHSVHEMKKKLERR |
| Ga0137419_109731421 | 3300012925 | Vadose Zone Soil | MFGKPRQLETEAEMYDVAVRALTRRAHSVHEMKQKLERR |
| Ga0137416_104978881 | 3300012927 | Vadose Zone Soil | MFGKTRKLETEAELYDVAVRALMRRPHSVHEMKQKLER |
| Ga0137407_113473312 | 3300012930 | Vadose Zone Soil | MFGKPRQLETEAELYDVAVRALMRRAHSAHEMKKKLERRSDDKL |
| Ga0137410_100231201 | 3300012944 | Vadose Zone Soil | MFGKPRQLETEAEMYDVAVRALTRRAHSVHEMKQKLERRSDNKLLVQVVM |
| Ga0126369_125049542 | 3300012971 | Tropical Forest Soil | MFSRGRSRQLETEQELYEVALRALMRRAHSVEEMRRKLSRHTR |
| Ga0134077_100645891 | 3300012972 | Grasslands Soil | MFGKPRQLETEAELYDIAVRALMRRAHSIHEMKQKLEHRSD |
| Ga0120132_10891511 | 3300013832 | Permafrost | MFGKPRKLETEPELYETAVKALMRRAHSVHEMKKSLERRT |
| Ga0137420_10859593 | 3300015054 | Vadose Zone Soil | MFSKPRQLETEAELYDVAVRALMRRAHSVHEMKQK |
| Ga0137420_11815691 | 3300015054 | Vadose Zone Soil | MFGKPRRVETEAELYDVAVQALMRRAHSVHEMKQKAEIGAA |
| Ga0137420_12611432 | 3300015054 | Vadose Zone Soil | MFGKPRPLETGEELYEVAVRALMRRAHSVHEMKRKLERRSDNKLLVQ |
| Ga0137403_101830244 | 3300015264 | Vadose Zone Soil | VFSRSRPRKLDTEQELYDVALRALTRRAHSVQEMKQKLARRTDN |
| Ga0187802_102287202 | 3300017822 | Freshwater Sediment | MFGKPRQLDTEAELYDVALRALLRRAHSVHEMKKKLERRSENKLLVQVVMA |
| Ga0187801_103303872 | 3300017933 | Freshwater Sediment | VFKKPRQLETEAELYDAALRVLLRRAHSVHEMKKKLERRSDNKLLV |
| Ga0187817_103511021 | 3300017955 | Freshwater Sediment | MFGKPRQLETEAELYDAALRVLLRRAHSVHEMKKKLERRSDNKLLVQVVMARL |
| Ga0187782_107798483 | 3300017975 | Tropical Peatland | MFGNPRQIETEAELYDSAIRILMRRAHSVSEMKKAL |
| Ga0187766_105947851 | 3300018058 | Tropical Peatland | MFSRPHLIETEAELYAAATRMLTRRAHSVHEMKKALAHRTD |
| Ga0066667_100682484 | 3300018433 | Grasslands Soil | MFSRLRQLETEAELYDVAVRALMRRAHSIHEMKQKLERRSDNKLLVQV |
| Ga0179592_102528831 | 3300020199 | Vadose Zone Soil | MFGKPRQLETEAEMYDVAVRALTRRAHSVHEMKQKLERRSDNKLLVQV |
| Ga0179592_105031141 | 3300020199 | Vadose Zone Soil | MFGKPRQLETESELYEVAVRALMRRAHSVHEMKKVLARRTGNDLLVQVVMA |
| Ga0210407_100204544 | 3300020579 | Soil | MFGKPRQLETEEELYEVAVRALMRRAHSVHEMKKKLD |
| Ga0210403_102654191 | 3300020580 | Soil | METEAELYDVALRALMRRAHSVQEMKRKLERRSENKLLVQ |
| Ga0210403_110244511 | 3300020580 | Soil | MFSKRRQIETEAELYDVALRALMRRAHSVHEMKQKLERRS |
| Ga0210399_107097092 | 3300020581 | Soil | MLGRMFGKPRQLETEAAVYDAAIKILMRRAHSVHEMKKA |
| Ga0210401_102886943 | 3300020583 | Soil | MFRKPRQLETEAELYDVALHALMRRAHSVQEMKRKLERRTNNKLLIQVVMARL |
| Ga0210401_112427722 | 3300020583 | Soil | MLPIVFSKPRRLDTESELYDVALRALMRRPHSVNEMQKLL |
| Ga0210406_104361243 | 3300021168 | Soil | MFGKPRQLESEAELYEVAVRALMRRAHSVHEMKKVLARRTGNELLVQVVMA |
| Ga0210400_100798353 | 3300021170 | Soil | MFGKPRRVETESELYEAALRALMRRAYSAYEMKQILGRRTEDDHLLGTV |
| Ga0210400_105542872 | 3300021170 | Soil | MFGKARQLETEAELYDVAVRALMRRAHSVHEMKQKLERRSNNKLLVQV |
| Ga0210405_114363512 | 3300021171 | Soil | MFGKPRQVETETELYEAAVRALMRRAYSVYEMKQLLGRRTE |
| Ga0210408_109171281 | 3300021178 | Soil | MFGKPRQLETEAEMYDVAVRALMRRAHSVHEMKQKLERRSHNKLLVQVVMAR |
| Ga0210408_112905871 | 3300021178 | Soil | MFSRPRQLETEAEMYDVAVRALMHRAHSVHEMKRKLER |
| Ga0210396_102464871 | 3300021180 | Soil | MFGKPRQLETESQLYEAAIKTLMRRAHSVHEMKKAL |
| Ga0210388_107030621 | 3300021181 | Soil | MFGKPRQVETETELYEAAVRALMRRAYSVYEMKQLLGRRTEDDKLLRTV |
| Ga0210385_114666011 | 3300021402 | Soil | MFGKPRQVETETELYEAAVRALMRRAYSVYEMKQLLGRSTEDDKL |
| Ga0210397_115943822 | 3300021403 | Soil | MFGKPRQLETESELYEVAVRALMRRAHSVHEMKKIL |
| Ga0210389_100305125 | 3300021404 | Soil | MFGKPRQLETEAQVYDAAIKVLMRRAHSVHEMKKA |
| Ga0210384_104588591 | 3300021432 | Soil | MFRKPRSLDTEAELYEVALRALTRRAHSVQEMKQKLGRRSDNKLLVQVVMARLKE |
| Ga0210384_107486971 | 3300021432 | Soil | VFPRSKKLDTESELYDVALRALMRRPHSVHEMQKLLKRR |
| Ga0210390_114522132 | 3300021474 | Soil | MFGKPRQVETETELYEAAVRALMRRAYSVYEMTPLLGRRTADDKL |
| Ga0210398_100910991 | 3300021477 | Soil | MFGKRRRVETESELYEAAVRALMRRAYSAYEMKQLLGRRTEDDHLLG |
| Ga0210402_102381611 | 3300021478 | Soil | MFGKPRQIETETELYEAAVRALMRRAYSVYEMKQLLGRRTED |
| Ga0210409_116471371 | 3300021559 | Soil | VFSKPRQVESETELYDAAVRALMRRAYSVYEMKQLLGRRTEDDKLLR |
| Ga0126371_110525411 | 3300021560 | Tropical Forest Soil | MFGKPRQLETEAELYDSAIKILMRRAHSVSEMKKA |
| Ga0137417_11853171 | 3300024330 | Vadose Zone Soil | MFGKPRQLETEAELYDVAVRALMRRAHSVHEMKQKLDR |
| Ga0137417_13479481 | 3300024330 | Vadose Zone Soil | MFGRPRQLDTESELYDVAVRALMRRAHSVHEMKQKL |
| Ga0247668_10433291 | 3300024331 | Soil | MLTLMFGKPRQVETETELYDAAVRALMRRAYSVYEMK |
| Ga0209438_10376051 | 3300026285 | Grasslands Soil | MFGKPRQLETEAAVYDAAIRILMRRAHSVHEMKKALGRR |
| Ga0209235_11266133 | 3300026296 | Grasslands Soil | MFGKPRQLETEEEMYEVALRALTRRAHSVHEMKQKLERRSNNKLLVQGAIKGKWHDR |
| Ga0209027_11476622 | 3300026300 | Grasslands Soil | VFAKAQQVETEAELYDVAVRALMRRALSVHEMRQKLERR |
| Ga0209239_12340711 | 3300026310 | Grasslands Soil | MFSRLRQLETEAELYDVAVRALMRRAHSIHEMKQKLERRSDNKLLVQVV |
| Ga0209239_13109741 | 3300026310 | Grasslands Soil | VFAKPQQVATEAELYDVAVRALMRRALSVHEMTQKLERRSDNKLLVQVVMAR |
| Ga0209268_11907701 | 3300026314 | Soil | MFGKPRQLETEAELYDVAVRALMRRAHSIHEMKQK |
| Ga0209157_11840801 | 3300026537 | Soil | MFGKPRQLETEEEMYELALRALTRRAHSVHEMKQKLERRSNNKLLVQVV |
| Ga0209474_105757111 | 3300026550 | Soil | VFAKAQQVETEAELYDVAVRALMRRALSVHEMTQKLERRSDNKLLVQVVMARLKENGM |
| Ga0209577_105221011 | 3300026552 | Soil | MFGKPRQLETEAELYDIAVRALMRRAHSIHEMKQKLEHR |
| Ga0179587_101111791 | 3300026557 | Vadose Zone Soil | VFSRSRPRKLDTEQELYDVALRALTRRAHSVQEMKQK |
| Ga0179587_108591212 | 3300026557 | Vadose Zone Soil | MFSRLRQLETEEELYDVAVRALMRRGHSVHEMKRKLERRSENKLLVQVV |
| Ga0179587_111288941 | 3300026557 | Vadose Zone Soil | MFGRPRKLDTESELYEVAVRALMRRAHSVSEMKKLLTRR |
| Ga0209117_10810891 | 3300027645 | Forest Soil | MFGKPRQLETEAELYDVAVRALMRRAHSVHEMKQKLER |
| Ga0209388_10733671 | 3300027655 | Vadose Zone Soil | MFGKPRRVETEAELYDVAVQALMRRAHSVHEMKQKLERRSDNK |
| Ga0209626_10208332 | 3300027684 | Forest Soil | MFRAPRKLDSEPELYEIAVRALMRRAHSVHEMKRSLERRT |
| Ga0209248_102441181 | 3300027729 | Bog Forest Soil | MFHRPRQLDTESELYDVALRALMRRAHSIHEMKQKLDRRTNNK |
| Ga0209177_102733251 | 3300027775 | Agricultural Soil | MFSKPRQAESETELYDAAVRALMRRAYSVYEMKQLLGRRTDD |
| Ga0209139_1000077913 | 3300027795 | Bog Forest Soil | MFSKPRQVETELYEAAVRALMRRAYSVYEMKQLLGRRTEDDKHL |
| Ga0209180_104875581 | 3300027846 | Vadose Zone Soil | MFGKPRQLETEEELYEVAVRALMRRAHSVHEMKQKLERR |
| Ga0209701_103336191 | 3300027862 | Vadose Zone Soil | MFSRSRQLETEAELYDVAVRALMRRAHSVQEMKKKLERRSENK |
| Ga0209068_108649521 | 3300027894 | Watersheds | MFGKPRQLETEAEMYDVAVRALMRRAHSVHEMKQKLE |
| Ga0209006_108498772 | 3300027908 | Forest Soil | MFGKPRKLDTESELYEVAVRALMRRAHSVNEMKKLL |
| Ga0137415_113853662 | 3300028536 | Vadose Zone Soil | MFRKQRQLETEAELYDVAVRALMRRAHSVHEMKKEL |
| Ga0308309_104133291 | 3300028906 | Soil | MFGKPRQLESETELYEAAVRALMRRAYSVYEMKQLL |
| Ga0302181_104083711 | 3300030056 | Palsa | VFPKPRKLDTESDLYEAALRALARRPHSVSEMKKLVER |
| Ga0073994_119448982 | 3300030991 | Soil | MFRAPRKLDSEPELYETAVRALMRRAHSVHEMKKSLERRTDDKSMVKS |
| Ga0073994_121596211 | 3300030991 | Soil | MFSRSRPRKLDTEEELYDVALRALMRRAHSVHEMK |
| Ga0170823_111322583 | 3300031128 | Forest Soil | VFSRARPRKLDTEDELYDVALRALTRRAHSVHEMKQKHA |
| Ga0307498_101068383 | 3300031170 | Soil | MFSRNRPRKLDTEKELYDVALHALMQRAHSAHEMKQKLARRTDNDL |
| Ga0307474_101899343 | 3300031718 | Hardwood Forest Soil | MFSKPRQLDSETELYEAAVRALMRRAYSVYEMKQLLGRRTEDDNLLRT |
| Ga0307474_103562401 | 3300031718 | Hardwood Forest Soil | VFPRSKKLDTESELYDVALRALMRRPHSVNEMQKL |
| Ga0318500_105686022 | 3300031724 | Soil | MFSRGRSRQLETEQELYEVALRALMRRAHSVEEMRRKLSRHT |
| Ga0307477_102789672 | 3300031753 | Hardwood Forest Soil | MFGKPRQLETEAELYDAALRVLLRRAHSVHEMKKKLERRSDNKLLVQL |
| Ga0307478_106528782 | 3300031823 | Hardwood Forest Soil | MYPAPRKLLGEEELYTAAVRALMRRSYSVHEMHAYL |
| Ga0307478_116604391 | 3300031823 | Hardwood Forest Soil | MFGKPRQVETETELYEAAVRALMRRAYSVYEMKQLLGRRTEDDKLLRTVID |
| Ga0306921_121481842 | 3300031912 | Soil | MFSRSRQRQIDNEGELYEVAVRALTRRAHSVEEMKRKLKRHTPNQ |
| Ga0307479_103919192 | 3300031962 | Hardwood Forest Soil | MFGRPRKLDTEAELYDVAVRALMRRAQSVHEMKRKLER |
| Ga0335074_103477891 | 3300032895 | Soil | MFGKPRQVESETELYEAAVRALMRRAYSVYEMKQMLGRRTDN |
| Ga0335072_103555053 | 3300032898 | Soil | MFGKPRQVESETELYEAAVRALMRRAYSVYEMKQML |
| Ga0335077_121626431 | 3300033158 | Soil | MFTRSRKLNNEQDLYDYALRILMRRAHSVHEMKKK |
| Ga0314865_194180_3_125 | 3300033806 | Peatland | MFGKPRQLETEALLYDAAIKALMRRAHSVHEMKKALARRCE |
| ⦗Top⦘ |