| Basic Information | |
|---|---|
| Family ID | F051276 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VAAVVFGPDRATRSARRRTGLVLGAGGVLGAAWMTGALA |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.44 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.36 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.250 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.556 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.139 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.30% β-sheet: 0.00% Coil/Unstructured: 59.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF01694 | Rhomboid | 17.36 |
| PF00368 | HMG-CoA_red | 5.56 |
| PF01872 | RibD_C | 4.17 |
| PF13193 | AMP-binding_C | 4.17 |
| PF00128 | Alpha-amylase | 2.78 |
| PF04264 | YceI | 2.08 |
| PF00436 | SSB | 2.08 |
| PF04075 | F420H2_quin_red | 1.39 |
| PF01425 | Amidase | 1.39 |
| PF00857 | Isochorismatase | 0.69 |
| PF12911 | OppC_N | 0.69 |
| PF04012 | PspA_IM30 | 0.69 |
| PF00408 | PGM_PMM_IV | 0.69 |
| PF13361 | UvrD_C | 0.69 |
| PF11941 | DUF3459 | 0.69 |
| PF00113 | Enolase_C | 0.69 |
| PF04069 | OpuAC | 0.69 |
| PF02880 | PGM_PMM_III | 0.69 |
| PF09084 | NMT1 | 0.69 |
| PF02775 | TPP_enzyme_C | 0.69 |
| PF00501 | AMP-binding | 0.69 |
| PF13191 | AAA_16 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 17.36 |
| COG1257 | Hydroxymethylglutaryl-CoA reductase | Lipid transport and metabolism [I] | 5.56 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 4.17 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 4.17 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 2.78 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 2.78 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 2.78 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 2.78 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 2.08 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 2.08 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 2.08 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 1.39 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.39 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 1.39 |
| COG1842 | Phage shock protein A | Transcription [K] | 1.39 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.69 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.69 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.69 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.69 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.89 % |
| Unclassified | root | N/A | 36.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003505|JGIcombinedJ51221_10141263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 970 | Open in IMG/M |
| 3300005180|Ga0066685_10816875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| 3300005181|Ga0066678_10824138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
| 3300005436|Ga0070713_102115419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
| 3300005437|Ga0070710_10039879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2585 | Open in IMG/M |
| 3300005529|Ga0070741_10442016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1187 | Open in IMG/M |
| 3300005541|Ga0070733_10286189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1088 | Open in IMG/M |
| 3300005564|Ga0070664_100665243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 968 | Open in IMG/M |
| 3300005602|Ga0070762_10805719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 636 | Open in IMG/M |
| 3300006028|Ga0070717_11889976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 539 | Open in IMG/M |
| 3300006050|Ga0075028_100992012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
| 3300006057|Ga0075026_100473300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 717 | Open in IMG/M |
| 3300006176|Ga0070765_102222686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300006574|Ga0074056_11674293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 806 | Open in IMG/M |
| 3300006797|Ga0066659_10941639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 722 | Open in IMG/M |
| 3300006806|Ga0079220_11904166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300006954|Ga0079219_10835323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
| 3300009520|Ga0116214_1382655 | Not Available | 548 | Open in IMG/M |
| 3300009522|Ga0116218_1303963 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300009525|Ga0116220_10169766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 940 | Open in IMG/M |
| 3300010361|Ga0126378_12828267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 554 | Open in IMG/M |
| 3300010376|Ga0126381_104293148 | Not Available | 552 | Open in IMG/M |
| 3300010880|Ga0126350_12368491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 639 | Open in IMG/M |
| 3300011085|Ga0138581_1087536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1790 | Open in IMG/M |
| 3300012357|Ga0137384_10425706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Prauserella → Prauserella shujinwangii | 1094 | Open in IMG/M |
| 3300012362|Ga0137361_10458147 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 1171 | Open in IMG/M |
| 3300013307|Ga0157372_11862071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Prauserella → Prauserella shujinwangii | 692 | Open in IMG/M |
| 3300016294|Ga0182041_12045549 | Not Available | 534 | Open in IMG/M |
| 3300016341|Ga0182035_12008766 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300016422|Ga0182039_11034037 | Not Available | 738 | Open in IMG/M |
| 3300017821|Ga0187812_1247112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300017823|Ga0187818_10031205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2286 | Open in IMG/M |
| 3300017928|Ga0187806_1088459 | Not Available | 979 | Open in IMG/M |
| 3300017928|Ga0187806_1251115 | Not Available | 612 | Open in IMG/M |
| 3300017932|Ga0187814_10086931 | Not Available | 1149 | Open in IMG/M |
| 3300017932|Ga0187814_10257212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
| 3300017932|Ga0187814_10303469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
| 3300017932|Ga0187814_10383569 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300017932|Ga0187814_10404570 | Not Available | 532 | Open in IMG/M |
| 3300017942|Ga0187808_10003457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5824 | Open in IMG/M |
| 3300017955|Ga0187817_10546090 | Not Available | 739 | Open in IMG/M |
| 3300017972|Ga0187781_10314857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1111 | Open in IMG/M |
| 3300017972|Ga0187781_11174566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| 3300017973|Ga0187780_11162928 | Not Available | 565 | Open in IMG/M |
| 3300018001|Ga0187815_10071709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1456 | Open in IMG/M |
| 3300018001|Ga0187815_10197847 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 851 | Open in IMG/M |
| 3300018001|Ga0187815_10360148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
| 3300018007|Ga0187805_10322921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
| 3300018007|Ga0187805_10485318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300018085|Ga0187772_11109389 | Not Available | 580 | Open in IMG/M |
| 3300018090|Ga0187770_10108194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2083 | Open in IMG/M |
| 3300018090|Ga0187770_10251867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1368 | Open in IMG/M |
| 3300020582|Ga0210395_10055131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2912 | Open in IMG/M |
| 3300020583|Ga0210401_10085403 | All Organisms → cellular organisms → Bacteria | 2970 | Open in IMG/M |
| 3300021403|Ga0210397_10650496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 808 | Open in IMG/M |
| 3300021404|Ga0210389_10262905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1350 | Open in IMG/M |
| 3300021405|Ga0210387_11335888 | Not Available | 618 | Open in IMG/M |
| 3300021407|Ga0210383_10574305 | Not Available | 972 | Open in IMG/M |
| 3300021407|Ga0210383_11663966 | Not Available | 523 | Open in IMG/M |
| 3300021474|Ga0210390_11162618 | Not Available | 624 | Open in IMG/M |
| 3300024225|Ga0224572_1041618 | Not Available | 864 | Open in IMG/M |
| 3300025906|Ga0207699_10334261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1066 | Open in IMG/M |
| 3300025945|Ga0207679_11843151 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300026078|Ga0207702_10760584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 957 | Open in IMG/M |
| 3300026318|Ga0209471_1148206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Prauserella → Prauserella shujinwangii | 972 | Open in IMG/M |
| 3300027047|Ga0208730_1011118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 968 | Open in IMG/M |
| 3300027297|Ga0208241_1010605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1292 | Open in IMG/M |
| 3300027505|Ga0209218_1060011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 774 | Open in IMG/M |
| 3300027568|Ga0208042_1005079 | Not Available | 3720 | Open in IMG/M |
| 3300027767|Ga0209655_10261374 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda | 563 | Open in IMG/M |
| 3300027775|Ga0209177_10460954 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300027826|Ga0209060_10062089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1782 | Open in IMG/M |
| 3300027867|Ga0209167_10118916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1366 | Open in IMG/M |
| 3300027894|Ga0209068_10670057 | Not Available | 607 | Open in IMG/M |
| 3300027895|Ga0209624_10577027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 747 | Open in IMG/M |
| 3300027908|Ga0209006_11485343 | Not Available | 514 | Open in IMG/M |
| 3300027911|Ga0209698_11432166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → unclassified Mycolicibacterium → Mycolicibacterium sp. CBMA 361 | 502 | Open in IMG/M |
| 3300028047|Ga0209526_10360738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Prauserella → Prauserella shujinwangii | 972 | Open in IMG/M |
| 3300028047|Ga0209526_10823070 | Not Available | 573 | Open in IMG/M |
| 3300028720|Ga0307317_10157898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 762 | Open in IMG/M |
| 3300028801|Ga0302226_10365057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
| 3300028877|Ga0302235_10006020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8001 | Open in IMG/M |
| 3300028906|Ga0308309_10208932 | Not Available | 1613 | Open in IMG/M |
| 3300028906|Ga0308309_11242722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 641 | Open in IMG/M |
| 3300029882|Ga0311368_10578818 | Not Available | 794 | Open in IMG/M |
| 3300029882|Ga0311368_10683411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 712 | Open in IMG/M |
| 3300029910|Ga0311369_10885062 | Not Available | 714 | Open in IMG/M |
| 3300029993|Ga0302304_10211708 | Not Available | 718 | Open in IMG/M |
| 3300029997|Ga0302302_1223764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 701 | Open in IMG/M |
| 3300030007|Ga0311338_10594703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1139 | Open in IMG/M |
| 3300030053|Ga0302177_10593127 | Not Available | 566 | Open in IMG/M |
| 3300030494|Ga0310037_10066448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces olivochromogenes | 1700 | Open in IMG/M |
| 3300030509|Ga0302183_10037941 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300030520|Ga0311372_10141886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4192 | Open in IMG/M |
| 3300030707|Ga0310038_10176713 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300031236|Ga0302324_102375185 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031544|Ga0318534_10524495 | Not Available | 676 | Open in IMG/M |
| 3300031546|Ga0318538_10668208 | Not Available | 564 | Open in IMG/M |
| 3300031682|Ga0318560_10329672 | Not Available | 824 | Open in IMG/M |
| 3300031713|Ga0318496_10193648 | Not Available | 1116 | Open in IMG/M |
| 3300031720|Ga0307469_10548649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1023 | Open in IMG/M |
| 3300031747|Ga0318502_10102994 | Not Available | 1585 | Open in IMG/M |
| 3300031747|Ga0318502_10129955 | Not Available | 1422 | Open in IMG/M |
| 3300031748|Ga0318492_10403795 | Not Available | 719 | Open in IMG/M |
| 3300031751|Ga0318494_10734084 | Not Available | 578 | Open in IMG/M |
| 3300031764|Ga0318535_10224979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 840 | Open in IMG/M |
| 3300031764|Ga0318535_10558186 | Not Available | 508 | Open in IMG/M |
| 3300031765|Ga0318554_10300455 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300031768|Ga0318509_10253433 | Not Available | 983 | Open in IMG/M |
| 3300031769|Ga0318526_10438080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 534 | Open in IMG/M |
| 3300031779|Ga0318566_10435027 | Not Available | 644 | Open in IMG/M |
| 3300031779|Ga0318566_10469043 | Not Available | 618 | Open in IMG/M |
| 3300031782|Ga0318552_10705889 | Not Available | 514 | Open in IMG/M |
| 3300031819|Ga0318568_10936752 | Not Available | 535 | Open in IMG/M |
| 3300031831|Ga0318564_10083469 | Not Available | 1413 | Open in IMG/M |
| 3300031846|Ga0318512_10130451 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300031860|Ga0318495_10124289 | Not Available | 1163 | Open in IMG/M |
| 3300031860|Ga0318495_10310795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 701 | Open in IMG/M |
| 3300031910|Ga0306923_10677834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1150 | Open in IMG/M |
| 3300031941|Ga0310912_10837074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 710 | Open in IMG/M |
| 3300031945|Ga0310913_10127812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1740 | Open in IMG/M |
| 3300031954|Ga0306926_12357500 | Not Available | 588 | Open in IMG/M |
| 3300031962|Ga0307479_11191175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 726 | Open in IMG/M |
| 3300032001|Ga0306922_10884043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 929 | Open in IMG/M |
| 3300032001|Ga0306922_12229694 | Not Available | 527 | Open in IMG/M |
| 3300032009|Ga0318563_10448813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia cypriaca | 697 | Open in IMG/M |
| 3300032010|Ga0318569_10068812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1563 | Open in IMG/M |
| 3300032025|Ga0318507_10159344 | Not Available | 967 | Open in IMG/M |
| 3300032043|Ga0318556_10109971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1401 | Open in IMG/M |
| 3300032043|Ga0318556_10186549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1077 | Open in IMG/M |
| 3300032043|Ga0318556_10723938 | Not Available | 517 | Open in IMG/M |
| 3300032044|Ga0318558_10150366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1120 | Open in IMG/M |
| 3300032054|Ga0318570_10449294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
| 3300032068|Ga0318553_10134122 | Not Available | 1277 | Open in IMG/M |
| 3300032068|Ga0318553_10450181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 674 | Open in IMG/M |
| 3300032068|Ga0318553_10604866 | Not Available | 574 | Open in IMG/M |
| 3300032089|Ga0318525_10246888 | Not Available | 917 | Open in IMG/M |
| 3300032089|Ga0318525_10260551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 891 | Open in IMG/M |
| 3300032160|Ga0311301_10124834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4823 | Open in IMG/M |
| 3300032160|Ga0311301_12643469 | Not Available | 555 | Open in IMG/M |
| 3300032782|Ga0335082_10544858 | Not Available | 1022 | Open in IMG/M |
| 3300032897|Ga0335071_11489779 | Not Available | 621 | Open in IMG/M |
| 3300033134|Ga0335073_10036158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6732 | Open in IMG/M |
| 3300033290|Ga0318519_11000947 | Not Available | 519 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.25% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 11.11% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.33% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.17% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.08% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.39% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011085 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029997 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ51221_101412632 | 3300003505 | Forest Soil | VAAVVFGPDAARRGPRGPRGSRGRTALVLGAGGVLGAAWMTGALA |
| Ga0066685_108168752 | 3300005180 | Soil | VPAVVFGPDRVIGRGRPRTGLVLGAGGVLGAAWMTGALVRLHERLP |
| Ga0066678_108241381 | 3300005181 | Soil | VPAVVFGPDRVIGRGRPRTGLVLGAGGVLGAAWMTGALVRLH |
| Ga0070713_1021154192 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VPTVVFGPDRVIGRRRPRTALVLGAGGVLGAAWMTGALVRLHERLPAADVDL |
| Ga0070710_100398793 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VPAVVFAADRAVRSSHRKIGLVLGAGGVLGAAWMTGALVRLQELL |
| Ga0070741_104420163 | 3300005529 | Surface Soil | VSAVVFGDERPRRGSHPRTALVLGAGGVLGAAWMTG |
| Ga0070733_102861891 | 3300005541 | Surface Soil | VAAVAFGPDLERHRSRSRTGLILGAGGVLGAAWMTGALACLQDRL |
| Ga0070664_1006652431 | 3300005564 | Corn Rhizosphere | VPAVVFAPDRAVHRSHRTIGLVLGAGGVLGAAWMTGALVRLQERLPG |
| Ga0070762_108057192 | 3300005602 | Soil | VAAVVFGPGRADRGSSGRTALVLGAGGVLGAAWMTGALTCLHDRLPC |
| Ga0070717_118899762 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VPAVVFGPDRAVRRFRPRVGLVLGAGGVLGAAWMTGAL |
| Ga0075028_1009920122 | 3300006050 | Watersheds | VPAVVFGPDRVIGRGRPRTALVLGAGGVLGAAWMT |
| Ga0075026_1004733002 | 3300006057 | Watersheds | VPTVVFGPDRVIGHRRPRTALVLGAGGVLGAAWMTGA |
| Ga0070765_1022226861 | 3300006176 | Soil | VAAVVFGPDRVPHRSHRSSRTTALVLGAGGVLGAAWMTGALVRLGE |
| Ga0074056_116742931 | 3300006574 | Soil | LVAEANVPAVVFGPDRVIGHGRPRTALVLGAGGVLGAAWMTG |
| Ga0066659_109416392 | 3300006797 | Soil | VPTVVFGLDRVIGRRRPRTALVLGAGGVLGAAWMTGALVRLHERLPA |
| Ga0079220_119041661 | 3300006806 | Agricultural Soil | VPTVVFGPDRVTGRRRPRTALVLGAGGVLGAAWMTGALVRLHERLPAA |
| Ga0079219_108353231 | 3300006954 | Agricultural Soil | VPAVVFAPDRAVHRSQRTIGLVLGAGGVLGAAWMTGA |
| Ga0116214_13826552 | 3300009520 | Peatlands Soil | MVTEVVVGVVVFSPDRATRGSRRRTALVLGAGGVLGAAWMTGALACL |
| Ga0116218_13039631 | 3300009522 | Peatlands Soil | VVFDPDLAIRLSRPRIGLVLGAGGVLGAAWMTGAVARLQDRLP |
| Ga0116220_101697661 | 3300009525 | Peatlands Soil | MVTEVVVGVVVFSPDRATRGSRRRTALVLGAGGVLGAAWMTGALACLQDRLPCAAGDV |
| Ga0126378_128282671 | 3300010361 | Tropical Forest Soil | VVVAVVVFGPDRGRHQTRPRTGLVLGVGGVLGAAWMTGALAYLQDR |
| Ga0126381_1042931482 | 3300010376 | Tropical Forest Soil | VVFGPDRVIRRERSRVGLVLGAGGVLGAAWMTGALTCLQERFPV |
| Ga0126350_123684911 | 3300010880 | Boreal Forest Soil | MVAEVPVAAVVFGADRVPRPSRRSAGGTALVLGAGGVLGAAWMTGALARLAERLPGPVS |
| Ga0138581_10875361 | 3300011085 | Peatlands Soil | VVFGPDLAIRPSHPRIGLVLGVGGVLGAAWITGAMA |
| Ga0137384_104257063 | 3300012357 | Vadose Zone Soil | VPAVVFGPDRVIGRGRPRTALVLSAGGVLGAAWMTGALVRLHERL |
| Ga0137361_104581471 | 3300012362 | Vadose Zone Soil | VVFGPDRAILRSGPGNTANPANPRIGLVLGAGGVLGA |
| Ga0157372_118620711 | 3300013307 | Corn Rhizosphere | VVFGPDRVIGRRRPRTALVLGAGGVLGAAWMTGAL |
| Ga0182041_120455492 | 3300016294 | Soil | VIAEVAVAAVVFGPDRVGHGSSRRTALVLGAGGVLGAAWMTGALARLQDRLPCAAGDV |
| Ga0182035_120087662 | 3300016341 | Soil | MAAVVFGPDRAGRDSGCRTALVLGAGGVLGVAWMTGALACLQARLPGPAG |
| Ga0182039_110340372 | 3300016422 | Soil | VPAVVFGPDRVIRRERAKTGLVLGAGGVLGAAWMTGALACL |
| Ga0187812_12471121 | 3300017821 | Freshwater Sediment | VAAVAFGPGRGRHRSRPRTGLVLGAGGVLGAAWMTGALA |
| Ga0187818_100312051 | 3300017823 | Freshwater Sediment | VSAVVFGPDLAIRPSHPRIGLVLGAGGVLGAAWMTGALACLQ |
| Ga0187806_10884591 | 3300017928 | Freshwater Sediment | VAVVVFSPDRATHGSRRRTGLVLGAGGVLGAAWMTGALACL |
| Ga0187806_12511151 | 3300017928 | Freshwater Sediment | MVAEVAVAAVVFGPDRARHGSRRRTALVLGAGGVLGAAWMTGALAALADRLP |
| Ga0187814_100869312 | 3300017932 | Freshwater Sediment | MVTEVVVGVVVFSPDRATRGSRRRTALVLGAGGVLGA |
| Ga0187814_102572122 | 3300017932 | Freshwater Sediment | VAAVVFGADVAHRWPRRRTALVLGAGGVVGAAWMTGALASLADRLPCAP |
| Ga0187814_103034691 | 3300017932 | Freshwater Sediment | VAAVVFGPQRAERQLSPRIGLVLGAGGVLGAAWMTAALACLQDRLPV |
| Ga0187814_103835691 | 3300017932 | Freshwater Sediment | VSAVVFGPDLAIRPSRPRIGLVLGAGGVLGAAWMTGAL |
| Ga0187814_104045701 | 3300017932 | Freshwater Sediment | VAAVVFGPDRAGHGAHRRTALVLGAGGVLGAAWMTGALARLQDRLPCP |
| Ga0187808_100034577 | 3300017942 | Freshwater Sediment | VAVVVFNPDRAIHSSRRRTGLVLGAGGVLGAAWMTGALA |
| Ga0187817_105460901 | 3300017955 | Freshwater Sediment | MVTEVVVGVVVFSPDRATHSSRRRTALVLGAGGVLGAAWMTGALACLQDRLPCA |
| Ga0187781_103148573 | 3300017972 | Tropical Peatland | VAAVVFGPDRGRHLPRARTGLVLGAGGVLGAAWMTGAL |
| Ga0187781_111745661 | 3300017972 | Tropical Peatland | VAAVVFGPDRAGHGPGRRTALVLGAGGVLGAAWMTGAL |
| Ga0187780_111629281 | 3300017973 | Tropical Peatland | VAAVVFSPDRASRRSRRRTGLVLGAGGVLGAAWMTGALA |
| Ga0187815_100717093 | 3300018001 | Freshwater Sediment | MVAEVAVAAVVFGPDRARHGSRRRTALVLGAGGVLG |
| Ga0187815_101978471 | 3300018001 | Freshwater Sediment | VAVVVFNPDRAIHSSRRRTGLVLGAGGVLGAAWMTGALACLQDRLPCAAGDV |
| Ga0187815_103601482 | 3300018001 | Freshwater Sediment | VAAVVFGADVAHHWSRRRTALVLGAGGVVGAAWMTGALAS |
| Ga0187805_103229211 | 3300018007 | Freshwater Sediment | VSAVVFGPDLAIRPSRPRIGLVLGAGGVLGAAWMTGALACLQDR |
| Ga0187805_104853182 | 3300018007 | Freshwater Sediment | VAAVVFGADVAHHWSRRRTALVLGAGGVVGAAWMTGALASLADRLPCA |
| Ga0187772_111093891 | 3300018085 | Tropical Peatland | VAAVVFSPDRASRRSRRRTGLVLGAGGLLGAAWMT |
| Ga0187770_101081941 | 3300018090 | Tropical Peatland | VAAVVFGLDRADHGAHRRTALVLGAGGVLGAAWMTGALARLQDRLP |
| Ga0187770_102518671 | 3300018090 | Tropical Peatland | VAAVVFGPDRARHGFRHGASGPMALVLGAGGVLGAAWMTGALAC |
| Ga0210395_100551311 | 3300020582 | Soil | MVAEVAVAAVVFGPDRVPGRSHRSSRTTALVLGAGGGL |
| Ga0210401_100854031 | 3300020583 | Soil | MVAEVAVAAVVFGPDRAPRRSRRSSGTTALVLGAGGVLGAAWMTGALVRLAERLPGPVSDVD |
| Ga0210397_106504962 | 3300021403 | Soil | MVAEVAVAAVVFGPDRARPGSGGSSRRTALVLGAGGVLGAA |
| Ga0210389_102629051 | 3300021404 | Soil | MVAEVAVAAVVFGPDRARRGGTGLVLGAGGVLGAAWMTGALAGLSDRLPCAAADV |
| Ga0210387_113358881 | 3300021405 | Soil | MRGWVAEADVSAVVFGPDQAIRHSNPRIGLVLGAGGVLGAAW |
| Ga0210383_105743051 | 3300021407 | Soil | VSAVVFGPDLPARRFHPSPRIGLVLGAGGVLGAPWMTGALARLQDRLPGT |
| Ga0210383_116639661 | 3300021407 | Soil | VAAVVFGPEWTGHGFRRRTGLVLGAGGVLGAAWMTGALA |
| Ga0210390_111626181 | 3300021474 | Soil | VSAVVFGPDLPARRFHPSPRIGLVLGAGGVLGAAWMTGALARLQDRLPGTAA |
| Ga0224572_10416181 | 3300024225 | Rhizosphere | VSAVVFGPDLPARRSHPSPRIGLVFGAGGVLGAAWMTGALARLQDRLPGTAADV |
| Ga0207699_103342611 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VPAVVFAPDRARRSPRPRVALVLGAGGVLGAAWMTGALVRLQELL |
| Ga0207679_118431511 | 3300025945 | Corn Rhizosphere | VPAVVFAADRAARSSHRKIGLVLGAGGVLGAAWMTGALVRLQERLPGPAA |
| Ga0207702_107605842 | 3300026078 | Corn Rhizosphere | VPAVVFAPDRAVHRSHRTIGLVLGAGGVLGAAWMTGALVRLQERLPGPV |
| Ga0209471_11482061 | 3300026318 | Soil | VPTVVFGLDRVIGRRRPRTALVLGAGGVLGAAWMTGALVRLHER |
| Ga0208730_10111181 | 3300027047 | Forest Soil | MVAEVAVAAVVFGPDRARRGRTGLVLGAGGVLGAAWMTGALAGLSDRL |
| Ga0208241_10106053 | 3300027297 | Forest Soil | MVAEVSVAAVVFGPDRARRGGTGLVLGAGGVLGAAWMTGVLAG |
| Ga0209218_10600112 | 3300027505 | Forest Soil | MVAEVPVAAVVFGPDRTRHRSAGRTALVLGAGGVLGAAWMTGTLARL |
| Ga0208042_10050791 | 3300027568 | Peatlands Soil | VAAVVFGADVAHRWSRRRTALVLGAGGVVGAAWMTGALASLADRLPCALGDVD |
| Ga0209655_102613742 | 3300027767 | Bog Forest Soil | MVAEVPVAAVVFGSDRTRHRSAGRTALVLGAGGVLGAA |
| Ga0209177_104609542 | 3300027775 | Agricultural Soil | VPAVVFAADRAARSSHRKIGLVLGAGGVLGAAWMT |
| Ga0209060_100620893 | 3300027826 | Surface Soil | MVAEVAVAAVVFGPDRVHSRGPVALVLGAGGVLGAAWMT |
| Ga0209167_101189161 | 3300027867 | Surface Soil | LAAVVFGPDRAGHGSGRRTGLVLGAGGVLGAAWMTGAL |
| Ga0209068_106700572 | 3300027894 | Watersheds | VSAVVFGPDRAIRHHLNPRIGLVLGAGGVLGAAWM |
| Ga0209624_105770271 | 3300027895 | Forest Soil | MVAEVPVAAVVFGPDRTRHRSAGRTALVLGAGGVLGAAWMTGAL |
| Ga0209006_114853431 | 3300027908 | Forest Soil | MVAEVPVAAVVFGPDRTRHRSAGRTALVLGAGGVLGAAWMT |
| Ga0209698_114321661 | 3300027911 | Watersheds | VSAVVFGPDQVLRRSNPGNPRIGLVLGAGGVLGAAWTTGA |
| Ga0209526_103607381 | 3300028047 | Forest Soil | VPTVVFGPDRVIGRRRPRTALVLGAGGVLGAAWMTGALVRLHERLPAAD |
| Ga0209526_108230702 | 3300028047 | Forest Soil | MVAEVPVAAVVFGPDRRRHRSAGRTALVLGAGGVLGAAWMTGAL |
| Ga0307317_101578982 | 3300028720 | Soil | VPAVVFGPDRVIGRGRPRTALVLGAGGVLGAAWMTGALVRLHER |
| Ga0302226_103650572 | 3300028801 | Palsa | MAVAAVVFSPDRATRSSRRRTGLVLGAGGLLGAAWMTGALACLQG |
| Ga0302235_100060201 | 3300028877 | Palsa | MAVAAVVFSPDRAIHSSRRRTGLVLGAGGLLGAAWMTGALACLQ |
| Ga0308309_102089321 | 3300028906 | Soil | VSAVVFGPDPAKRLSRPAGPHPRIGLVLGAGGVLGAAWMTG |
| Ga0308309_112427222 | 3300028906 | Soil | MVAEVAVAAVVFGPDRVPRSSRRSAGGTALVLGAGGVLGAAWMTGALARLAE |
| Ga0311368_105788182 | 3300029882 | Palsa | MAVAAVVFSPDRATRSSRRRTGLVLGAGGLLGAAWMTGALACL |
| Ga0311368_106834112 | 3300029882 | Palsa | MVAEVAVAAVVFGPDRARHRSRRIALVLGAGGVLGAAWMTGALA |
| Ga0311369_108850622 | 3300029910 | Palsa | VAAVVFSPGRATHSSRRRTGLVLGAGGLLGAAWMTGALACLQDRLPC |
| Ga0302304_102117082 | 3300029993 | Palsa | VAAVVFSPGRATHSSRRRTGLVLGAGGLLGAAWMTGALACLQGRLPCA |
| Ga0302302_12237641 | 3300029997 | Palsa | MVAEVAVAAVVFGPDRARHRSRRIALVLGAGGVLGAAWMT |
| Ga0311338_105947031 | 3300030007 | Palsa | MAVAAVVFSPDRGTHSSRRRTGLVLGAGGLLGAAWMTGALACLQ |
| Ga0302177_105931271 | 3300030053 | Palsa | VAAVVFSPGRATHSSRRRTGLVLGAGGLLGAAWMTGAL |
| Ga0310037_100664484 | 3300030494 | Peatlands Soil | MVTEVVVGVVVFSPDRATRGSRRRTALVLGAGGVLGAAWMTG |
| Ga0302183_100379414 | 3300030509 | Palsa | VAAVVFSPDRAIHSSRRRTGLVLGAGGLLGAAWMTGTLACLQG |
| Ga0311372_101418865 | 3300030520 | Palsa | VAAVVFSPDRATHTSRRRTGLVLGAGGLLGAAWMTGALACLQGRLPC |
| Ga0310038_101767131 | 3300030707 | Peatlands Soil | VSAVVFGPDLAIRPSHPRIGLVLGAGGVLGAAWITGALARLQDRLPEAAAD |
| Ga0302324_1023751851 | 3300031236 | Palsa | VAAVVFSPDRATRSSRRRTGLVLGAGGLLGAAWMTGALASLQGRLPCGA |
| Ga0318534_105244952 | 3300031544 | Soil | VPAVVFGPDRVIRHECAKIGLVLGAGGVLGAAWMT |
| Ga0318538_106682082 | 3300031546 | Soil | VPAVVFGPDRVIRRERPQVGLVLGAGGVLGAAWMTGALACLQERFPVADDE |
| Ga0318560_103296721 | 3300031682 | Soil | VPAVVFGPDRVIRHERSKVGLVLGAGGVLGAAWMTG |
| Ga0318496_101936481 | 3300031713 | Soil | VAVAAVVFGPDRATRSARRRTGLVLGAGGVLGAAWMTGALACL |
| Ga0307469_105486491 | 3300031720 | Hardwood Forest Soil | MVAEVAVAAVVFGPDRVPRRSHRSAGTTALVLGAGGVLGAAWMTGALARLSERLPGPLSDVDL |
| Ga0318502_101029942 | 3300031747 | Soil | VPAVVFGPDRVIRHERAKVGLVLGAGGVLGAAWMTGAL |
| Ga0318502_101299551 | 3300031747 | Soil | VPAVVFGPDRVIRHERSKVGLVLGAGGVLGAAWMTGALACLQERLPVAD |
| Ga0318492_104037952 | 3300031748 | Soil | VPAVVFGPDLAAQRSRVGLVLGAGGVLGAAWMTGALAHLADRLP |
| Ga0318494_107340842 | 3300031751 | Soil | VPAVIFGPDRVIRRERAKTGLVLGAGGVLGAAWMTGALACLDER |
| Ga0318535_102249792 | 3300031764 | Soil | MVAEVAVAAVVFGPDRAGRDSGRRTALVLGAGGVLGVA |
| Ga0318535_105581861 | 3300031764 | Soil | VPAVVFGPDRVIRHERAKVGLVLGAGGVLGAAWMT |
| Ga0318554_103004552 | 3300031765 | Soil | VAAVVFGPDRAGRDSGRRTALVLGAGGVLGVAWMTG |
| Ga0318509_102534332 | 3300031768 | Soil | VPAVVFGPDRVIGPGRHRVGLVLGAGGILGAAWMTGALVRL |
| Ga0318526_104380801 | 3300031769 | Soil | VPAVVFRPDRPTRAPHPRIGLVLGAGGVLGAAWMTGALA |
| Ga0318566_104350272 | 3300031779 | Soil | VPAVVFGPDRVIRRGRAKTGLVLGAGGVLGAAWMTGALACLH |
| Ga0318566_104690432 | 3300031779 | Soil | VIAEVAVAAVVFGPDRVGHGSSRRTALVLGAGGVLGAAWMTGALARLQDWLPCAAGDVD |
| Ga0318552_107058892 | 3300031782 | Soil | VPAVVFGPDRVIRHERAKVGLVLGAGGVLGAAWMTGALACLQERL |
| Ga0318568_109367521 | 3300031819 | Soil | MAAEVAVAAVVFGPDRARYGSRRRTALVLGAGGVLGAAWMTGALAALADRLPC |
| Ga0318564_100834691 | 3300031831 | Soil | VPAVVFGPDRVIRHERAKVGLVLGAGGVLGAAWMTGALAC |
| Ga0318512_101304512 | 3300031846 | Soil | MAAVVFGPDRAGRDSGCRTALVLGAGGVLGAAWMTGALACLQ |
| Ga0318495_101242891 | 3300031860 | Soil | VPAVVFGPDRVIRRERAKTGLVLGAGGVLGAAWMTGALACLHERFPVADAD |
| Ga0318495_103107951 | 3300031860 | Soil | MVAEVAVAAVVFGPDRARHGSRRRTGLVLGAGGVLGAAWMTGALASLADRLPCAAGRPGW |
| Ga0306923_106778342 | 3300031910 | Soil | VAAVVFGPDRVGHGSSRRTALVLGAGGVLGAAWMTGALARLQDWLPCAAGDVD |
| Ga0310912_108370742 | 3300031941 | Soil | MVAEVAVAAVVFGPDRARHSSGRRAGLVLGAGGVLGAAWMTGAL |
| Ga0310913_101278123 | 3300031945 | Soil | VAAVVFGPERARHSSRRRTGLVLGAGGVLGAAWMTGALASLADLLP |
| Ga0306926_123575002 | 3300031954 | Soil | MVAEVAVAAVVFGPDRARHSSRRAALVLGAGGVLGAA |
| Ga0307479_111911751 | 3300031962 | Hardwood Forest Soil | MVAEVAVAAVVFGPDRARPGSGGSSRRTALVLGAGGVLGAAWMTGAL |
| Ga0306922_108840431 | 3300032001 | Soil | MVAEVAVAAVVFGPDRARHGSRRRTGLVLGAGGVL |
| Ga0306922_122296941 | 3300032001 | Soil | VPAVVFGPDRVIRHERSKVGLVLGAGGVLGAAWMTGALACLQERLP |
| Ga0318563_104488132 | 3300032009 | Soil | VAAVVFGPDGTGRAGRGSRTALVLGAGGVLGASWMTGALASLQDRLP |
| Ga0318569_100688121 | 3300032010 | Soil | VAAVVFGPDRATRSARRRTGLVLGAGGVLGAAWMTGALA |
| Ga0318507_101593441 | 3300032025 | Soil | VAVAAVVFGPDRATRSARRRTGLVLGAGGVLGAAWMTGALAC |
| Ga0318556_101099713 | 3300032043 | Soil | VAAVVFGPERARHGSRRRTGLVLGAGGVLGAAWMTGALASLADRLPCAAGDV |
| Ga0318556_101865491 | 3300032043 | Soil | MVAEVAVAAVVFGPDRARHGSRRRTGLVLGAGGVLGAAWMTGALA |
| Ga0318556_107239381 | 3300032043 | Soil | VAAVVFGPERARHSSRRRTGLVLGAGGVLGAAWMTGALASLADLLPCAAS |
| Ga0318558_101503661 | 3300032044 | Soil | VAAVVFGPERARHSSRRRTGLVLGAGGVLGAAWMTGALA |
| Ga0318570_104492941 | 3300032054 | Soil | MVAEVAVAAVVFGPDRARHGSRRRTGLVLGAGGVLGAAWMTGALASLADRL |
| Ga0318553_101341221 | 3300032068 | Soil | VAAVVFGPDRATRSARRRTGLVLGAGGVLGAAWMTGALACLQDRLPSAAGDV |
| Ga0318553_104501812 | 3300032068 | Soil | MVAEVAVAAVVFGPDRARHGSRRRTGLVLGAGGVLGAAWM |
| Ga0318553_106048661 | 3300032068 | Soil | VPAVVFGPDRVIRHERAKVGLVLGAGGVLGAAWMTG |
| Ga0318525_102468881 | 3300032089 | Soil | VAVAAVVFGPDRATRSARRRTGLVLGAGGVLGAAWMTGALACLQDRLPCA |
| Ga0318525_102605511 | 3300032089 | Soil | MVAEVAVAAVVFGPDRARHGSRRRTGLVLGAGGVLGAAWMTGALAS |
| Ga0311301_101248341 | 3300032160 | Peatlands Soil | VAAVVFGPQRAGRQLSPRIGLVLGAGGVLGAAWMTGA |
| Ga0311301_126434692 | 3300032160 | Peatlands Soil | VAAVTFTPDRARRRSDHRTGLVLGAGGVLGAAWMTGALACLQNRLPH |
| Ga0335082_105448583 | 3300032782 | Soil | VGRIAEADVPAVVFGPDRAIHRSKPRVGLVLGAGGFLGAAWTTGA |
| Ga0335071_114897792 | 3300032897 | Soil | VPAVVFGPDRVIRRERAKVGLVLGAGGVLGAAWMTGALVRLQERLPVADA |
| Ga0335073_100361581 | 3300033134 | Soil | VPAVVFTPDRAVRPSRRKIGLVLGAGGVLGAAWMTGALVRLEERL |
| Ga0318519_110009472 | 3300033290 | Soil | VPAVVFGPDRVIGPGRHRVGLVLGAGGILGAAWMTGALVRLQERLPAADAD |
| ⦗Top⦘ |