NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F051107

Metagenome / Metatranscriptome Family F051107

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051107
Family Type Metagenome / Metatranscriptome
Number of Sequences 144
Average Sequence Length 51 residues
Representative Sequence PKLEERLSSAGITAEQIDSALEPSGYLGAADAFITAALDAHEKLEDRHG
Number of Associated Samples 135
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.31 %
% of genes from short scaffolds (< 2000 bps) 94.44 %
Associated GOLD sequencing projects 134
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.222 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(29.861 % of family members)
Environment Ontology (ENVO) Unclassified
(23.611 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.222 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.05%    β-sheet: 0.00%    Coil/Unstructured: 51.95%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 144 Family Scaffolds
PF02627CMD 71.53
PF01144CoA_trans 23.61
PF00756Esterase 0.69
PF10397ADSL_C 0.69
PF00775Dioxygenase_C 0.69
PF12323HTH_OrfB_IS605 0.69
PF12391PCDO_beta_N 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 144 Family Scaffolds
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 71.53
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 71.53
COG1788Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunitLipid transport and metabolism [I] 23.61
COG2057Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunitLipid transport and metabolism [I] 23.61
COG4670Acyl CoA:acetate/3-ketoacid CoA transferaseLipid transport and metabolism [I] 23.61
COG3485Protocatechuate 3,4-dioxygenase beta subunitSecondary metabolites biosynthesis, transport and catabolism [Q] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.22 %
UnclassifiedrootN/A2.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_104062249All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300001867|JGI12627J18819_10432284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia537Open in IMG/M
3300002245|JGIcombinedJ26739_100537102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1046Open in IMG/M
3300003368|JGI26340J50214_10003753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4938Open in IMG/M
3300004082|Ga0062384_100749763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia677Open in IMG/M
3300004157|Ga0062590_102457093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia551Open in IMG/M
3300005179|Ga0066684_10382531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia944Open in IMG/M
3300005184|Ga0066671_10798770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia604Open in IMG/M
3300005435|Ga0070714_101128123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae764Open in IMG/M
3300005436|Ga0070713_100679081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales982Open in IMG/M
3300005436|Ga0070713_100804061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia901Open in IMG/M
3300005447|Ga0066689_10233825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1126Open in IMG/M
3300005459|Ga0068867_101940276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M
3300005536|Ga0070697_100048744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3435Open in IMG/M
3300005537|Ga0070730_10456413All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300005553|Ga0066695_10333569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia953Open in IMG/M
3300005556|Ga0066707_10806336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae580Open in IMG/M
3300005559|Ga0066700_10886553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia594Open in IMG/M
3300005560|Ga0066670_10528784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300005921|Ga0070766_10614873All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300005950|Ga0066787_10002478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2625Open in IMG/M
3300006034|Ga0066656_10877316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis574Open in IMG/M
3300006059|Ga0075017_100542059All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300006578|Ga0074059_12071201All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300006604|Ga0074060_12035565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia731Open in IMG/M
3300006871|Ga0075434_100314855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1585Open in IMG/M
3300006953|Ga0074063_10005251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia581Open in IMG/M
3300006954|Ga0079219_11246733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia649Open in IMG/M
3300009012|Ga0066710_104423051All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300009089|Ga0099828_11553047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300009090|Ga0099827_10683563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria887Open in IMG/M
3300010303|Ga0134082_10519536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300010359|Ga0126376_11206657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria772Open in IMG/M
3300010401|Ga0134121_12411838Not Available567Open in IMG/M
3300010880|Ga0126350_10125464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300011269|Ga0137392_10224023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1543Open in IMG/M
3300011271|Ga0137393_11290162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300012189|Ga0137388_11239540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria684Open in IMG/M
3300012199|Ga0137383_10771107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria702Open in IMG/M
3300012202|Ga0137363_11287770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300012206|Ga0137380_10177578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1937Open in IMG/M
3300012208|Ga0137376_11407347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria588Open in IMG/M
3300012209|Ga0137379_10053122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae3900Open in IMG/M
3300012210|Ga0137378_10716396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria912Open in IMG/M
3300012211|Ga0137377_10726784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria927Open in IMG/M
3300012357|Ga0137384_11061208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300012359|Ga0137385_10757875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria808Open in IMG/M
3300012473|Ga0157340_1008334All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300012479|Ga0157348_1010653All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300012488|Ga0157343_1027540All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300012508|Ga0157315_1055140All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300012685|Ga0137397_10993452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria618Open in IMG/M
3300012910|Ga0157308_10469623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300012958|Ga0164299_10220582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1111Open in IMG/M
3300014157|Ga0134078_10320894All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300014499|Ga0182012_10529198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria763Open in IMG/M
3300014499|Ga0182012_10915718All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300014969|Ga0157376_11545775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300015373|Ga0132257_101500403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria860Open in IMG/M
3300017959|Ga0187779_11085359All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300017970|Ga0187783_10397067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1002Open in IMG/M
3300017975|Ga0187782_10810432All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300018001|Ga0187815_10420771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura parvosata → Actinomadura parvosata subsp. kistnae570Open in IMG/M
3300019877|Ga0193722_1049966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1061Open in IMG/M
3300020070|Ga0206356_10583422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1318Open in IMG/M
3300020199|Ga0179592_10338598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria664Open in IMG/M
3300020579|Ga0210407_10380468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1104Open in IMG/M
3300020579|Ga0210407_10873393All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300021088|Ga0210404_10354017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria815Open in IMG/M
3300021171|Ga0210405_10150904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1840Open in IMG/M
3300021362|Ga0213882_10372814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300021377|Ga0213874_10094469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia987Open in IMG/M
3300021401|Ga0210393_10864841All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300021403|Ga0210397_11371560All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300021404|Ga0210389_10202958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1546Open in IMG/M
3300021407|Ga0210383_11610962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300021475|Ga0210392_10751088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria727Open in IMG/M
3300021478|Ga0210402_11031302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria749Open in IMG/M
3300021559|Ga0210409_10520163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1055Open in IMG/M
3300021560|Ga0126371_11486416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria806Open in IMG/M
3300024181|Ga0247693_1044677All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300024224|Ga0247673_1037466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia675Open in IMG/M
3300025898|Ga0207692_10019741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3051Open in IMG/M
3300025898|Ga0207692_10261135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1041Open in IMG/M
3300025916|Ga0207663_10304042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1193Open in IMG/M
3300025939|Ga0207665_10877542All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300026327|Ga0209266_1304592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300026369|Ga0257152_1036865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300026494|Ga0257159_1013005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1318Open in IMG/M
3300026548|Ga0209161_10476407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300026551|Ga0209648_10452657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria795Open in IMG/M
3300027119|Ga0209522_1010234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1004Open in IMG/M
3300027824|Ga0209040_10016216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales4991Open in IMG/M
3300027855|Ga0209693_10103172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1412Open in IMG/M
3300027889|Ga0209380_10503360Not Available706Open in IMG/M
3300027894|Ga0209068_10984133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300028716|Ga0307311_10050346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1107Open in IMG/M
3300028784|Ga0307282_10344953All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300028884|Ga0307308_10349667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria708Open in IMG/M
3300030617|Ga0311356_10391775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1373Open in IMG/M
3300031544|Ga0318534_10032616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2851Open in IMG/M
3300031546|Ga0318538_10295545All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300031561|Ga0318528_10086861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1628Open in IMG/M
3300031564|Ga0318573_10446121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria696Open in IMG/M
3300031572|Ga0318515_10173740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1151Open in IMG/M
3300031679|Ga0318561_10438709Not Available718Open in IMG/M
3300031681|Ga0318572_10049948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2249Open in IMG/M
3300031708|Ga0310686_106095456All Organisms → cellular organisms → Bacteria1910Open in IMG/M
3300031718|Ga0307474_10499362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria954Open in IMG/M
3300031719|Ga0306917_10257849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1338Open in IMG/M
3300031719|Ga0306917_10853486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia713Open in IMG/M
3300031736|Ga0318501_10122484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1318Open in IMG/M
3300031744|Ga0306918_10628162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria842Open in IMG/M
3300031769|Ga0318526_10064764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1418Open in IMG/M
3300031769|Ga0318526_10120849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1056Open in IMG/M
3300031778|Ga0318498_10078757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1485Open in IMG/M
3300031798|Ga0318523_10458717All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300031805|Ga0318497_10084883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1683Open in IMG/M
3300031823|Ga0307478_10728161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae831Open in IMG/M
3300031831|Ga0318564_10488236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300031859|Ga0318527_10518144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinomycetospora → environmental samples → uncultured Actinomycetospora sp.509Open in IMG/M
3300031880|Ga0318544_10135627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae940Open in IMG/M
3300031896|Ga0318551_10239720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1011Open in IMG/M
3300031896|Ga0318551_10272581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia948Open in IMG/M
3300031897|Ga0318520_10106366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1581Open in IMG/M
3300031941|Ga0310912_10912261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300031946|Ga0310910_11509968Not Available515Open in IMG/M
3300031954|Ga0306926_10567497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1389Open in IMG/M
3300031954|Ga0306926_11032618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae976Open in IMG/M
3300031954|Ga0306926_11441162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria797Open in IMG/M
3300032041|Ga0318549_10126743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1127Open in IMG/M
3300032054|Ga0318570_10224705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae850Open in IMG/M
3300032060|Ga0318505_10063014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1617Open in IMG/M
3300032063|Ga0318504_10235816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria859Open in IMG/M
3300032068|Ga0318553_10459410All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300032074|Ga0308173_10658166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae954Open in IMG/M
3300032089|Ga0318525_10478141All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300032090|Ga0318518_10476572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300032770|Ga0335085_11590286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria677Open in IMG/M
3300032828|Ga0335080_11228124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → environmental samples → uncultured Frankineae bacterium752Open in IMG/M
3300032893|Ga0335069_10363349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1707Open in IMG/M
3300032897|Ga0335071_11044795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura parvosata → Actinomadura parvosata subsp. kistnae763Open in IMG/M
3300032898|Ga0335072_11285746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinomycetospora → environmental samples → uncultured Actinomycetospora sp.642Open in IMG/M
3300034124|Ga0370483_0071015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1121Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil29.86%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.86%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.17%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.47%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.08%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.08%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.08%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.08%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere2.08%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.39%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.39%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.39%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.39%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.39%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.39%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.69%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.69%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.69%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.69%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.69%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.69%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.69%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.69%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.69%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003368Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012473Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610Host-AssociatedOpen in IMG/M
3300012479Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.yng.030610EnvironmentalOpen in IMG/M
3300012488Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610Host-AssociatedOpen in IMG/M
3300012508Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510Host-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024181Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34EnvironmentalOpen in IMG/M
3300024224Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026369Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-AEnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027119Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10406224933300000955SoilITAEQIDSALEPSGYLGATDAFITAAIDAHEEPENRHG*
JGI12627J18819_1043228413300001867Forest SoilARATSAGLPLRDVLLSVPKLEERLSSAGITAEQIDSALEPSGYLGATDAFITAAIDAHEKPEDRHG*
JGIcombinedJ26739_10053710233300002245Forest SoilAGVRAVSAGLPLRDVLLAVPKLEEQLSAAGITAEQIDAALEPSGYLGATDAFITAALEAHESLGVPVG*
JGI26340J50214_1000375313300003368Bog Forest SoilLSAAGITAEQIDSALDPAGYLGATDAFITAALEAHRSSSREVPSG*
Ga0062384_10074976323300004082Bog Forest SoilLEERLSAAGIAAEQIDSALEPTGYLGATDAFIAAALEAHRSLEVPRG*
Ga0062590_10245709313300004157SoilLLAVPKLEERLSSAGITAEQIDSALEPSGYLGATGAFVAAALDAHKALEARHG*
Ga0066684_1038253113300005179SoilERLSSAGITAEQIDSALEPSGYLGAADAFITAALDAHEKLEDRHG*
Ga0066671_1079877013300005184SoilPKLEERLSSAGITAEQIDSALEPSGYLGAADAFITAALDAHEKLEDRHG*
Ga0070714_10112812323300005435Agricultural SoilAGITAEQIDSALEPSGYLGSAGAFVTAALDAHEKLGILHG*
Ga0070713_10067908113300005436Corn, Switchgrass And Miscanthus RhizosphereLRDVLLSVPKLEERLSSAGITAEQIDSALEPSGYLGATDAFITAAIDAHEKPEDRHG*
Ga0070713_10080406133300005436Corn, Switchgrass And Miscanthus RhizosphereAVPKLEERLTAAGITPEQIDSALEPSGYLGSADAFITAALDAHRSGGISHG*
Ga0066689_1023382513300005447SoilAGLPLQDVLLAVPKLEERLSAAGITPEQIEAALEPSGYLGATDAFITAALDAHEKLGERHG*
Ga0068867_10194027613300005459Miscanthus RhizosphereLSSAGITAEQIDSALEPSGYLGAAGVFVAAALDAHTALEASHG*
Ga0070697_10004874463300005536Corn, Switchgrass And Miscanthus RhizosphereEAGARAVSAGLPLQDVLLAVPKLEERLSAAGITPEQIEAALEPSGYLGATDAFITAALGAHEKLGDRHG*
Ga0070730_1045641333300005537Surface SoilPEQIDSALEPSGYLGSADAFVTAALDAHRSGGSRHG*
Ga0066695_1033356913300005553SoilTAEQIDSALEPSGYLGAADAFITAALDAHEKLEDRHG*
Ga0066707_1080633613300005556SoilITAEQIDSALEPSGYLGSAGAFVTAALDAHEKLGILHG*
Ga0066700_1088655313300005559SoilLLAVPELEERLSAAGITAAQIDAALEPSGYLGATDAFITAALEAHESLGVPYG*
Ga0066670_1052878413300005560SoilPLRDVLLAVPKLEERLSSAGITAEQIDSALEPSGYLGAADAFITAALDAHEKLEDRHG*
Ga0070766_1061487313300005921SoilEERLSAAGITAEQIDSALEPAGYLGATDAFITAALEAHRSWEVSSG*
Ga0066787_1000247813300005950SoilTAEQIDAALEPAGYLGAADAFTAAALDAHETLNLQEPQHG*
Ga0066656_1087731623300006034SoilSAGITAEQIDSALEPSGYLGAADAFITAALDAHEKLEDRHG*
Ga0075017_10054205913300006059WatershedsAAGITAEQIDSALEPAGYLGATDGFIAAALEAHQALEVPRG*
Ga0074059_1207120113300006578SoilRLSSAGITAEQIDSALEPSGYLGAAGAFVTAALDAHEQLGNLHG*
Ga0074060_1203556513300006604SoilLLAVPKLEERLSAAGITPEQIEAALEPSGYLGATDAFITAALDAHEKLGESHGCPPHG*
Ga0075434_10031485543300006871Populus RhizosphereRLTAAGITPEQIDSALEPSGYLGSADAFITAALHAHRSGGTPHG*
Ga0074063_1000525113300006953SoilTAEQIDSALEPSGYLGAAGAFVTAALDAHEKLGNLHG*
Ga0079219_1124673323300006954Agricultural SoilLEERLTAAGITPEQIDSALEPSGYLGSADAFITAALHAHRSGGTPHG*
Ga0066710_10442305113300009012Grasslands SoilVLLAVPKLEERLSSAGITAEQIDSALEPSGYLGSAGEFVTAALDAHEKLGNLHG
Ga0099828_1155304723300009089Vadose Zone SoilSSAGVTPEQIDAAREPSGYLGASDAFVTAALEAHESLEVPHG*
Ga0099827_1068356313300009090Vadose Zone SoilAGITAEQIDSALEPSGYLGAAGAFITAALDAHQAQGVRHG*
Ga0134082_1051953613300010303Grasslands SoilLLAVPKLEERLSSAGITAEQIDSALEPSGYLGSAGAFVTAALDAHEKLGILHG*
Ga0126376_1120665713300010359Tropical Forest SoilGITPEQIDSALEPSGYLGSADAFITAALDAHRSGGIPNG*
Ga0134121_1241183813300010401Terrestrial SoilVGAGPPKKDVLLAVPKLEERLTAAGITPEQIDSALEPSGYLGSADAFITAALDAHRSGGTAHG*
Ga0126350_1012546413300010880Boreal Forest SoilAGITAEQIDAALDPVGYLGSADAFITAALGAHRSGGISHG*
Ga0137392_1022402333300011269Vadose Zone SoilAVPTLEERLSSAGVTPEQIDAALEPSGYLGASDAFVIAALEAHESLGSPGVRYG*
Ga0137393_1129016213300011271Vadose Zone SoilTLEERLSSAGVTPEQIDAALEPSGYLGASDAFVIAALEAHESLGSPGVRNG*
Ga0137388_1123954013300012189Vadose Zone SoilSAGVTPEQIDAALEPSGYLGASEAFVTAALEAHESLGSPGVRNG*
Ga0137383_1077110713300012199Vadose Zone SoilLLAVPKLEERLSSAGITAEQIDSALEPSGYLGSAGAFVTAALDAHEKLGNLHG*
Ga0137363_1128777013300012202Vadose Zone SoilSSAGITAEQIDSALEPSGYLGSAGAFVTAALDAHDALEARDG*
Ga0137380_1017757843300012206Vadose Zone SoilEERLTAAGVTPEQIDSALEPSGYLGSADAFITAALDAHGSRGVPHG*
Ga0137376_1140734713300012208Vadose Zone SoilITAEQIDSALEPSGYLGSAGAFVTAALDAHDALEARDG*
Ga0137379_1005312213300012209Vadose Zone SoilRLSSAGVTPEQIDAALEPSGYLGASEAFVTAALEAHESLGSPGVRNG*
Ga0137378_1071639613300012210Vadose Zone SoilKLEERLSAAGITPEQIEAALEPSRYLGATDAFIDGVLDAHEKLGDRHG*
Ga0137377_1072678413300012211Vadose Zone SoilRLSSAGITAEQIDSALEPSGYLGATDAFITAALDAHEKLEDRHG*
Ga0137384_1106120823300012357Vadose Zone SoilEERLSSAGITAEQIDSALEPSGYLGATDAFITAALDAHEKLEDRHG*
Ga0137385_1075787523300012359Vadose Zone SoilDVLLAVPTLEERLCSAGVTPEQIDAALEPSGYLGASEAFVTAALEAHESLGSPGVRNG*
Ga0157340_100833423300012473Arabidopsis RhizosphereRDVLLAVPKLEERLSSAGITAEQIDSALEPSGYLGATDAFITAAIDAHEKPENRHG*
Ga0157348_101065313300012479Unplanted SoilLPLRDVLLAVPKLEERLSSAGITAEQIDSALEPSGYLGATDAFITAAIDAHEKPEDRHG*
Ga0157343_102754013300012488Arabidopsis RhizospherePKLEERLSSAGITTEQIDSALEPSGYLGATDAFITAAIDAHEKPENRHG*
Ga0157315_105514023300012508Arabidopsis RhizosphereRDVLLSVPKLEERLSSAGITAEQIDSALEPSGYLGATGAFITAAIDAHEKPENRHG*
Ga0137397_1099345213300012685Vadose Zone SoilLLAVPKLEERLSSAGITAEQIDSALEPSGYLGSAGAFVTAALDAHDALEARDG*
Ga0157308_1046962313300012910SoilRLSSAGITAEQIDSALEPSGYLGATDAFITAAIDAHEKPENRHG*
Ga0164299_1022058233300012958SoilVPKLEERLSSAGITAEQIDSALEPSGYLGSAGAFVTAALDAHDALEARDG*
Ga0134078_1032089413300014157Grasslands SoilKLEERLSSVGITAEQIDSALEPSGYLGAAGAFVTAALDAHKALEARHG*
Ga0182012_1052919813300014499BogITAEQIDSALEPAGYLGVTDALITAALEAHETLKLQESQHG*
Ga0182012_1091571823300014499BogSAGITAEQIDAALEPAGYLGAADTFTGAALDAHETLNLLQARHG*
Ga0157376_1154577523300014969Miscanthus RhizospherePLRDVLLAVPKLEERLSSAGITAEQIDSALEPSGYLGSAGAFVTAALDAHDALEARDG*
Ga0132257_10150040313300015373Arabidopsis RhizosphereKLEERLSSAGITAEQIDSALEPSGYLGATDAFITAAIDAHEKPENRHG*
Ga0187779_1108535913300017959Tropical PeatlandLEERLSAAGITAEQIEAALEPSGYLGASDAFITAALEAHRSLGVRNG
Ga0187783_1039706733300017970Tropical PeatlandAGLPLRDVLLSVPKLEGRLASAGITPEQIESALEPTSYLGAADAFVTAALQAHQALGAQLSEGDHHG
Ga0187782_1081043213300017975Tropical PeatlandRAVNAGLPLRDVLLAVPRLEGQLASAGITAEQIESALEPIGYLGATDAFVTTALKAHAALDAQQRQEEGHG
Ga0187815_1042077113300018001Freshwater SedimentQRAVSAGLPLRDVLLAVPKLEGRLASAGITPEQIESALEPTGYLGGADAFVAAALQAHEALDAQLSEGVDHG
Ga0193722_104996613300019877SoilAEQIDSALEPSGYLGAAGAFVTAALDAHEKLGNLHG
Ga0206356_1058342213300020070Corn, Switchgrass And Miscanthus RhizosphereGITAEQIDSALEPSGYLGATDAFITAAIDAHEKPENRHG
Ga0179592_1033859813300020199Vadose Zone SoilLSSAGITAEQIDSALEPSGYLGSAGAFVTAALDAHDALEARDG
Ga0210407_1038046833300020579SoilVPKLEERLSSAGITAEQIDSALEPSGYLGVADAFVTAALDAHQALEARHG
Ga0210407_1087339313300020579SoilEAGARAVGAGLPLRDVLLAVPKLEERLSAAGIAAEQIDSALEPTGYLGATDAFIVAALEAHRSLEVPRG
Ga0210404_1035401733300021088SoilGITAEQIDSALEPSGYLGSAGAFVTAALDAHEKLGNLHG
Ga0210405_1015090443300021171SoilGLPLRDVLLAVPKLEERLSSAGITAEQIDSALEPSGYLGVADAFVTAALDAHDALEARHG
Ga0213882_1037281413300021362Exposed RockEDRLLAAGVTAEQIDAALEPSGYLGSADAFITAALEAHQKLGIHRG
Ga0213874_1009446933300021377Plant RootsGLPLQDVLLAVPDLEERLCAAGVTPEQIEAALEPANYLGSVDAFITAALDAHASMEVLNG
Ga0210393_1086484123300021401SoilKLEERLSAAGIAAEQIDSALEPTGYLGATDAFITAALEAHRSMEVPRG
Ga0210397_1137156013300021403SoilGARAVSAGLPLQDVLLAVPRLEERLSAAGITAEQIEAALEPSGYLGAADAFVTAALNAHEALEVRHG
Ga0210389_1020295813300021404SoilGLPLRDVLLSVPKLEERLSSAGITAEQIDSALEPSGYLGATDAFITAAIDAHEKPENRHG
Ga0210383_1161096213300021407SoilTAEQIDSALEPSSYLGSAGAFVTAALDAHQKLGNLHG
Ga0210392_1075108813300021475SoilPLRDVLLAVPKLEERLSSAGITAEQIDSALEPSGYLGVTDAFVTAALDAHQALEARHG
Ga0210402_1103130233300021478SoilAEQIDSALEPSGYLGSAGAFVTAALDAHEKLGNLHG
Ga0210409_1052016333300021559SoilLPLRDVLLAVPKLEERLSSAGITAEQIDSALEPSGYLGSAGAFVTAALDAHEKLGNLHG
Ga0126371_1148641633300021560Tropical Forest SoilAAGITPEQIEAALEPSGYLGATDAFITAALDAHEALEVRHG
Ga0247693_104467713300024181SoilGARATSAGLPLRDVLLAVPKLEERLSSAGITAEQIDSALEPSGYLGATDAFITAAIDAHEKPENRHG
Ga0247673_103746623300024224SoilATSAGLPLRDVLLAVPKLEERLSSAGITAEQIDSALEPSGYLGATDAFITAAIDAHEKPENRHG
Ga0207692_1001974113300025898Corn, Switchgrass And Miscanthus RhizosphereGLPLSDVLLAVPKLEERLTAAGITPEQIDSALEPSGYLGSADAFITAALDAHRSGGTPHG
Ga0207692_1026113533300025898Corn, Switchgrass And Miscanthus RhizosphereSSAGITAEQIDSALEPSGYLGSAGAFVTAALDAHEKLGNLHG
Ga0207663_1030404213300025916Corn, Switchgrass And Miscanthus RhizosphereSDVLLAVPKLEERLTAAGITPEQIDSALEPSGYLGSADAFITAALDAHRTREVPSG
Ga0207665_1087754213300025939Corn, Switchgrass And Miscanthus RhizosphereLAAGVTAEQIDAALEPSGYLGSADAFITAALDAHQARENRDG
Ga0209266_130459213300026327SoilQDVLLAVPKLEERLSAAGITPEQIEAALEPSGYLGATDAFITAALDAHEKLGDRHG
Ga0257152_103686523300026369SoilLLAVPKLEERLSAVGITPEQVEAALEPSGYLGATDAFITGALDAHEKLGDRHG
Ga0257159_101300533300026494SoilERLSAVGITPEQIEAALEPSGYLGATDAFITGALDAHEKLGDRHG
Ga0209161_1047640713300026548SoilPKLEERLSSAGITAEQIDSALEPSGYLGSAGAFVTAALDAHDALEARDG
Ga0209648_1045265713300026551Grasslands SoilEERLSSAGVPPEQIDAALEPSGYLGASGAFVTAALEAHESLEVPNG
Ga0209522_101023413300027119Forest SoilPKLEERLSAAGITAEQIDSALEPSGYLGAADAFVAAALDAHEALEVHHG
Ga0209040_1001621613300027824Bog Forest SoilAAGITAEQIDSALDPAGYLGATDAFITAALEAHRSSSREVPSG
Ga0209693_1010317213300027855SoilQVGQALDPAGYLGAAGAFVAAALAAHTSTEQNGRP
Ga0209380_1050336023300027889SoilITAEQIDSALEPAGYLGATDAFITAALEAHRSWEVSSG
Ga0209068_1098413313300027894WatershedsLPLRDVLLAVPKLEERLSSAGITAEQIDSALEPSGYLGVADSFVAAALDEHQALEARLG
Ga0307311_1005034633300028716SoilTSAGLPLRDVLLAVPKLEERLSSAGITAEQIDSALEPSGYLGSTDAFITAAIDAHEKPENRHG
Ga0307282_1034495333300028784SoilTAEQIDSALEPSGYLGAAGAFVTAALDAHTALEARHG
Ga0307308_1034966713300028884SoilLSSAGITAEQIDSALEPSGYLGAAGAFVTAALDAHKALEARHG
Ga0311356_1039177513300030617PalsaEDRLVSAGITAEQIDAALEPAGYLGAADAFTVAALDAHEALNLQESRHG
Ga0318534_1003261653300031544SoilAEQIDSALEPAGYLGSADAFITAALDAHQSLEAAEAKETGHG
Ga0318538_1029554533300031546SoilLLSVPKLEERLSAAGITAEQIDSALEPSGYLGAADAFVTAALDAHEALEVHHG
Ga0318528_1008686113300031561SoilEAGARAVGAGLPLSDVLLAVPALEERLSSAGITPEQIDAALEPSGYLGASDAFITAALEAHESLQVPHG
Ga0318573_1044612113300031564SoilLEERLAAAGVTAEQIDSALEPSGYLGAADAFVTAALDAHEAWGIHHG
Ga0318515_1017374033300031572SoilLEERLSAVGITAEQIDSALEPSGYLGAADAFVTAALDAHEALGVRHG
Ga0318561_1043870913300031679SoilDVLLAVPKLEERLSAAGITPEQIEAALEPSGYLGATDAFITAALDAHEALEVRHG
Ga0318572_1004994833300031681SoilVSAGLPLRDVLLSVPKLEERLSAAGITAEQIDSALEPSGYLGAADAFVTAALDAHEALEVHHG
Ga0310686_10609545613300031708SoilKLEERLSAAGITAEQIDSALEPAGYLGATDAFITAALEAHRSWEVSSG
Ga0307474_1049936213300031718Hardwood Forest SoilSARAIGAGLPLRDVLLGVPELADRLAAAGVTPEQVEAALEPSGYLGASGAFIDAALRVHEGIRSTDE
Ga0306917_1025784933300031719SoilWAVSAGLPLRDVLLAVPKLEERLSAVGITAEQIDSALEPSGYLGAADAFVTAALDAHEALGVRHG
Ga0306917_1085348623300031719SoilDVLLAVPKLEGRLASAGITPEQIESALEPVGYLGAADAFVTAALQAHDALEAQLSEGDDD
Ga0318501_1012248413300031736SoilGLCLCGIAAEQIDSALEPAGYLGSADAFITAALDAHQSLEAAEAKETGHG
Ga0306918_1062816213300031744SoilRLSAAGITAEQIDSALEPSGYLGSADAFITAALDAHQSLEAAEATETGHG
Ga0318526_1006476413300031769SoilRLSAAGITAEQIDSALEPAGYLGSADAFITAALDAHQSLEAAEAKETGHG
Ga0318526_1012084933300031769SoilLSAVGITAEQIDSALEPSGYLGAADAFVTAALDAHEALGVRHG
Ga0318498_1007875713300031778SoilPQLEERLAAAGVTAEQIDSALEPSGYLGAADAFVTAALDAHEAWGIHHG
Ga0318523_1045871713300031798SoilAEQIDSALEPSGYLGATGAFITAALEAHESLGVPDG
Ga0318497_1008488313300031805SoilVLLAVPKLEERLSAVGITAEQIDSALEPSGYLGAADAFVTAALDAHEALGVRHG
Ga0307478_1072816133300031823Hardwood Forest SoilSSAGITAEQIDSALEPSSYLGSAGAFVTAALDAHQKLGNLHG
Ga0318564_1048823613300031831SoilDVLLAVPKLEERLTAAGITPEQIEAALEPSGYLGSADSFVTAALGAHEKLGERHG
Ga0318527_1051814423300031859SoilRPRARLGHQVVPKLEERLSAAGITPEQIEAALEPSGYLGATDAFITAALDAHEALEVRHG
Ga0318544_1013562713300031880SoilKLEERLSAAGITAEQIDAALEPAGYLGATDAFITAALEAHEAVGVSDG
Ga0318551_1023972013300031896SoilLEERLTAAGITPEQIEAALEPSGYLGSAGSFVTAALDAHEKRGERHG
Ga0318551_1027258133300031896SoilVLLSVPKLEERLSAAGITAEQIDSALEPSGYLGAADAFVTAALDAHEALEVHHG
Ga0318520_1010636613300031897SoilSVPKLEERLSAAGITAEQIDSALEPSGYLGAADAFVTAALDAHEALEVHHG
Ga0310912_1091226123300031941SoilVAEAGARAVSAGLPLRDVLLAVPKLEERLSAVGITAEQIDSALEPSGYLGAADAFVTAALDAHEALGVRHG
Ga0310910_1150996823300031946SoilSAGLPLRDVLLAVPKLEGRLASAGITPEQIESALEPVGYLGAADAFVTAALQAHDALEAQLSEGDDDG
Ga0306926_1056749743300031954SoilERLTAAGITPEQIDSALEPSGYLGSADAFVTAALHAHRSGGSRNG
Ga0306926_1103261833300031954SoilPKLEERLTAAGITPEQIEAALEPSGYLGSADSFVTAALGAHEKLGERHG
Ga0306926_1144116213300031954SoilVLLSVPRLEERLSAAGITAEQIDSALEPSGYLGSADAFITAALDAHQSLEAAEAKETGHG
Ga0318549_1012674313300032041SoilAGARAVSAGLPLQDVLLAVPKLEERLSAAGITPEQIEAALEPSGYLGATDAFITAALDAHEALEVRHG
Ga0318570_1022470533300032054SoilRLSAAGITAEQIDSALEPAGYLGSADAFITAALDAHQSLEAAKAQEAGPG
Ga0318505_1006301433300032060SoilAVSAGLPLQDVLLAVPKLEERLSAAGITPEQIEAALEPSGYLGATDAFITAALDAHEALEVRHG
Ga0318504_1023581613300032063SoilVGITAEQIDSALEPSGYLGAADAFVTAALDAHEALGVRHG
Ga0318553_1045941023300032068SoilLAVPKLEEQLSAAGITPEQIEAALEPSGYLGATDAFITAALDAHEALEVRHG
Ga0308173_1065816613300032074SoilAGLPLSDVLLAVPKLEERLTAAGITPEQIDSALEPSGYLGSADAFITAALDAHRTRGVVPNG
Ga0318525_1047814123300032089SoilSAGITAEQIESALEPAGYLGAADAFITAALEAHKSLEAPDG
Ga0318518_1047657223300032090SoilVPNLEERLSAAGITAEQIDSALEPSGYLGATGAFITAALEAHESLGVPDG
Ga0335085_1159028623300032770SoilGLPLRDVLLAVPKLEERLSAAGITAEQIDAALEPSGYLGAADAFITAALDAHQSLATAEAKETGHG
Ga0335080_1122812413300032828SoilRDVLLSVPKLEERLSAAGITAEQIDSALEPSGYLGAADAFVASALDAHEALEVHHG
Ga0335069_1036334913300032893SoilKLEERLSAAGITAEQIESALEPSGYLGSADAFITAALEAHQLLEAAEAKEAGHG
Ga0335071_1104479513300032897SoilLAVPRLEERLSAAGITAEQIEAALEPSGYLGATDAFITAALDAHEKLGGRRG
Ga0335072_1128574623300032898SoilEERLTAAGITAEQIDSALEPSGYLGSADAFITAALDAHNSRGFPHG
Ga0370483_0071015_2_1393300034124Untreated Peat SoilASAGITAEQIDSALEPAGYLGVTDAMITATLDAHETLKLQESQHG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.