NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F051261

Metagenome / Metatranscriptome Family F051261

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051261
Family Type Metagenome / Metatranscriptome
Number of Sequences 144
Average Sequence Length 51 residues
Representative Sequence YVNPGPARTPIIEFSETTIERAKKKAEGWKALCAKYRPLVEAERNKVKAAS
Number of Associated Samples 130
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.31 %
% of genes from short scaffolds (< 2000 bps) 93.75 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(12.500 % of family members)
Environment Ontology (ENVO) Unclassified
(25.694 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(36.806 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.30%    β-sheet: 0.00%    Coil/Unstructured: 55.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 144 Family Scaffolds
PF09084NMT1 4.17
PF00343Phosphorylase 0.69
PF01321Creatinase_N 0.69
PF04909Amidohydro_2 0.69
PF012572Fe-2S_thioredx 0.69
PF05036SPOR 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 144 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 4.17
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 4.17
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 0.69
COG0058Glucan phosphorylaseCarbohydrate transport and metabolism [G] 0.69
COG1905NADH:ubiquinone oxidoreductase 24 kD subunit (chain E)Energy production and conversion [C] 0.69

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2040502000|ACOD_GAKN62C01E5V9BAll Organisms → cellular organisms → Bacteria527Open in IMG/M
3300000559|F14TC_101496311All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium935Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10015635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes2085Open in IMG/M
3300000955|JGI1027J12803_103612326All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300000956|JGI10216J12902_107997080All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300001213|JGIcombinedJ13530_102195555All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300004061|Ga0055487_10001787All Organisms → cellular organisms → Bacteria2010Open in IMG/M
3300004070|Ga0055488_10187550All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300004077|Ga0055523_10178521All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300004114|Ga0062593_101241608All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300004156|Ga0062589_101592730All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300004643|Ga0062591_100606859All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300004778|Ga0062383_10647190All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300004779|Ga0062380_10378594All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300004781|Ga0062379_10187957All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300005166|Ga0066674_10069174All Organisms → cellular organisms → Bacteria1615Open in IMG/M
3300005172|Ga0066683_10254013All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300005177|Ga0066690_10499057All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300005332|Ga0066388_103291955All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium825Open in IMG/M
3300005332|Ga0066388_108637351All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300005345|Ga0070692_10747553All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300005439|Ga0070711_101419908All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300005456|Ga0070678_101618364All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300005467|Ga0070706_100242394All Organisms → cellular organisms → Bacteria1683Open in IMG/M
3300005468|Ga0070707_102193915All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300005536|Ga0070697_101212778All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium672Open in IMG/M
3300005563|Ga0068855_101703455All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300005614|Ga0068856_101564837All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300005713|Ga0066905_101223021All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300005713|Ga0066905_101592314All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300005842|Ga0068858_100718480All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300005937|Ga0081455_10041369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales4053Open in IMG/M
3300006194|Ga0075427_10017873All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1109Open in IMG/M
3300006237|Ga0097621_101398985All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300006576|Ga0074047_11500803All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300006796|Ga0066665_11693220All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300006800|Ga0066660_10040351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes2962Open in IMG/M
3300006845|Ga0075421_100570411All Organisms → cellular organisms → Bacteria1334Open in IMG/M
3300006852|Ga0075433_11112359All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300006854|Ga0075425_102237251All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium608Open in IMG/M
3300006871|Ga0075434_101831413All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300006904|Ga0075424_100335469All Organisms → cellular organisms → Bacteria1610Open in IMG/M
3300006904|Ga0075424_102367269All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium557Open in IMG/M
3300006969|Ga0075419_10999759All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300007076|Ga0075435_100284297All Organisms → cellular organisms → Bacteria1412Open in IMG/M
3300007076|Ga0075435_101483775All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium594Open in IMG/M
3300009036|Ga0105244_10525953All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300009100|Ga0075418_10844244All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300009100|Ga0075418_11412825All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300009147|Ga0114129_12169669All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300009148|Ga0105243_11886165All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300009156|Ga0111538_10481609All Organisms → cellular organisms → Bacteria1573Open in IMG/M
3300009162|Ga0075423_11285579All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium782Open in IMG/M
3300009162|Ga0075423_11399627All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium749Open in IMG/M
3300009162|Ga0075423_12083154All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300009162|Ga0075423_12150846All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300009167|Ga0113563_10913435All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300009545|Ga0105237_10491278All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300009678|Ga0105252_10475966All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300009792|Ga0126374_10880023All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium692Open in IMG/M
3300010045|Ga0126311_11619184All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300010046|Ga0126384_10851339All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300010047|Ga0126382_11240729All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium670Open in IMG/M
3300010358|Ga0126370_12045781All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300010360|Ga0126372_10951697All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium866Open in IMG/M
3300010376|Ga0126381_100307817All Organisms → cellular organisms → Bacteria2172Open in IMG/M
3300010398|Ga0126383_11361997All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium799Open in IMG/M
3300011429|Ga0137455_1123290All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300011444|Ga0137463_1016454All Organisms → cellular organisms → Bacteria2611Open in IMG/M
3300012171|Ga0137342_1010548All Organisms → cellular organisms → Bacteria1552Open in IMG/M
3300012173|Ga0137327_1017407All Organisms → cellular organisms → Bacteria1458Open in IMG/M
3300012174|Ga0137338_1035473All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300012202|Ga0137363_10392850All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1154Open in IMG/M
3300012509|Ga0157334_1052682All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300012948|Ga0126375_10487785All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium915Open in IMG/M
3300012948|Ga0126375_10922952All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300012957|Ga0164303_10003554All Organisms → cellular organisms → Bacteria4712Open in IMG/M
3300012958|Ga0164299_10201557All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300012971|Ga0126369_12312305All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium624Open in IMG/M
3300012984|Ga0164309_11196481All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300012985|Ga0164308_11528012All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300013297|Ga0157378_10376128All Organisms → cellular organisms → Bacteria1394Open in IMG/M
3300013297|Ga0157378_12890956All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300014295|Ga0075305_1121081All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300015245|Ga0137409_10591771All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium939Open in IMG/M
3300015371|Ga0132258_11922390All Organisms → cellular organisms → Bacteria1489Open in IMG/M
3300015372|Ga0132256_100278836All Organisms → cellular organisms → Bacteria1749Open in IMG/M
3300015373|Ga0132257_100302114All Organisms → cellular organisms → Bacteria1923Open in IMG/M
3300015373|Ga0132257_102430580All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300015374|Ga0132255_102779363All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300016319|Ga0182033_11921218All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300016341|Ga0182035_11438015All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300017944|Ga0187786_10137909All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300017966|Ga0187776_10532993All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300018074|Ga0184640_10258839All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300018078|Ga0184612_10082768All Organisms → cellular organisms → Bacteria1676Open in IMG/M
3300018079|Ga0184627_10661901All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300018084|Ga0184629_10602109All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300018422|Ga0190265_10560691All Organisms → cellular organisms → Bacteria1259Open in IMG/M
3300018466|Ga0190268_10474153All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria838Open in IMG/M
3300018466|Ga0190268_12233713All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300018469|Ga0190270_12858676All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300019356|Ga0173481_10329151All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300019881|Ga0193707_1109638All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300020004|Ga0193755_1041700All Organisms → cellular organisms → Bacteria1508Open in IMG/M
3300021560|Ga0126371_11073371All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300021859|Ga0210334_10286920All Organisms → cellular organisms → Bacteria628Open in IMG/M
(restricted) 3300024521|Ga0255056_10269888All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium763Open in IMG/M
3300025903|Ga0207680_10535773All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300025921|Ga0207652_10105237All Organisms → cellular organisms → Bacteria2497Open in IMG/M
3300025930|Ga0207701_10510520All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300025931|Ga0207644_10487703All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300025986|Ga0207658_10956733All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300026121|Ga0207683_11547149All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300026542|Ga0209805_1139137All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1130Open in IMG/M
3300026552|Ga0209577_10485062All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300027573|Ga0208454_1172766All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300027775|Ga0209177_10364310All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300028380|Ga0268265_10273526All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Tannerellaceae → Tannerella → unclassified Tannerella → Tannerella sp. oral taxon HOT-286 → Tannerella sp. oral taxon BU063 isolate Cell 6/7/91508Open in IMG/M
3300028814|Ga0307302_10460591All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium630Open in IMG/M
3300030620|Ga0302046_10222195All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300031229|Ga0299913_10859543All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300031538|Ga0310888_10463318All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300031547|Ga0310887_10528648All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300031720|Ga0307469_10825567All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium852Open in IMG/M
3300031820|Ga0307473_10049787All Organisms → cellular organisms → Bacteria1976Open in IMG/M
3300031879|Ga0306919_11509024All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300031908|Ga0310900_11259468All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300031910|Ga0306923_10296488All Organisms → cellular organisms → Bacteria1848Open in IMG/M
3300031947|Ga0310909_10616078All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300031962|Ga0307479_10531925All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300031965|Ga0326597_10485278All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300032005|Ga0307411_11133972All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300032122|Ga0310895_10729105All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300032180|Ga0307471_100019929All Organisms → cellular organisms → Bacteria4878Open in IMG/M
3300032205|Ga0307472_101156547All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300033004|Ga0335084_10636188All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300033289|Ga0310914_10982626All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300033407|Ga0214472_11373844All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300033407|Ga0214472_11520031All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300033414|Ga0316619_11997323All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300033487|Ga0316630_10130301All Organisms → cellular organisms → Bacteria1744Open in IMG/M
3300033487|Ga0316630_10777018All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300033815|Ga0364946_061283All Organisms → cellular organisms → Bacteria793Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere12.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.42%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.25%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil4.86%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.47%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.47%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.78%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment2.08%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil2.08%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.08%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.39%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.39%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.39%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.39%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.39%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.39%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.69%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.69%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.69%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.69%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.69%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.69%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.69%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.69%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.69%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.69%
Fungus GardenHost-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden0.69%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.69%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.69%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.69%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2040502000Fungus garden microbial communities from Atta colombica in Panama - dump bottomHost-AssociatedOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300004061Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004070Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004077Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300004781Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2FreshEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006194Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012171Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2EnvironmentalOpen in IMG/M
3300012173Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2EnvironmentalOpen in IMG/M
3300012174Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012509Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014295Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021859Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024521 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027573Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033815Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ACODB_194280902040502000Fungus GardenPGPARTPITNFSDTIIERAKKKAEGWNVLCAKYRPLVEAERNRVKAAS
F14TC_10149631123300000559SoilPIEFAGYVNPGPARTPITNFSDTIIERTKKKAEGWNALCVKYRPLVEAERKQVKAAS*
AF_2010_repII_A1DRAFT_1001563513300000597Forest SoilPIIDFSATTIERAKKKAEGWNALCAKYRPLVEVERNRVKAAS*
JGI1027J12803_10361232623300000955SoilPIIRFSDTTIERAKKKAEGWKVLCAKFRSSVEAERNKVKAAS*
JGI10216J12902_10799708013300000956SoilAGYVNPGPARTPIIKFSDTTIERAKKKADGWKALCAKYRPLVEAEHTQVKAAS*
JGIcombinedJ13530_10219555523300001213WetlandFSDTAIERAKKKAEAWKALCAKYKPLVEAARAQAKVA*
Ga0055487_1000178733300004061Natural And Restored WetlandsPIEFAGYVNPGPARTPIVKFSDAAIERAKKKAEAWKALCAKYKPLVEAARTQAKVA*
Ga0055488_1018755013300004070Natural And Restored WetlandsGYVNPGPARTPIVKFSDAAIERAKKKAEAWKALCAKYKPLVEAARTQAKVA*
Ga0055523_1017852123300004077Natural And Restored WetlandsPGPARTPIVKFPDAAIERAKKKAEAWKALCAKYKPLVEAARTQAKVA*
Ga0062593_10124160823300004114SoilKLPIEFAGYVNPGPARTPIIKFSDTTIERAKKKADGWKALCAKYRPLVEAERTQVKAAS*
Ga0062589_10159273023300004156SoilIEFSETTIERAKKKAEGWKALCAKYRPLVEAERNKVKAAS*
Ga0062591_10060685923300004643SoilIVKFSDAAIERAKKKAEAWKALCAKYKPLVEAARTQAKVA*
Ga0062383_1064719013300004778Wetland SedimentARTPIVKFSDTAIERAKKKAEGWKALCAKYKPLVEAARAQAKVA*
Ga0062380_1037859423300004779Wetland SedimentRPGGNEGATAKLPIEYAGYVNPGPARTPIVKFSDTAIERAKKKAEGWKALCAKYKPLVEAARAQAKVA*
Ga0062379_1018795723300004781Wetland SedimentAGYVNPGPARTPIVKFSDTAIERAKKKAESWKALCAKYKPLVEAARAQAKVA*
Ga0066674_1006917423300005166SoilGPARTPIIEFSDTTIERAKKKAEGWKALCAKYRPLVEAERNRVKAAS*
Ga0066683_1025401313300005172SoilINFSDTTIERAKKKAEGWKALCAKYRPLVEARRAQVKVAS*
Ga0066690_1049905723300005177SoilKLPIEFAGYVNPGPARTPIIEFSDTTIERAKKKAEGWKALCAKYRPLVEAERNRVKAAS*
Ga0066388_10329195513300005332Tropical Forest SoilGPARTPIINFSDTTIERAKKKAEGWNALCAKYRPLVEAERNRVKAAS*
Ga0066388_10863735113300005332Tropical Forest SoilYVNPGPARTPIINFSDTTIERAKKKAEGWNALCAKYRPLVETERNRVKAAS*
Ga0070692_1074755313300005345Corn, Switchgrass And Miscanthus RhizosphereIIEFSETTIERAKKKAEGWKALCTKYRPLVEAEGSKVKAAS*
Ga0070711_10141990813300005439Corn, Switchgrass And Miscanthus RhizosphereAKLPIEFAGYVKPGPARTPMVKFSESAIERAKKKAEGWKKLCDKYRPLVEADTGTVKAAS
Ga0070678_10161836413300005456Miscanthus RhizosphereARTPIVKFSETAIERAKKKAEGWKRLCDKYRPLVEAEGNKVKAAS*
Ga0070706_10024239433300005467Corn, Switchgrass And Miscanthus RhizospherePARTPIINFSDTTIERAKKKAEGWNALCAKYRPLVEAERNKVKAAS*
Ga0070707_10219391523300005468Corn, Switchgrass And Miscanthus RhizospherePIINFSDTTIERAKKKAEGWNALCVKYRPLVEAERNKVKAAS*
Ga0070697_10121277823300005536Corn, Switchgrass And Miscanthus RhizosphereARTPIINFSDTTIERAKKKAEGWNALCAKYRPLVEAERNQVKAAS*
Ga0068855_10170345523300005563Corn RhizosphereGNEGATAKLPIEFAGYVNPGPARTPIIEFADTTIERAKKKAEGWKALCTKYRPLVEAEGSKVKAAS*
Ga0068856_10156483723300005614Corn RhizosphereTTIERAKKKAEGWKALCAKYRPLVEAERNKVKAAS*
Ga0066905_10122302123300005713Tropical Forest SoilGATAKLPIEFAGYVNPGPARTPIINFSDTTIERAKKKAEDWNALCAKYRPLVEAERNRVKVAS*
Ga0066905_10159231423300005713Tropical Forest SoilTAKLPIEFAGYVNPGPARTPIINFSDTTIERAKKKAEGWNALCAKYRPLVEAERNRVKAAS*
Ga0068858_10071848013300005842Switchgrass RhizosphereVNPGPARTPIIEFADTTIERAKKKAEGWKALCAKYRPLVEAERNKVKAAS*
Ga0081455_1004136913300005937Tabebuia Heterophylla RhizosphereGPARTPIVKFLETTIERAKKKAEGWKKLCDKYRPVVEAERSKVKAAS*
Ga0075427_1001787323300006194Populus RhizosphereVNPGPARTPIINFPATTIERAKKKAEGWNALCAKYRPLVEAERNQVKAAS*
Ga0097621_10139898523300006237Miscanthus RhizospherePGPARTPIIEFSETTIERAKKKAEGWKALCAKYRPLVEAERNKVKAAS*
Ga0074047_1150080323300006576SoilTAKLPIEFAGYVNPGPARTPIINFPTTTIERAKKKAEGWNALCAKYRPVVEAERNQVKAAS*
Ga0066665_1169322023300006796SoilATAKLPIEFAGYVNPGPARTPIIEFSDTTIERAKKKAEGWKALCTKYRPLVEGQAPKARTAS*
Ga0066660_1004035113300006800SoilGYVNPGPARTPIIEFSDTTIERAKKKAEGWKALCTKYRPLVEGQAPKARTAS*
Ga0075421_10057041123300006845Populus RhizosphereEGATAKLPIEFAGYVNPGPARTPIINFPATTIERAKKKAEGWNALCAKYRPLVEAERNQVKAAS*
Ga0075433_1111235923300006852Populus RhizosphereIIRFSDTTIERAKKKAEGWKALCAKYRPLVEAERNQVKAAS*
Ga0075425_10223725123300006854Populus RhizosphereSDTTIERAKKKAEGWNALCAKYRPLVEAERKQVKAAS*
Ga0075434_10183141323300006871Populus RhizosphereARTPIIEFSETTIERAKKKAEGWKALCAKYRPLVEAERNKVKAAS*
Ga0075424_10033546933300006904Populus RhizosphereTIERAKKKAEGWKALCAKYRPLVEAERNKVKAAS*
Ga0075424_10236726923300006904Populus RhizosphereTIERAKKKAEGWNALCAKYRPLVDAERNRVKAAS*
Ga0075419_1099975913300006969Populus RhizosphereARTPIIKFSDTTIERAKKKADGWKALCAKYRPLVEAERAQVKAAS*
Ga0075435_10028429713300007076Populus RhizospherePARTPIIEFSETTIERAKKKAEGWKALCAKYRPLVEAERNKVKAAS*
Ga0075435_10148377523300007076Populus RhizospherePARTPIINFSATTIERAKKKAEGWNALCAKYRPLVKAERNQVKAAS*
Ga0105244_1052595323300009036Miscanthus RhizosphereAKLPIEFAGYVNPGPARTPIIEFSETTIERAKKKAEGWKALCAKYRPLVEAERNKVKAAS
Ga0075418_1084424433300009100Populus RhizosphereGGSEGATAKLPIEYAGYIKPGPARTPIVKFPETVSERAKKKAEGWKKLCDKYRPLVEEENKIKAAS*
Ga0075418_1141282513300009100Populus RhizosphereTTIERAKKKADGWKALCAKYRPLVEAEHTQVKAAS*
Ga0114129_1216966933300009147Populus RhizosphereSDTTIERAKKKADGWKALCSKYRPLVEAERAQVKAAS*
Ga0105243_1188616513300009148Miscanthus RhizosphereGPTAKLPIEFAGYVKPGPARTPIVKFSETAIERAKKKAEGWKRLCDKYRPLVEAERNKVKAAS*
Ga0111538_1048160923300009156Populus RhizosphereGGNEGATAKLPIEFAGYVNPGPARTPIIEFADTTIERAKKKAEGWKALCAKYRPLVEAEGSKVKAAS*
Ga0075423_1128557913300009162Populus RhizosphereGYVNPGPARTPIINFPATTIERAKKKAEGWNALCAKYRPLVEAERNQVKAAS*
Ga0075423_1139962713300009162Populus RhizosphereGPARTPIINFPATTIERAKKKAEGWNALCAKYRPVVEVERNQVKAAS*
Ga0075423_1208315413300009162Populus RhizosphereIIEFADTTIERAKKKAEGWKALCTKYRPLVEAEGSKVKAAS*
Ga0075423_1215084613300009162Populus RhizosphereDTTIERAKKKAEGWKALCAKYRPLVEAEGSKVKAAS*
Ga0113563_1091343523300009167Freshwater WetlandsLPIEFAGYVNPGPARTPIVKFSDAAIERAKKKAEGWKKLCDKYRPLVEAERSKVKAAS*
Ga0105237_1049127813300009545Corn RhizosphereTTIERAKKKAEGWKALCTKYRPLVEAEGSKVKAAS*
Ga0105252_1047596623300009678SoilKFADAAIERAKKKAEAWKTLCAKYKPLVEAARVQAKVA*
Ga0126374_1088002313300009792Tropical Forest SoilFAGYVNPGPARTPIIDFSDTTIERAKKKAEGWNALCARYRPLVEAERNRVKAAS*
Ga0126311_1161918413300010045Serpentine SoilPIVKFSDAAIEGAKKKAEAWKVLCAKYKPLVEAVRPTAKVA*
Ga0126384_1085133913300010046Tropical Forest SoilTIERAKKKAEGWNALCAKYRPLVEAERNRVKVAS*
Ga0126382_1124072913300010047Tropical Forest SoilLPIEFAGYVNPGPARTPIINFSDTTIERAKKKAEDWNALCAKYRPLVEAERNRVKAAS*
Ga0126370_1204578113300010358Tropical Forest SoilNPGPARTSIIEFSETTIERAKKKAEGWKALCAKYRPLVEAERNKVKAAS*
Ga0126372_1095169723300010360Tropical Forest SoilGYVKPGPARTPITNFSDTIIERAKKKAEGWNALCAKYRPLVEAERNRVKAAS*
Ga0126381_10030781713300010376Tropical Forest SoilAGYVNPGPARTPIINFSDTTIERAKKKAEGWNALCAKYQPLVEAERNRVKAAS*
Ga0126383_1136199713300010398Tropical Forest SoilGGNEGATAKLPIEFAGYVNPGPARTPVINFPDTTIERAKKKAEGWNALCAKYRPLVEAERNRVKAAS*
Ga0137455_112329013300011429SoilTAKLPIEFAGYVNPGPARTPIIKFADTTIERAKKKADGWKALCAKYRPLVEAERAQVKAAS*
Ga0137463_101645413300011444SoilEGPTAKLPIEFAGYVKPGPARTPIVKFSETAIERAKKKAEGWKRLCDKYRPLVEAERNKVKAAS*
Ga0137342_101054823300012171SoilPGPARTPIIKFSDTTIERAKKKAEGWKKLCDKYRPLVEAERNKVRAAS*
Ga0137327_101740713300012173SoilPARTPIIKFSDTTIERAKKKAEGWKALCAKYRPLVEAERSKVRAAS*
Ga0137338_103547313300012174SoilVNPGPARTPIMKFSDTTIERAKKKAEGWKKLCDKYRPLVEAERNKVRAAS*
Ga0137363_1039285023300012202Vadose Zone SoilYVNPGPARTPIINFSDTTIERAKKKAEGWNALCAKYRPLVETERNQVKAAS*
Ga0157334_105268223300012509SoilGNEGPTAKLPIEFAGYVKPGAARTPIVKFSETAIERAKKKAEGWKRLCDKYRPLVEAERNKVKAAS*
Ga0126375_1048778523300012948Tropical Forest SoilPDTTIERAKKKAEGWNALCAKYRPLVEAERNRVKAAS*
Ga0126375_1092295223300012948Tropical Forest SoilGPARTPIINFSHTTIERAKKKAEGWNALCAKYLPLVEAERNRVKVAS*
Ga0164303_1000355453300012957SoilPIEFAGYVNPGPARTPIIAFADTTIARAKKKAEGWKALCAKYRPLVEAEGSKVKVAS*
Ga0164299_1020155723300012958SoilAKLPIEFAGYVKPGPARTPIVKFSETAIERAKKKAEGWKRLCDKYRPLVEAERNKVKAAS
Ga0126369_1231230523300012971Tropical Forest SoilIEFAGYVNPGPARTPIINFSATIIERAKKKAESWNALCAKYRPLVEAERNQVKAAS*
Ga0164309_1119648113300012984SoilEGATAKLPIEFAGYVKPGPARTPIVKFSDATIERAKKKAESWKALCAKYRPLVEAARAQVKAAS*
Ga0164308_1152801223300012985SoilPIVKFSETAIERAKKKAEGWKRLCDKYRPLVEAERNKVKAAS*
Ga0157378_1037612813300013297Miscanthus RhizosphereGPARTPIVKFSDTTIERAKKKAEGWKALCAKYKPLVEAARTKAKVA*
Ga0157378_1289095613300013297Miscanthus RhizosphereTIERAKKKAEGWKALCTKYRPLVEAEGSKVKAAS*
Ga0075305_112108113300014295Natural And Restored WetlandsTAKLPIAFAGFVDPGPARTPIVKFSDAAIERAKKKAEAWKALCAKYKPLVEAARTQAKVA
Ga0137409_1059177113300015245Vadose Zone SoilFAGYVNPGPARTPIINFSTTTIERAKKKAEGWNALCAKYRPVVEAERNQVKAAS*
Ga0132258_1192239023300015371Arabidopsis RhizosphereFAGYVNPGPARTPIIRFSDTTIERAKKKAEGWKVLCAKFRSSVEAERNKVKAAS*
Ga0132256_10027883633300015372Arabidopsis RhizosphereGPARTPIIEFSETTIERAKKKAEGWKALCAKYRPLVEAERNKVKAAS*
Ga0132257_10030211413300015373Arabidopsis RhizosphereTPIIEFSETTIERAKKKAEGWKALCAKYRPLVEAERNKVKAAS*
Ga0132257_10243058013300015373Arabidopsis RhizosphereGYVNPGPARTPIIEFADTTIERAKKKAEGWKALCTKYRPLVEAERNKVKAAS*
Ga0132255_10277936313300015374Arabidopsis RhizosphereIIEFADTTIERAKKKAEGWKALCTKYRPLVEAERNKVKAAS*
Ga0182033_1192121813300016319SoilATAKLPIEFAGYVKPGPARTPIINFSDTTIERAKKKAEGWNTLCAKYQPLVEAERNKVKAAS
Ga0182035_1143801513300016341SoilTAKLPIEFAGYVNPGPARTSIIEFSETTIERAKKKAEGWKALCAKYRLLVEAERNKVKAA
Ga0187786_1013790923300017944Tropical PeatlandPARTPIVKFSDTTIERAKKKAEAWKTLCAKYRPLVEAARNKVKAAS
Ga0187776_1053299313300017966Tropical PeatlandGASAKLPIEFAGYVNPGPARTPIVKFSDTTIERAKKKAEAWKTLCAKYRPLVEAARNKVKAAS
Ga0184640_1025883913300018074Groundwater SedimentIEFAGYVNPGPARTPIMKFSDTTIERAKKKAEGWKRLCDKYRPLVEAERNKVKAAW
Ga0184612_1008276813300018078Groundwater SedimentNEGATAKLPIEFAGYVNPGPARTPIINFSDTTIERAKKKAEGWEKLCDKYRPLVEAERNKVKAAS
Ga0184627_1066190113300018079Groundwater SedimentKLPIEFAGYVNPGPARTPIVKFSDTTIERAKQKAEGWKVLCAKYRPLVEAERAQVKAAS
Ga0184629_1060210923300018084Groundwater SedimentPIEFAGYVNPGPARTPIMKFSDTTIERAKKKAEGWKKLCDKYRPLVEAERNKVRAAS
Ga0190265_1056069113300018422SoilPTAKLPIEFAGYVKPGPARTPIVKFSETAIERAKKKAEGWKRLCDKYRPLVEAARNKVKAAS
Ga0190268_1047415323300018466SoilAGYVNPGPARTPIVKFSDTAIERAKKKAEGWKALCDKYQPLVEAAKVQAKVA
Ga0190268_1223371313300018466SoilRTPIVKFSDTAIERAKKKAEGWKALCAKYKPLVEAARVQAKVA
Ga0190270_1285867613300018469SoilYVNPGPARTPIVKFSDTAIERAKKKAEGWKALCAKYQPLVEAARVQAKVA
Ga0173481_1032915113300019356SoilPARTPIIEFSETTIERAKKKAEGWKALCAKYRPLVEAERNKVKAAS
Ga0193707_110963823300019881SoilGPARTPIIRFSDTTIERAKKKAEGWKALCAKYRPLVEAERNQVKAAS
Ga0193755_104170013300020004SoilNEGATAKLPIEFAGYVNPGPARTPIIRFSDTTIERAKKKAEGWKALCAKYRPLVEAERNQVKAAS
Ga0126371_1107337113300021560Tropical Forest SoilTTIERAKKKAEGWKALCAKYRPLVEAERNKVKAAS
Ga0210334_1028692023300021859EstuarineFAGYGNPGPARTPIVKFSDTAIERAKKKAEGWKALCAKYKPLVEAARVQAKVA
(restricted) Ga0255056_1026988823300024521SeawaterNEGTSGKLPLEFAGYCKPGPTRTPIVQFPPAAIERAKKKAEHWKALCEKYRPLVEAQGPIAAAR
Ga0207680_1053577313300025903Switchgrass RhizosphereAKLPIEFAGYVNPGPARTPIIEFSETTIERAKKKAEGWKALCTKYRPLVEAERNKVKAAS
Ga0207652_1010523713300025921Corn RhizosphereGYVNPGPARTPIIEFADTTIERAKKKAEGWKALCTKYRPLVEAEGSKVKAAS
Ga0207701_1051052023300025930Corn, Switchgrass And Miscanthus RhizosphereIIRFSDTTIERAKKKAEGWKVLCAKFRSSVEAERNKVKAAS
Ga0207644_1048770313300025931Switchgrass RhizosphereYVNPGPARTPIIEFSETTIERAKKKAEGWKALCAKYRPLVEAERNKVKAAS
Ga0207658_1095673323300025986Switchgrass RhizosphereVNPGPARTPIVKFSDTTIERAKKKAEGWKALCAKYKPLVEAARTKAKVA
Ga0207683_1154714913300026121Miscanthus RhizospherePARTPIVKFSETAIERAKKKAEGWKRLCDKYRPLVEAEGNKVKAAS
Ga0209805_113913733300026542SoilTPIIEFSDTTIERAKKKAEGWKALCAKYRPLVEAERNRVKAAS
Ga0209577_1048506213300026552SoilGYVNPGPARTPIIEFSDTTIERAKKKAEGWKALCTKYRPLVEGQAPKARTAS
Ga0208454_117276613300027573SoilKFADAAIERAKKKAEAWKTLCAKYKPLVEAARVQAKVA
Ga0209177_1036431023300027775Agricultural SoilIIEFSETTIERAKKKAEGWKALCAKYRPLVEAERNKVKAAS
Ga0268265_1027352623300028380Switchgrass RhizosphereATAKLPIEFAGYVNPGPARTPIIEFSETTIERAKKKAEGWKALCTKYRPLVEAEGSKVKAAS
Ga0307302_1046059123300028814SoilRTPIINFSDTTIERAKKKAEGWKALCTKYRPLVEAQRGQVKAAS
Ga0302046_1022219513300030620SoilIEYAGYVKPGPARTPIVKFSETAIERAKKKAEGWKKLCDKYRPLVEAERSKVKAAS
Ga0299913_1085954313300031229SoilTAKLPIEFAGYVNPGPARTPIVKFSETTLERAKKKAESWKKLCDKYRPLVEAEKNKVKAA
Ga0310888_1046331813300031538SoilVNPGPARTPIIKFADTTIERAKKKADGWKALCAKYRPLVEAERAQVKAAS
Ga0310887_1052864823300031547SoilRTPIVKFSDTAIERAKKKAEGWKTLCAKYKPLVEAARAQAKVA
Ga0307469_1082556723300031720Hardwood Forest SoilARTPIINFPATTIERAKKKAEGWNALCAKYRPVVEAERNQVKAAS
Ga0307473_1004978713300031820Hardwood Forest SoilEGTTAKLPIEFAGYVNPGPARTPIINFPATTIERAKKKAEGWNALCAKYRPVVEAERNQVKAAS
Ga0306919_1150902423300031879SoilAGYVNPGPARTPIIEFSETTIERAKKKAEGWKALCAKYRLLVEAERNKVKAAS
Ga0310900_1125946823300031908SoilTAKLPIEFAGYVKPGPARTPIVKFSETAIERAKKKAEGWKRLCDKYRPLVEAERNKVKAA
Ga0306923_1029648833300031910SoilNPGPARTPIIEFSETTIERAKKKAEGWKALCAKYRLLVEAERNKVKAAS
Ga0310909_1061607823300031947SoilTPIIEFSETTIERAKKKAEGWKALCAKYRLLVEAERNKVKAAS
Ga0307479_1053192523300031962Hardwood Forest SoilLPIEFAGYVNPGPARTPIISFSDTTIERAKKKAEGWNALCAKYRPLVEAERNKVKAAS
Ga0326597_1048527823300031965SoilSDTTIERAKKKAEGWKALCAKYRPLVEAERAQVKAAS
Ga0307411_1113397223300032005RhizosphereRPGGNEGATAKLPIEFAGYVNPGPARTPIVKFSDAAIERAKKKAEGWKALCAKYKPLVETARTQAKVA
Ga0310895_1072910513300032122SoilGGNEGATAKLPIEFAGYVNPGPARTPIVKFSDTAIERAKKKAEGWKTLCAKYKPLVEAARAQAKVA
Ga0307471_10001992943300032180Hardwood Forest SoilEFAGYVNPGPARTPIINFSDTTIERAKKKAEGWNALCAKYRPLVEAERNKVKAAS
Ga0307472_10115654723300032205Hardwood Forest SoilIEFAGYVKPGPARTPIVKFSETAIERAKKKAEGWKRLCDKYRPLVEAERNKVKAAS
Ga0335084_1063618813300033004SoilFSDTTIERAKKKAEAWKVLCAKYRPLVEAARNKVKAAS
Ga0310914_1098262623300033289SoilRTSIIEFSETTIERAKKKAEGWKALCAKYRPLVEAERNKVKAAS
Ga0214472_1137384423300033407SoilNEGATAKLPIEFAGYVNPGPARTPIMKFSETTIERAKKKAEGWKRLCDKYRPLVEAERNKVRAAS
Ga0214472_1152003113300033407SoilNPGPARTPIMKFSDTTIERAKKKAEGWKKLCDKYRPLVEAERNKVRAAS
Ga0316619_1199732313300033414SoilGATAKLPIEFAGYVNPGPARTPIVKFSDAAIERAKKKAEGWKKLCDKYRPLVEAERSKVKAAS
Ga0316630_1013030133300033487SoilGATAKLPIEFAGYVNPGPARTPIVKFSDAAIERAKKKAEGWKALCAKYKPLVEAARAQAKVA
Ga0316630_1077701813300033487SoilTPIVKFSDAAIERAKKKAEGWKKLCDKYRPLVEAERSKVKAAS
Ga0364946_061283_644_7933300033815SedimentNPGPARTPIVKFSDTAIERAKKKAEGWKALCAKYRPLVEAERSKVKAAS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.