| Basic Information | |
|---|---|
| Family ID | F051106 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 45 residues |
| Representative Sequence | AAYPAVPAFIELQKQLSAAIDKQAAALAARPVPGERLLATA |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.70 % |
| % of genes near scaffold ends (potentially truncated) | 95.14 % |
| % of genes from short scaffolds (< 2000 bps) | 89.58 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.278 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.694 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.694 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.38% β-sheet: 0.00% Coil/Unstructured: 53.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF02566 | OsmC | 61.81 |
| PF00486 | Trans_reg_C | 4.86 |
| PF07690 | MFS_1 | 2.08 |
| PF13535 | ATP-grasp_4 | 1.39 |
| PF00903 | Glyoxalase | 1.39 |
| PF13191 | AAA_16 | 0.69 |
| PF01904 | DUF72 | 0.69 |
| PF03591 | AzlC | 0.69 |
| PF13006 | Nterm_IS4 | 0.69 |
| PF13377 | Peripla_BP_3 | 0.69 |
| PF01022 | HTH_5 | 0.69 |
| PF03992 | ABM | 0.69 |
| PF01042 | Ribonuc_L-PSP | 0.69 |
| PF11139 | SfLAP | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 61.81 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 61.81 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.69 |
| COG1296 | Predicted branched-chain amino acid permease (azaleucine resistance) | Amino acid transport and metabolism [E] | 0.69 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.28 % |
| Unclassified | root | N/A | 34.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS401CMF4V | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300000956|JGI10216J12902_118250462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300004281|Ga0066397_10160250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300004633|Ga0066395_10843138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300005434|Ga0070709_10767147 | Not Available | 755 | Open in IMG/M |
| 3300005549|Ga0070704_101225252 | Not Available | 685 | Open in IMG/M |
| 3300005560|Ga0066670_10114205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1532 | Open in IMG/M |
| 3300005617|Ga0068859_101187434 | Not Available | 840 | Open in IMG/M |
| 3300005764|Ga0066903_100927228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1580 | Open in IMG/M |
| 3300005981|Ga0081538_10281386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
| 3300006028|Ga0070717_10055276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3274 | Open in IMG/M |
| 3300006580|Ga0074049_12460919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 924 | Open in IMG/M |
| 3300006581|Ga0074048_10668792 | Not Available | 697 | Open in IMG/M |
| 3300006876|Ga0079217_10830441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 647 | Open in IMG/M |
| 3300009100|Ga0075418_12510236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300009156|Ga0111538_10001630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 31574 | Open in IMG/M |
| 3300009157|Ga0105092_10840634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300009545|Ga0105237_12139315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300009809|Ga0105089_1041893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
| 3300009814|Ga0105082_1017824 | Not Available | 1058 | Open in IMG/M |
| 3300009815|Ga0105070_1099091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300009818|Ga0105072_1022626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1151 | Open in IMG/M |
| 3300009822|Ga0105066_1050500 | Not Available | 872 | Open in IMG/M |
| 3300009822|Ga0105066_1051332 | Not Available | 866 | Open in IMG/M |
| 3300010038|Ga0126315_10422726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 840 | Open in IMG/M |
| 3300010038|Ga0126315_11012993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300010040|Ga0126308_10511620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 812 | Open in IMG/M |
| 3300010040|Ga0126308_10516808 | Not Available | 808 | Open in IMG/M |
| 3300010041|Ga0126312_11089546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300010043|Ga0126380_10277618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1178 | Open in IMG/M |
| 3300010043|Ga0126380_11965099 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300010043|Ga0126380_12270809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300010046|Ga0126384_11147498 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300010358|Ga0126370_10474679 | Not Available | 1050 | Open in IMG/M |
| 3300010361|Ga0126378_10382798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1518 | Open in IMG/M |
| 3300010361|Ga0126378_11884031 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300010371|Ga0134125_10910418 | Not Available | 966 | Open in IMG/M |
| 3300010373|Ga0134128_12507999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300010398|Ga0126383_10949933 | Not Available | 947 | Open in IMG/M |
| 3300010398|Ga0126383_12013708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 665 | Open in IMG/M |
| 3300010861|Ga0126349_1139096 | Not Available | 890 | Open in IMG/M |
| 3300010905|Ga0138112_1032520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1732 | Open in IMG/M |
| 3300011107|Ga0151490_1115327 | Not Available | 666 | Open in IMG/M |
| 3300012200|Ga0137382_10035320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3024 | Open in IMG/M |
| 3300012206|Ga0137380_10995542 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300012224|Ga0134028_1207489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300012353|Ga0137367_10025402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4596 | Open in IMG/M |
| 3300012355|Ga0137369_10382306 | Not Available | 1020 | Open in IMG/M |
| 3300012360|Ga0137375_10193308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1934 | Open in IMG/M |
| 3300012385|Ga0134023_1203270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 661 | Open in IMG/M |
| 3300012476|Ga0157344_1008650 | Not Available | 702 | Open in IMG/M |
| 3300012937|Ga0162653_100050069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300012958|Ga0164299_11240327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300012971|Ga0126369_13166043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300012985|Ga0164308_11733319 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300012989|Ga0164305_10731853 | Not Available | 812 | Open in IMG/M |
| 3300013296|Ga0157374_12318294 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300016387|Ga0182040_10055747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 2485 | Open in IMG/M |
| 3300018052|Ga0184638_1187913 | Not Available | 731 | Open in IMG/M |
| 3300018089|Ga0187774_10458433 | Not Available | 792 | Open in IMG/M |
| 3300018466|Ga0190268_10805267 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300018466|Ga0190268_11753350 | Not Available | 557 | Open in IMG/M |
| 3300018468|Ga0066662_12535180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
| 3300018476|Ga0190274_11272315 | Not Available | 821 | Open in IMG/M |
| 3300018481|Ga0190271_10834353 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300018482|Ga0066669_10421451 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300019377|Ga0190264_10936537 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300019377|Ga0190264_11899465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
| 3300020016|Ga0193696_1065020 | Not Available | 954 | Open in IMG/M |
| 3300020582|Ga0210395_11171002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300021171|Ga0210405_10818957 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300021406|Ga0210386_10680915 | Not Available | 887 | Open in IMG/M |
| 3300021475|Ga0210392_10709455 | Not Available | 749 | Open in IMG/M |
| 3300021478|Ga0210402_10386175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1300 | Open in IMG/M |
| 3300025898|Ga0207692_11165928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300025942|Ga0207689_10305864 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300027209|Ga0209875_1034537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300027909|Ga0209382_12088507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300028720|Ga0307317_10024983 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300028721|Ga0307315_10230913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300028722|Ga0307319_10258894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300028722|Ga0307319_10270282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
| 3300028722|Ga0307319_10276026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300028755|Ga0307316_10150472 | Not Available | 829 | Open in IMG/M |
| 3300028771|Ga0307320_10367201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300028796|Ga0307287_10159307 | Not Available | 858 | Open in IMG/M |
| 3300028796|Ga0307287_10263275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 652 | Open in IMG/M |
| 3300028810|Ga0307294_10154237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 768 | Open in IMG/M |
| 3300028881|Ga0307277_10022663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2465 | Open in IMG/M |
| 3300029990|Ga0311336_11333692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
| 3300030516|Ga0268255_10129985 | Not Available | 745 | Open in IMG/M |
| 3300030520|Ga0311372_11085495 | Not Available | 1042 | Open in IMG/M |
| 3300031114|Ga0308187_10109506 | Not Available | 870 | Open in IMG/M |
| 3300031114|Ga0308187_10401258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300031543|Ga0318516_10327788 | Not Available | 884 | Open in IMG/M |
| 3300031544|Ga0318534_10008488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5047 | Open in IMG/M |
| 3300031548|Ga0307408_100099822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2209 | Open in IMG/M |
| 3300031548|Ga0307408_100329127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1289 | Open in IMG/M |
| 3300031564|Ga0318573_10722376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300031640|Ga0318555_10301962 | Not Available | 866 | Open in IMG/M |
| 3300031680|Ga0318574_10284613 | Not Available | 959 | Open in IMG/M |
| 3300031713|Ga0318496_10744032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300031744|Ga0306918_10827748 | Not Available | 722 | Open in IMG/M |
| 3300031748|Ga0318492_10434940 | Not Available | 692 | Open in IMG/M |
| 3300031764|Ga0318535_10472385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300031765|Ga0318554_10744301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
| 3300031765|Ga0318554_10846929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 511 | Open in IMG/M |
| 3300031779|Ga0318566_10060713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 1812 | Open in IMG/M |
| 3300031782|Ga0318552_10017326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3134 | Open in IMG/M |
| 3300031793|Ga0318548_10233641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 903 | Open in IMG/M |
| 3300031794|Ga0318503_10186873 | Not Available | 671 | Open in IMG/M |
| 3300031798|Ga0318523_10197323 | Not Available | 1005 | Open in IMG/M |
| 3300031799|Ga0318565_10178390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1032 | Open in IMG/M |
| 3300031805|Ga0318497_10137170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 1333 | Open in IMG/M |
| 3300031819|Ga0318568_10279592 | Not Available | 1035 | Open in IMG/M |
| 3300031821|Ga0318567_10744125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
| 3300031833|Ga0310917_10680648 | Not Available | 697 | Open in IMG/M |
| 3300031846|Ga0318512_10234543 | Not Available | 903 | Open in IMG/M |
| 3300031879|Ga0306919_10085511 | All Organisms → cellular organisms → Bacteria | 2185 | Open in IMG/M |
| 3300031893|Ga0318536_10385254 | Not Available | 708 | Open in IMG/M |
| 3300031901|Ga0307406_10236678 | Not Available | 1367 | Open in IMG/M |
| 3300031942|Ga0310916_11322657 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300031954|Ga0306926_11227191 | Not Available | 879 | Open in IMG/M |
| 3300031995|Ga0307409_101465719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 709 | Open in IMG/M |
| 3300032002|Ga0307416_101725282 | Not Available | 731 | Open in IMG/M |
| 3300032002|Ga0307416_102496914 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300032005|Ga0307411_10036212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3090 | Open in IMG/M |
| 3300032043|Ga0318556_10506637 | Not Available | 631 | Open in IMG/M |
| 3300032055|Ga0318575_10128463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1248 | Open in IMG/M |
| 3300032059|Ga0318533_10812728 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300032060|Ga0318505_10329467 | Not Available | 721 | Open in IMG/M |
| 3300032064|Ga0318510_10289356 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300032065|Ga0318513_10551206 | Not Available | 564 | Open in IMG/M |
| 3300032068|Ga0318553_10331398 | Not Available | 796 | Open in IMG/M |
| 3300032090|Ga0318518_10644119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300032091|Ga0318577_10230242 | Not Available | 887 | Open in IMG/M |
| 3300032126|Ga0307415_100005187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6881 | Open in IMG/M |
| 3300032126|Ga0307415_100108962 | All Organisms → cellular organisms → Bacteria | 2050 | Open in IMG/M |
| 3300032261|Ga0306920_101101632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1152 | Open in IMG/M |
| 3300032770|Ga0335085_10400430 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
| 3300032770|Ga0335085_11531112 | Not Available | 693 | Open in IMG/M |
| 3300034417|Ga0364941_013239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1589 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.94% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 6.25% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.47% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.08% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.08% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.08% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.39% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.39% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.69% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.69% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.69% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.69% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010905 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030516 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_01234400 | 2189573004 | Grass Soil | IFDITCRLAAYPATAMFIELQKQLSAAIDNQAAALAARPVPGECLLATA |
| JGI10216J12902_1182504621 | 3300000956 | Soil | PPLPTFVELHKRVGAVIDNEAATLAARPVPGEQALACA* |
| Ga0066397_101602501 | 3300004281 | Tropical Forest Soil | TCALVVYPPVADFVELQRQLGGAIDTGAAALAARPIPGERELVPT* |
| Ga0066395_108431381 | 3300004633 | Tropical Forest Soil | YPPVAEFVELQKQLSAAIDVEAAAVAARPVPGLPAYACG* |
| Ga0070709_107671472 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | FEITCRLAAYPAVPAFIELQKQLSAAIDSEAAALASWPVPGDRLLATA* |
| Ga0070704_1012252521 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | AYPAVPAFIALQKKLSAAIDFEAAALASRPVPGDRLLATA* |
| Ga0066670_101142051 | 3300005560 | Soil | AAYPAVPAFIELQKQLSAAIDKQAAALAARPVPGERLLATA* |
| Ga0068859_1011874342 | 3300005617 | Switchgrass Rhizosphere | LREIFEITRRLGAYPAVPAFIALQKKLSAAIDFEAAALASRPVPGDRLLATA* |
| Ga0066903_1009272281 | 3300005764 | Tropical Forest Soil | QRDQALAEIFGITCQLGAFPPVPAFIALQKQLSAAIEAEAAALAARPLLGQQLLATA* |
| Ga0068860_1024481942 | 3300005843 | Switchgrass Rhizosphere | RFVQLQKQLSQALDTEAAQLAARPVPGVREPVTA* |
| Ga0081538_102813861 | 3300005981 | Tabebuia Heterophylla Rhizosphere | AAYPPVPAFVELQKQLSAAIDKDAAALAARAAPGERLLATA* |
| Ga0070717_100552766 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PAFIELQKQLSAAIDTEAAALASRPVPGERLLATA* |
| Ga0074049_124609192 | 3300006580 | Soil | EEIFELTCRLAAYPPVPAFIELQKQLSAAIDNEAAALATRPVPGECLLASA* |
| Ga0074048_106687921 | 3300006581 | Soil | LRELFEITCALAKFPPAHHFIELQKQLSAAMDNQAAAIATRPDPWLATA* |
| Ga0079217_108304412 | 3300006876 | Agricultural Soil | FQITCSLAAYPPVARFIELQKQLSAAIDKQAAALAARPIPGSSLLATA* |
| Ga0075418_125102361 | 3300009100 | Populus Rhizosphere | DQALGEIFELTCQLGAYPPVPRFVELQKQLSAAIDTQATALAARPVPDERLLATA* |
| Ga0111538_1000163030 | 3300009156 | Populus Rhizosphere | VPAFIALQKQLSAAIDDEAAALAARPIPGERLLATA* |
| Ga0105092_108406341 | 3300009157 | Freshwater Sediment | ITCRLAAYPPVPTFVQLQKQLGAAIDTQAAALAARPIPGRLLLATA* |
| Ga0105237_121393151 | 3300009545 | Corn Rhizosphere | REIFEITRRLGAYPAVPAFIALQKKLSAAIDFEAAALASRPVPGDRLLATA* |
| Ga0105089_10418931 | 3300009809 | Groundwater Sand | IFEITCRLAAYPPVPAFVELQKQLGAAIDKEAAALAARPVPGERRLATT* |
| Ga0105082_10178242 | 3300009814 | Groundwater Sand | PAFVELQKQLSAAIDKEAAALAARPVPGERRLATA* |
| Ga0105070_10990912 | 3300009815 | Groundwater Sand | TCRLAAYPPVPAFIELQKRLSAAIDTQAAALAARPVPGERRLATT* |
| Ga0105072_10226261 | 3300009818 | Groundwater Sand | FEITCRLAAYPPVPTFIDLQKQLGAAIDKEAMALTARPIPGECLLVTA* |
| Ga0105066_10505001 | 3300009822 | Groundwater Sand | YQQLRDQALREIFELTCRLAAYPAVPTFIELQKQLSAAIDREAAALAARPVPGEFVLASA |
| Ga0105066_10513322 | 3300009822 | Groundwater Sand | SAYPPVPAFVELQKQLSAAIDKEAAALAARPVPGERRLATT* |
| Ga0126315_104227262 | 3300010038 | Serpentine Soil | VPAFIALQKQLSAAIDREAAALAARPVPGERLLATA* |
| Ga0126315_110129931 | 3300010038 | Serpentine Soil | PVPAFIALQKQLSAAIDREAAALAARPVPGARLLATA* |
| Ga0126308_105116202 | 3300010040 | Serpentine Soil | FEITCHLAAYPPVPTFVQLQKQLGGAIDKEAAALAARPVPGERRLATA* |
| Ga0126308_105168081 | 3300010040 | Serpentine Soil | LREIFEITCRLAAYPPVPAFIALQKQLSAAIDREAAALAARPVPGARLLATA* |
| Ga0126312_110895461 | 3300010041 | Serpentine Soil | DQALAEIFQITCSLAADPPVARFIELQKQLSTAIDKQAAALAARPIPGSSLLATA* |
| Ga0126380_102776183 | 3300010043 | Tropical Forest Soil | VPAFIELQKQLSAANDKEATALASWPIPGERLLATA* |
| Ga0126380_119650992 | 3300010043 | Tropical Forest Soil | PAVPAFIELQKQLSAAIDSEAAALASWPVPGDRLLATA* |
| Ga0126380_122708092 | 3300010043 | Tropical Forest Soil | EIFEITCRLGAYPAVPAFIALQKQLSAAIDSEAAALASWPVPGDRLLATA* |
| Ga0126384_111474981 | 3300010046 | Tropical Forest Soil | RDQALREIFEITCRLAAYPAVPAFITLQKQLSAAIDAEAAALASRPIPGERLLATA* |
| Ga0126370_104746791 | 3300010358 | Tropical Forest Soil | RQRDQALREIFEITCRLGAYPAVPAFIDLQKQLSAAIDTEAAALASRPVPGERLLATA* |
| Ga0126378_103827983 | 3300010361 | Tropical Forest Soil | SYPPVPAFIELQKQLSAAIDAEAAALAAWPIPGQRLLATA* |
| Ga0126378_118840312 | 3300010361 | Tropical Forest Soil | REIFEITCRLAAYLVVPAFIELQKQLSAAIDSEAAALASWPVPGDRLLATA* |
| Ga0134125_109104181 | 3300010371 | Terrestrial Soil | PAVPAFIELQKQLSAAIDSETAALASWPVPGERLLATA* |
| Ga0134128_125079991 | 3300010373 | Terrestrial Soil | AYPAVPAFIELQKQLSAAIDSEAAALASWPVPGERLLATA* |
| Ga0126383_109499331 | 3300010398 | Tropical Forest Soil | YPPVPAFIELQKQLSAAIDKQAAVLAARPAPAERLLATA* |
| Ga0126383_120137081 | 3300010398 | Tropical Forest Soil | EQRDRALAEIFGITCQLSSYPPVPTFIELQKQLSAAIDAEAAALAAWPLPGQRLLATA* |
| Ga0126349_11390961 | 3300010861 | Boreal Forest Soil | CRLAAYPAVSAFIELQKQLSAAIDKQAAALAARPVPGERLLATA* |
| Ga0138112_10325203 | 3300010905 | Grasslands Soil | FELTCRLAAYPAVPKFVELQKQLSAAIDREAAALAARPVPGERVLASA* |
| Ga0151490_11153271 | 3300011107 | Soil | PVPAFTGLQKQLSAAIDAEAAALATRPVPGECLLASA* |
| Ga0137382_100353202 | 3300012200 | Vadose Zone Soil | MFIELQKQLSAAIDKQAAALAARPVPGERLLETA* |
| Ga0137380_109955421 | 3300012206 | Vadose Zone Soil | LAAYPPVPTFIELQKQLSAAIDKEAVALAARPIPGERLLATA* |
| Ga0134028_12074891 | 3300012224 | Grasslands Soil | EIFELTCRLAAYPAVPKFVELQKQLSAAIDREAAALAARPVPGERVLASA* |
| Ga0137367_100254021 | 3300012353 | Vadose Zone Soil | AYPPVPTFIELQKQLSAAIDRQAAALAARPIPAQRLLATA* |
| Ga0137369_103823063 | 3300012355 | Vadose Zone Soil | FEITCRLAAYPAVPTFIELQKQLGAAIDREAAALAARPIPGERLLATA* |
| Ga0137375_101933081 | 3300012360 | Vadose Zone Soil | LAAYPAVPTFIELQKQLGAAIDREAAALAARPIPGERLLATA* |
| Ga0134023_12032701 | 3300012385 | Grasslands Soil | LREIFELTCRLAAYPAVPKFVELQKQLSAAIDREAAALAARPVPGERVLASA* |
| Ga0157344_10086502 | 3300012476 | Arabidopsis Rhizosphere | EIFEITCRLAAYPAVSAFIELQKQLSAAIDSEAAALASWPVPGERLLATA* |
| Ga0162653_1000500691 | 3300012937 | Soil | QALREIFELTCHLAAYPPVPTFIELQKQLSVAIDREAAALATRPVPGQRLLATA* |
| Ga0164299_112403272 | 3300012958 | Soil | IFEITCRLAAYPAVPAFIALQKQLNAAIDSEAAALASRPVPGERLLATA* |
| Ga0126369_131660431 | 3300012971 | Tropical Forest Soil | APAFIELQKQLSAAIDNEAAALAARPFPGEHLLATA* |
| Ga0164308_117333192 | 3300012985 | Soil | ALREIFEITCRLAAYPAVPAFIELQKQLSAAIDSEAAALASWPVPGDRLLATA* |
| Ga0164305_107318532 | 3300012989 | Soil | EIFEITRRLGAYPAVPAFIALQKQLSAAIDSEAAALASRPVPGERLLATA* |
| Ga0157374_123182942 | 3300013296 | Miscanthus Rhizosphere | PAVPAFIALQKQLSAAIDSEAAALASRPVPGDRLLATA* |
| Ga0182040_100557471 | 3300016387 | Soil | PVPTFIELQKQLSAAIDTEATALAAQPIPGERLLATA |
| Ga0184638_11879132 | 3300018052 | Groundwater Sediment | EVFELTCRLSAYPPVPAFVELQKQLGGAIDKQSAALAARPVPGERRLATA |
| Ga0187774_104584332 | 3300018089 | Tropical Peatland | LAAYPAVPAFIAQQKQLSAANDAEATALASWPVPGERLLATA |
| Ga0190268_108052672 | 3300018466 | Soil | TCRLAAYPPVPAFVELQKQLSAAIDTEATALAARPAPGERLLASV |
| Ga0190268_117533501 | 3300018466 | Soil | AAYPPMPTFVELQKRLSAAIDTEAAALAARPVPGEQLLATA |
| Ga0066662_125351801 | 3300018468 | Grasslands Soil | LYQQQRDQALREIFEITCRLAAYPAVPAFIELQKQLSAAIDKQAAALAARPVPGERLLAT |
| Ga0190274_112723151 | 3300018476 | Soil | AYPPVPRFIELQKRLGVAIDTQAAALAARPVPGERLLSTA |
| Ga0190271_108343533 | 3300018481 | Soil | FPPVHRFIELQKQLARAIDNQAGTLAARPIPALPAVA |
| Ga0066669_104214511 | 3300018482 | Grasslands Soil | ITCRLAAYPPVPAFTGLQKQLSAAIDKQAAALAARPVPGEFLLATA |
| Ga0190264_109365371 | 3300019377 | Soil | REIFELTCRLSAYPPVPTFIELQKQLSAAIDKDAAALAARPIPGERLLATA |
| Ga0190264_118994652 | 3300019377 | Soil | EIFELTCRLVAYPPVPRFIELQKQLGAAIDKQAAALAARPIPGERLLATA |
| Ga0193696_10650201 | 3300020016 | Soil | FEITCRLAAYPTVPTFIELQKQLGAAIDKEAAALAARPIPGERLLATA |
| Ga0210395_111710021 | 3300020582 | Soil | FEITCRLAAYPAVPAFIELQKQLSAAIDRQATALAARPVPGERLLAAT |
| Ga0210405_108189572 | 3300021171 | Soil | YPAVPAFIELQKQLSAAIDKQAAALAARPVPGERLLATA |
| Ga0210386_106809152 | 3300021406 | Soil | AVPAFIELQKQLSAAIDRQATALAARPVPGERLLAAT |
| Ga0210392_107094551 | 3300021475 | Soil | QRQRDHALREIFEITCRLGAYPAVPAFIALQKQLSAAIDSEAAALASRPVSGDRLLATA |
| Ga0210402_103861753 | 3300021478 | Soil | RLAAYPAVPAFIELQKQLSAAIDSEAAALASWPVPGDRLLATA |
| Ga0207692_111659281 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AVPAFIELQKQLSAAIDSEAAALASWPVPGDRLLATA |
| Ga0207689_103058641 | 3300025942 | Miscanthus Rhizosphere | YPAVPAFIALQKKLSAAIDFEAAALASRPVPGDRLLATA |
| Ga0209875_10345371 | 3300027209 | Groundwater Sand | SLREIFEITCRLAAYPPVPTFIELQKQLSAAIDKEAAALAARPIPGERLLATA |
| Ga0209465_103361621 | 3300027874 | Tropical Forest Soil | DLTCSIVAYPPVAEFVELQKQLSAAIDVEAAAVAARPVPGLPAYACG |
| Ga0209382_120885072 | 3300027909 | Populus Rhizosphere | AAYPAMPAFIELQKRLSVEIDCAAAALADRPVPGERLLAAT |
| Ga0307317_100249834 | 3300028720 | Soil | TCRLAAYPTVPTFIELQKQLGAAIDKEAAALAARPIPGERLLATA |
| Ga0307315_102309132 | 3300028721 | Soil | TVPTFIELQKQLGAAIDKEAAALAARPIPGERLLATA |
| Ga0307319_102588942 | 3300028722 | Soil | YPPVPRFIELQKQLSAAIDREAAALAARPVPGEQLLATA |
| Ga0307319_102702821 | 3300028722 | Soil | EIFELTCRLAAYPPVPRFIELQKQLSAAIDKEAAALAARPVPGQRLLASV |
| Ga0307319_102760261 | 3300028722 | Soil | YPPVPRFIELQKQLGAAIDKQAAALAARPVPGERLLATA |
| Ga0307316_101504721 | 3300028755 | Soil | RLAAFPPVPTFIGLQKQLSAAIDTEAAALAARPVPGQRLLASA |
| Ga0307320_103672011 | 3300028771 | Soil | ALREIFELTCRLAAYPPVPRFIELQKQLGAAIDKQAAALAARPVPGERLLATA |
| Ga0307287_101593071 | 3300028796 | Soil | IFEITCRLAAYPTVPTFIELQKQLGAAIDKEAAALAARPIPGKRLLATA |
| Ga0307287_102632751 | 3300028796 | Soil | TCRLAAYPPVPDFIGLQKQLSVAIDREAAALAARPVPGERLLATA |
| Ga0307294_101542372 | 3300028810 | Soil | QQQRYEAIREIFEITCRLAAYPTVPTFIELQKQLGAAIDKEAAALAARPIPGERLLATA |
| Ga0307277_100226633 | 3300028881 | Soil | VPTFVELQKQLGAAIDKDAAALAARPIPGERLLATA |
| Ga0311336_113336922 | 3300029990 | Fen | DSQLREIFEITCALSNFPAADRFIELQRQLNAAIDTQAAALAARPDPWLATA |
| Ga0268255_101299852 | 3300030516 | Agave | TCRLAAFPPVPAFIGLQKQLSAAIDTEAAALATRPVPSERLLATA |
| Ga0311372_110854951 | 3300030520 | Palsa | AVPAFIELQKQLSAAIDKQAEVLAARPVPGERLLITA |
| Ga0308187_101095062 | 3300031114 | Soil | PVPTFVELQKRLSTAIDTEAAALAARPVPGERLLATA |
| Ga0308187_104012582 | 3300031114 | Soil | AYPPVPAFIGLQKQLAAAIDKEAAALAARPVPRQRLLASV |
| Ga0318516_103277881 | 3300031543 | Soil | TCRLAAYPAVPAFIELQKQLSAAIDSEAAALASWPVPGDRLLATA |
| Ga0318534_100084884 | 3300031544 | Soil | LREIFEITCRLAAYPAVPAFIELQKQLSAAIDSEAAALASWPVPGDRLLATA |
| Ga0307408_1000998223 | 3300031548 | Rhizosphere | SAYPPVPAFVELQKQLGGAIDTEAAALAARPVPGERRLATA |
| Ga0307408_1003291273 | 3300031548 | Rhizosphere | YPPVPAFIALQKQLSAAIDREAAALAARPVPGARLLATA |
| Ga0318573_107223762 | 3300031564 | Soil | AEIFGITCQLGAFPPVPAFIALQKQLSAAIDAEAAALAARPIPGQRLLATA |
| Ga0318555_103019622 | 3300031640 | Soil | ITCRLGAFPPVPAFIALQKQLSAAIDAEAAALAARPIPGERLLATA |
| Ga0318574_102846133 | 3300031680 | Soil | LAAYPAVPAFIELQKQLSTAIDSEAAALASWPVPGDRLLATA |
| Ga0318496_107440322 | 3300031713 | Soil | WRLAAFPAVPEFIELQKQLSAANDSEATALASWPIPGERLLATA |
| Ga0306918_108277481 | 3300031744 | Soil | PAVPAFIELQKQLSAAIDSEAAALASWPVPGDRLLATA |
| Ga0318492_104349402 | 3300031748 | Soil | CRLAAYPAVPAFIELQKQLSAANDKEATALASWPIPGERLLATA |
| Ga0318535_104723851 | 3300031764 | Soil | DQALREIFEITCRLAAYPAVPAFIELQKQLSAANDKEATALAARPVPGERLLATG |
| Ga0318554_107443012 | 3300031765 | Soil | PVPAFTALQKQLSAAIDAEAAALASRPVPGERLLATG |
| Ga0318554_108469292 | 3300031765 | Soil | LREIFDITCRLAAYPPVPAFIELQKQLSAAIDKQAKVLAARPDPAEHLLATA |
| Ga0318566_100607133 | 3300031779 | Soil | RQRDQALAEIFGITRQLGAFPPVPAFIALQKQLSAAIDAEAEALAARPIHGQRLLATA |
| Ga0318552_100173261 | 3300031782 | Soil | REIFEITCRLAAYPAVPAFVELQKQLSAAIDSEAAALASWPVPGERLLATA |
| Ga0318548_102336411 | 3300031793 | Soil | AVPAFVELQKQLSAAIDSEAAALASWPVPGERLLATA |
| Ga0318503_101868732 | 3300031794 | Soil | PAVPAFIELQKQLSTAIDSEAAALASWPVPGDRLLATA |
| Ga0318523_101973231 | 3300031798 | Soil | PAFIALQKQLSAAIDAEAAALAARPIHGQRLLATA |
| Ga0318565_101783903 | 3300031799 | Soil | FEITCRLAAYPAVPAFVELQKQLSAAIDSEAAALASWPVPGERLLATA |
| Ga0318497_101371703 | 3300031805 | Soil | QELREIFDITCRLAAYPPVPAFIELQKQLSAAIDKQAKVLAARPDPAEHLLATA |
| Ga0318568_102795921 | 3300031819 | Soil | ALREIFEITCRLAAFPAVPAFIELQKQLSAANDKEATALAARPVPGERLLATG |
| Ga0318567_107441251 | 3300031821 | Soil | FEITCRLAAYPAVPAFIELQKQLSAANDKEATALASWPVSGERLLATA |
| Ga0310917_106806482 | 3300031833 | Soil | IFEITCRLAAYPAVPAFIELQKQLSAANDKEATALASWPVSGERLLATA |
| Ga0318512_102345431 | 3300031846 | Soil | RDQALREIFEITCRLAAYPAVPAFIELQKQLSAANDAEATALASWPIPGERLLATA |
| Ga0306919_100855113 | 3300031879 | Soil | RDQALREIFEITCRLAAFPPVPAFIELQKQLSAANDKEATALASRPILGERLLATA |
| Ga0318536_103852541 | 3300031893 | Soil | QALREIFEITCRLAAYPAVPAFIELQKQLSAAIDSEAAALASWPVPGDRLLATA |
| Ga0307406_102366783 | 3300031901 | Rhizosphere | VPRFIELQKQLSAAIDKEAAALAARPVPAERLLATA |
| Ga0310916_113226572 | 3300031942 | Soil | RQRDQALREIFEITCRLAAYPAVPAFIELQKQLSAAIDSEAAALASWPVPGDRLLATA |
| Ga0306926_112271912 | 3300031954 | Soil | FPPVPAFIALQKQLSAAIDAEAAALAARPIHGQRLLATA |
| Ga0307409_1014657191 | 3300031995 | Rhizosphere | LSAYPPVSAFVELQKQLGGAIDKEAAALAARPVPGERRLATA |
| Ga0307416_1017252821 | 3300032002 | Rhizosphere | ALAAYPPLPTFVELHKRVGIAIDNEAATLAARPVPGEQALASA |
| Ga0307416_1024969141 | 3300032002 | Rhizosphere | PAFVELQKQLGSAIDRQAAALAARPVPGERRLATA |
| Ga0307411_100362123 | 3300032005 | Rhizosphere | EITCRLAGYPPVPAFIDLQKQLSVAIDKEAAALAARPLPGECVLATA |
| Ga0318556_105066371 | 3300032043 | Soil | TCRLAAYPAVPAFIELQKQLSAANDKEATALASWPVSGERLLATA |
| Ga0318575_101284631 | 3300032055 | Soil | ITRQLGAFPPVPAFIALQKQLSAAIDAEAEALAARPIHGQRLLATA |
| Ga0318533_108127282 | 3300032059 | Soil | TCRLAAYPPVPAFIELQKQLSAAIDKQAKVLAARPDPAEHLLATA |
| Ga0318505_103294672 | 3300032060 | Soil | AYPPVPAFIELQKQLSAAIDKQAKVLAARPDPAEHLLATA |
| Ga0318510_102893561 | 3300032064 | Soil | LREIFEITCRLAAYPAVPAFIELQKQLSAANDKEATALASWPVSGERLLATA |
| Ga0318513_105512062 | 3300032065 | Soil | AYPAVPAFIELQKQLSAAIDSEAAALASWPVPGDRLLATA |
| Ga0318553_103313981 | 3300032068 | Soil | CRLAAYPAVPAFIELQKQLSTAIDSEAAALASWPVPGDRLLATA |
| Ga0318518_106441191 | 3300032090 | Soil | GGYPPVPAFTALQKQLSAAIDTEAAALAARPVPGERLLAAG |
| Ga0318577_102302423 | 3300032091 | Soil | VPAFIELQKQLSAAIDSEAAALASWPVPGDRLLATA |
| Ga0307415_1000051871 | 3300032126 | Rhizosphere | AYPPVPAFIALQKQLSAAIDREAAALAARPVPGARLLATA |
| Ga0307415_1001089621 | 3300032126 | Rhizosphere | AYPPVLAFVELQKQLGGAIDKEAAALAARPVPGERRLATA |
| Ga0306920_1011016321 | 3300032261 | Soil | LGAYPPVPTFIELQKQLSAAIDTEATALAAQPIPGERLLATA |
| Ga0335085_104004303 | 3300032770 | Soil | VPAFIGLQKQLSAAIDSEAAALASWPVPGDRLLATA |
| Ga0335085_115311122 | 3300032770 | Soil | ASGGAYPAVPAFIELQKQLSAAIDTEAAALASWPVPGDRLLATA |
| Ga0364941_013239_1482_1589 | 3300034417 | Sediment | SAFVELQKQLGGAIDKEAAALAARPVPGERRLATA |
| ⦗Top⦘ |