| Basic Information | |
|---|---|
| Family ID | F051102 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MKRPDTPLPGLQRHHIVIAIIAIVVAVALVLNYYLW |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.51 % |
| % of genes near scaffold ends (potentially truncated) | 15.28 % |
| % of genes from short scaffolds (< 2000 bps) | 75.69 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.583 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (18.056 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.889 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.19% β-sheet: 0.00% Coil/Unstructured: 57.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF00682 | HMGL-like | 41.67 |
| PF13673 | Acetyltransf_10 | 38.19 |
| PF09190 | DALR_2 | 6.94 |
| PF08502 | LeuA_dimer | 4.86 |
| PF12681 | Glyoxalase_2 | 1.39 |
| PF03641 | Lysine_decarbox | 1.39 |
| PF00664 | ABC_membrane | 0.69 |
| PF07992 | Pyr_redox_2 | 0.69 |
| PF04480 | DUF559 | 0.69 |
| PF01047 | MarR | 0.69 |
| PF12802 | MarR_2 | 0.69 |
| PF01406 | tRNA-synt_1e | 0.69 |
| PF02666 | PS_Dcarbxylase | 0.69 |
| PF00903 | Glyoxalase | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 7.64 |
| COG0119 | Isopropylmalate/homocitrate/citramalate synthases | Amino acid transport and metabolism [E] | 4.86 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 1.39 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0688 | Phosphatidylserine decarboxylase | Lipid transport and metabolism [I] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.58 % |
| Unclassified | root | N/A | 10.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0262586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 532 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1044645 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 684 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10004162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3928 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10004629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3756 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10130314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10003384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3613 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10005266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3000 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10085155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300005332|Ga0066388_106539153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 587 | Open in IMG/M |
| 3300005540|Ga0066697_10150917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1372 | Open in IMG/M |
| 3300005554|Ga0066661_10034460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2818 | Open in IMG/M |
| 3300005555|Ga0066692_10046275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2396 | Open in IMG/M |
| 3300005555|Ga0066692_10837218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 565 | Open in IMG/M |
| 3300005557|Ga0066704_10579104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 726 | Open in IMG/M |
| 3300005560|Ga0066670_10007089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4560 | Open in IMG/M |
| 3300005602|Ga0070762_10697579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 681 | Open in IMG/M |
| 3300005713|Ga0066905_100118810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1839 | Open in IMG/M |
| 3300005713|Ga0066905_100128389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1784 | Open in IMG/M |
| 3300005713|Ga0066905_100199685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1494 | Open in IMG/M |
| 3300005713|Ga0066905_100418269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1092 | Open in IMG/M |
| 3300005713|Ga0066905_100571495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 952 | Open in IMG/M |
| 3300005713|Ga0066905_100839843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 799 | Open in IMG/M |
| 3300005713|Ga0066905_100894701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 776 | Open in IMG/M |
| 3300005713|Ga0066905_101100466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 706 | Open in IMG/M |
| 3300005713|Ga0066905_101125630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 698 | Open in IMG/M |
| 3300005713|Ga0066905_101894747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 551 | Open in IMG/M |
| 3300005713|Ga0066905_102050091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 531 | Open in IMG/M |
| 3300005764|Ga0066903_100229554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2828 | Open in IMG/M |
| 3300005764|Ga0066903_100277425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2623 | Open in IMG/M |
| 3300005764|Ga0066903_103341882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 866 | Open in IMG/M |
| 3300005764|Ga0066903_103728861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 819 | Open in IMG/M |
| 3300005764|Ga0066903_103774533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 814 | Open in IMG/M |
| 3300005764|Ga0066903_103932881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 797 | Open in IMG/M |
| 3300005764|Ga0066903_104692709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 727 | Open in IMG/M |
| 3300005764|Ga0066903_106692926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 599 | Open in IMG/M |
| 3300005764|Ga0066903_107678674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 555 | Open in IMG/M |
| 3300005764|Ga0066903_107897135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 546 | Open in IMG/M |
| 3300005937|Ga0081455_10005505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 13877 | Open in IMG/M |
| 3300005937|Ga0081455_10037182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4327 | Open in IMG/M |
| 3300006028|Ga0070717_10014365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6092 | Open in IMG/M |
| 3300006028|Ga0070717_10176562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1860 | Open in IMG/M |
| 3300006038|Ga0075365_10512936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 848 | Open in IMG/M |
| 3300006604|Ga0074060_10003584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 891 | Open in IMG/M |
| 3300006755|Ga0079222_10773777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 777 | Open in IMG/M |
| 3300006806|Ga0079220_10316797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 973 | Open in IMG/M |
| 3300006852|Ga0075433_10912475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 766 | Open in IMG/M |
| 3300006953|Ga0074063_10093887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1314 | Open in IMG/M |
| 3300009089|Ga0099828_10342383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1347 | Open in IMG/M |
| 3300009100|Ga0075418_12306958 | Not Available | 587 | Open in IMG/M |
| 3300009792|Ga0126374_10032893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2453 | Open in IMG/M |
| 3300009792|Ga0126374_11214495 | Not Available | 604 | Open in IMG/M |
| 3300010043|Ga0126380_10500447 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300010043|Ga0126380_11187055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 657 | Open in IMG/M |
| 3300010043|Ga0126380_11503806 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300010046|Ga0126384_10079473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2357 | Open in IMG/M |
| 3300010046|Ga0126384_12031739 | Not Available | 550 | Open in IMG/M |
| 3300010048|Ga0126373_10592084 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300010333|Ga0134080_10527893 | Not Available | 565 | Open in IMG/M |
| 3300010359|Ga0126376_10467424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1158 | Open in IMG/M |
| 3300010360|Ga0126372_10504308 | Not Available | 1137 | Open in IMG/M |
| 3300010360|Ga0126372_11216886 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 778 | Open in IMG/M |
| 3300010361|Ga0126378_10670969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1149 | Open in IMG/M |
| 3300010361|Ga0126378_12810099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 556 | Open in IMG/M |
| 3300010366|Ga0126379_10225433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1824 | Open in IMG/M |
| 3300010366|Ga0126379_13030572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 562 | Open in IMG/M |
| 3300010376|Ga0126381_103808915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 589 | Open in IMG/M |
| 3300010396|Ga0134126_10287877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1932 | Open in IMG/M |
| 3300010398|Ga0126383_11496628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 765 | Open in IMG/M |
| 3300010403|Ga0134123_11560162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 707 | Open in IMG/M |
| 3300010403|Ga0134123_12033517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 633 | Open in IMG/M |
| 3300010999|Ga0138505_100011368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1034 | Open in IMG/M |
| 3300012022|Ga0120191_10021475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 925 | Open in IMG/M |
| 3300012198|Ga0137364_10009528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5470 | Open in IMG/M |
| 3300012201|Ga0137365_10003417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12662 | Open in IMG/M |
| 3300012202|Ga0137363_10211113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1562 | Open in IMG/M |
| 3300012203|Ga0137399_11741250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 512 | Open in IMG/M |
| 3300012204|Ga0137374_10062981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3708 | Open in IMG/M |
| 3300012206|Ga0137380_10217507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1728 | Open in IMG/M |
| 3300012206|Ga0137380_11332111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 603 | Open in IMG/M |
| 3300012208|Ga0137376_11277892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 624 | Open in IMG/M |
| 3300012351|Ga0137386_10616466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 781 | Open in IMG/M |
| 3300012354|Ga0137366_10452009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 931 | Open in IMG/M |
| 3300012358|Ga0137368_10093209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2360 | Open in IMG/M |
| 3300012918|Ga0137396_10734253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 728 | Open in IMG/M |
| 3300012985|Ga0164308_10594391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 940 | Open in IMG/M |
| 3300012989|Ga0164305_10453839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 997 | Open in IMG/M |
| 3300014150|Ga0134081_10036261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1443 | Open in IMG/M |
| 3300014157|Ga0134078_10004159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3915 | Open in IMG/M |
| 3300015371|Ga0132258_13396764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1093 | Open in IMG/M |
| 3300015374|Ga0132255_106058093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 512 | Open in IMG/M |
| 3300016404|Ga0182037_10199402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1551 | Open in IMG/M |
| 3300018061|Ga0184619_10470257 | Not Available | 558 | Open in IMG/M |
| 3300018431|Ga0066655_10092779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 1673 | Open in IMG/M |
| 3300018433|Ga0066667_10303267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1243 | Open in IMG/M |
| 3300018468|Ga0066662_10143753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1790 | Open in IMG/M |
| 3300018468|Ga0066662_10558185 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1060 | Open in IMG/M |
| 3300020579|Ga0210407_10399723 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300021178|Ga0210408_10096197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2326 | Open in IMG/M |
| 3300021361|Ga0213872_10420753 | Not Available | 540 | Open in IMG/M |
| 3300021432|Ga0210384_11419472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 599 | Open in IMG/M |
| 3300021478|Ga0210402_10443218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1206 | Open in IMG/M |
| 3300021560|Ga0126371_10404704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1507 | Open in IMG/M |
| 3300021560|Ga0126371_11266222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 872 | Open in IMG/M |
| 3300026306|Ga0209468_1009988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3540 | Open in IMG/M |
| 3300026354|Ga0257180_1022569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 825 | Open in IMG/M |
| 3300027061|Ga0209729_1002222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 1776 | Open in IMG/M |
| 3300027119|Ga0209522_1013916 | Not Available | 899 | Open in IMG/M |
| 3300027576|Ga0209003_1046112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 770 | Open in IMG/M |
| 3300027646|Ga0209466_1021169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1352 | Open in IMG/M |
| 3300027654|Ga0209799_1020132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1462 | Open in IMG/M |
| 3300027873|Ga0209814_10057567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1626 | Open in IMG/M |
| 3300027874|Ga0209465_10056525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 1885 | Open in IMG/M |
| 3300027875|Ga0209283_10258721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1153 | Open in IMG/M |
| 3300027882|Ga0209590_10297486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1036 | Open in IMG/M |
| 3300027909|Ga0209382_10118478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3089 | Open in IMG/M |
| 3300027909|Ga0209382_11427116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
| 3300028710|Ga0307322_10203967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 540 | Open in IMG/M |
| 3300028878|Ga0307278_10137408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1096 | Open in IMG/M |
| 3300028878|Ga0307278_10214705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 856 | Open in IMG/M |
| 3300028881|Ga0307277_10000378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 16155 | Open in IMG/M |
| 3300031543|Ga0318516_10012986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4082 | Open in IMG/M |
| 3300031543|Ga0318516_10055084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2173 | Open in IMG/M |
| 3300031543|Ga0318516_10065596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2003 | Open in IMG/M |
| 3300031543|Ga0318516_10755505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 550 | Open in IMG/M |
| 3300031544|Ga0318534_10285789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 951 | Open in IMG/M |
| 3300031561|Ga0318528_10007012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 4963 | Open in IMG/M |
| 3300031682|Ga0318560_10190278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1094 | Open in IMG/M |
| 3300031719|Ga0306917_10642555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 834 | Open in IMG/M |
| 3300031723|Ga0318493_10608722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300031747|Ga0318502_10002762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 6953 | Open in IMG/M |
| 3300031782|Ga0318552_10630082 | Not Available | 547 | Open in IMG/M |
| 3300031795|Ga0318557_10568105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300031897|Ga0318520_10823522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 583 | Open in IMG/M |
| 3300032039|Ga0318559_10248527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 822 | Open in IMG/M |
| 3300032064|Ga0318510_10454702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300032180|Ga0307471_100069625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3027 | Open in IMG/M |
| 3300032261|Ga0306920_100683467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1513 | Open in IMG/M |
| 3300033290|Ga0318519_10127022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1402 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 18.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.19% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.08% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.08% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.39% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.39% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.39% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.39% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.39% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.39% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.69% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027119 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_02625862 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MKEPRASLPTFQRHHAIIAIIAILVAVALVLNYYLW* |
| AF_2010_repII_A01DRAFT_10446452 | 3300000580 | Forest Soil | MKRPNPPLPGLQRHHVVIAIIALVVAVALVLNYYLW* |
| AF_2010_repII_A1DRAFT_100041623 | 3300000597 | Forest Soil | MKRPRTASRFQRHHLVIAVIAIVVAVALVLNYYLW* |
| AF_2010_repII_A1DRAFT_100046293 | 3300000597 | Forest Soil | MKRPNAPLPGLQRHHVVIAIIALVVAVALVLNYYLW* |
| AF_2010_repII_A1DRAFT_101303141 | 3300000597 | Forest Soil | APAMNRPQPPLAGFQRHHVVIAIVAIVVAVALVLNYYLW* |
| AF_2010_repII_A001DRAFT_100033842 | 3300000793 | Forest Soil | MKRPNAPLPGLQRHHVVXAIIALVVAVALVLNYYLW* |
| AF_2010_repII_A001DRAFT_100052664 | 3300000793 | Forest Soil | MKEPRVSLPTFQRHHVIIAIIAILVAVALVLNYYLW* |
| AF_2010_repII_A001DRAFT_100851551 | 3300000793 | Forest Soil | ACCQGAPAMNRPQPPLAGFQRHHVVIAIVAIVVAVALVLNYYLW* |
| Ga0066388_1065391531 | 3300005332 | Tropical Forest Soil | ARAMNRPRTPLPRFQRHHLVIAVIAIVVAVALVLNYYLW* |
| Ga0066697_101509172 | 3300005540 | Soil | MKRSQVPLPPFQRHHLIIATIAIVIAVALVLNYYLW* |
| Ga0066661_100344602 | 3300005554 | Soil | MKRSQVPLPPFQRHHLVIATIAIVIAVALVLNYYLW* |
| Ga0066692_100462752 | 3300005555 | Soil | VKRPSTPPPRLQRHHVVLAIIAVVVAVALVLNYYLW* |
| Ga0066692_108372182 | 3300005555 | Soil | MKRPNTPLPPFQRHHIVIAVVAIVVAVALVLNYYLW* |
| Ga0066704_105791041 | 3300005557 | Soil | MNRPQPPLPPFQRHHVVIAIIAILVAVALVLNYYLW* |
| Ga0066670_100070892 | 3300005560 | Soil | MNRPQPPLAGFQRHHVVIAIVAIVVAVALVLNYYLW* |
| Ga0070762_106975792 | 3300005602 | Soil | MKRPSTPPPRLQRHHVVLAIIPVVVAVALVLNYYLW* |
| Ga0066905_1001188103 | 3300005713 | Tropical Forest Soil | MKRPDRPRPGLQRHHIVIAVIAVVVAVALVLNYYLW* |
| Ga0066905_1001283892 | 3300005713 | Tropical Forest Soil | MKEPRASLPTFQRHHVIIAIIAILVAVALVLNYYLW* |
| Ga0066905_1001996853 | 3300005713 | Tropical Forest Soil | MKRSQVPPFQRHHLVIATIAIVIAVALVLNYYLW* |
| Ga0066905_1004182693 | 3300005713 | Tropical Forest Soil | MNRPRTPLPRFQRHHLVIAVIAIVVAVALVLNYYLW* |
| Ga0066905_1004849383 | 3300005713 | Tropical Forest Soil | MNRPDEPTPYLQRHHIVAAIVAIVVAIALVLNYYLW* |
| Ga0066905_1005714953 | 3300005713 | Tropical Forest Soil | MKRPDTSLPGLQRHHIVIAVIAIVVAVALVLNYYLW* |
| Ga0066905_1008398432 | 3300005713 | Tropical Forest Soil | MKRPDTPLPGLKRHHIVIAVIAIVVAVALVLNYYLW* |
| Ga0066905_1008947013 | 3300005713 | Tropical Forest Soil | MKRPNAPLPGLKRHHIVIAVIAIVVAGALVLNYYLW* |
| Ga0066905_1011004662 | 3300005713 | Tropical Forest Soil | MTRPYAPPRLKRHHVVAAVVAIVVAVALVLNYYLW* |
| Ga0066905_1011256302 | 3300005713 | Tropical Forest Soil | VKRPKAPLPGLQRHHIVIAIIAIVVAVALVLNYYLW* |
| Ga0066905_1018947471 | 3300005713 | Tropical Forest Soil | MKRPDTPLPGLKRHHIVIAVIAIVVALALVLNYYLW* |
| Ga0066905_1020500912 | 3300005713 | Tropical Forest Soil | MKRPNAPLPGLQRHHVVIAVIAIVVAVALVLNYYLW* |
| Ga0066903_1002295542 | 3300005764 | Tropical Forest Soil | MKEPRVSLPTFQRHHAVIAIIAILVAVALVLNYYLW* |
| Ga0066903_1002774253 | 3300005764 | Tropical Forest Soil | MKRPSTPPPRLQRHHVVLAIIAVVVAVAMVLNYYLW* |
| Ga0066903_1033418822 | 3300005764 | Tropical Forest Soil | VKRPSTPLPRLQRHHVVIAIIAVVVAVALVLNYYLW* |
| Ga0066903_1037288612 | 3300005764 | Tropical Forest Soil | MNRPEESTPYLQKHHIVAAVVAIVVAIALVLNYYLW* |
| Ga0066903_1037745332 | 3300005764 | Tropical Forest Soil | MNRPQPPRAGFQRHHVVIAIVAIVVAVALVLNYYLW* |
| Ga0066903_1039328812 | 3300005764 | Tropical Forest Soil | VKRPSTPPPRLQRHHVVIAIIAVVVAVALVLNYYLW* |
| Ga0066903_1046927092 | 3300005764 | Tropical Forest Soil | VKRPNTPLPRLQRHHVVIALIAVVVAVALVLNYYLW* |
| Ga0066903_1066929261 | 3300005764 | Tropical Forest Soil | MKRPGTPPPRLQRHHVVIAIIAVVVAVAMVLNYYLW* |
| Ga0066903_1076786742 | 3300005764 | Tropical Forest Soil | MKRPSTPPPRLQRHHVVIAIIAVMVAVALVLNYYLW* |
| Ga0066903_1078971351 | 3300005764 | Tropical Forest Soil | RQGACAMKRPDTPLPGLKRHHIVIAVIAIVVAVALVLNYYLW* |
| Ga0081455_100055053 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MNRPQAPLPPFQRHHVVIAIIAIVVAVALVLNYYLW* |
| Ga0081455_100371825 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MNRPEGSTPYLQKHHIVAAIVAIVVAIALVLNYYLW* |
| Ga0070717_100143653 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRLRAPQGGLQRHHVVMAVVAIAVAIALVLNYYLW* |
| Ga0070717_101765622 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNHPRAPSIQRHHVVIAIVAIVVAVALVLNYYLW* |
| Ga0075365_101164552 | 3300006038 | Populus Endosphere | MNRPEGPTPYLQKHHIVAAIIAIVVAIALVLNYYLW* |
| Ga0075365_105129361 | 3300006038 | Populus Endosphere | MNRPDMPTSGFQRHHIVIAIIAIVVAVAMALNYYLW* |
| Ga0074060_100035842 | 3300006604 | Soil | MKRPSTPPPRLQRHHVVLAIIAVVVAVALVLNYYLW* |
| Ga0079222_107737772 | 3300006755 | Agricultural Soil | VKRPSTPPPRLQRHHVVIAIIAVVVALALVLNYYLW* |
| Ga0079220_103167973 | 3300006806 | Agricultural Soil | MNRPQPPLAGFQRHHVVIAIVAIVVTVALVLNYYLW* |
| Ga0075431_1002593213 | 3300006847 | Populus Rhizosphere | MNRPEGPTPYLQKHHIVAAIVAIVVAIALVLNYYLW* |
| Ga0075431_1018719121 | 3300006847 | Populus Rhizosphere | MNRPVGPTPYLQKHHIVAAIVAIVVAIALVLNYYLW* |
| Ga0075433_109124753 | 3300006852 | Populus Rhizosphere | MTRPHAPPRLKRHHVVAALVAIVVAVALVLNYYLW* |
| Ga0074063_100938872 | 3300006953 | Soil | MKRPSTPPPRLQQHHVVLAIIAVVVAVALVLNYYLW* |
| Ga0099829_108299412 | 3300009038 | Vadose Zone Soil | MTQPDTPSARFQRHHIVISIVAILVAVALVLNYYLW* |
| Ga0099828_103423832 | 3300009089 | Vadose Zone Soil | MKKPDTPFPRYRLHHVVIAIVAIVAAVALVLNYYTW* |
| Ga0075418_123069581 | 3300009100 | Populus Rhizosphere | MKRLRTPQGGLQRHHVVMAVVAIAVAIALVLNYYLW* |
| Ga0126374_100328933 | 3300009792 | Tropical Forest Soil | MKRPDTPLPGLQRHHIVIAVIAIVVAVALVLNYYLW* |
| Ga0126374_112144951 | 3300009792 | Tropical Forest Soil | MKHPQPPLAGFQRHHVVMAIIAIAVAVALVLNYYLW* |
| Ga0126380_105004472 | 3300010043 | Tropical Forest Soil | MKRPNAPLPGLKRHHIVIAVIAIVVAVALVLNYYLW* |
| Ga0126380_111870552 | 3300010043 | Tropical Forest Soil | MKRANAPLPGLKRHHIVIAVIAIVVAVALVLNYYLW* |
| Ga0126380_115038061 | 3300010043 | Tropical Forest Soil | QGARAMKRPNAPLPGLKRHHIVIAVIAIVVAGALVLNYYLW* |
| Ga0126384_100794733 | 3300010046 | Tropical Forest Soil | VKRPNTPLPGLQRHHVVIAIIAIVVAVALVLNYYLW* |
| Ga0126384_120317391 | 3300010046 | Tropical Forest Soil | MKRPDTPLPGPQRHHIVIGVIAIVVAVALVLNYYLW* |
| Ga0126373_105920842 | 3300010048 | Tropical Forest Soil | MKRPNAPLPGLQRHHVMIAIIALVIAVALVLNYYLW* |
| Ga0134080_105278932 | 3300010333 | Grasslands Soil | MKRPSTPPPRLQRHHVVIAIVEVVVAVALVLNYYLW* |
| Ga0126376_104674243 | 3300010359 | Tropical Forest Soil | MNRPQPPRAGFQRHHVVIAIIAIAVAVALVPNYYLW* |
| Ga0126372_105043083 | 3300010360 | Tropical Forest Soil | MNRPQPPRAGFQRHHVVIAIIAIAVAVALVLNYYLW* |
| Ga0126372_112168862 | 3300010360 | Tropical Forest Soil | VKRPDTPLPGLQRHHIVIAVIAIVVAVALVLNYYLW* |
| Ga0126378_106709692 | 3300010361 | Tropical Forest Soil | MNRPRTPLPRLKRHHLVIAVIAIVVAVALVLNYYLW* |
| Ga0126378_128100992 | 3300010361 | Tropical Forest Soil | MKRPNASLPGLQRHHVVIAIIAVVVAVAMVLNYYLW* |
| Ga0126379_102254332 | 3300010366 | Tropical Forest Soil | MNRPQPPLVGFQRHHVVIAIVAIVVAVALVLNYYLW* |
| Ga0126379_130305722 | 3300010366 | Tropical Forest Soil | MKRPNAPLTGLQRHHIVIAIVAIVVAVALVLNYYLW* |
| Ga0126381_1038089152 | 3300010376 | Tropical Forest Soil | MKRPDTPLPGLQRHHIVIAIIAIVVAVALVLNYYLW* |
| Ga0134126_102878771 | 3300010396 | Terrestrial Soil | RPRTPQGGLQRHHVVIAVVAIVVAIALVLNYYLW* |
| Ga0126383_114966282 | 3300010398 | Tropical Forest Soil | MNRPEEPTAYLQKHHIVAAIVAIVVAIALVLNYYLW* |
| Ga0134123_115601621 | 3300010403 | Terrestrial Soil | MKRLRTPQGGLQRHHAVMAVVAIAVAIALVLNYYLW* |
| Ga0134123_120335172 | 3300010403 | Terrestrial Soil | RVRRNGGMSGLASHHVVIAVIAIVVAVALLANYYLW* |
| Ga0138505_1000113682 | 3300010999 | Soil | MNRPRTPQGALQRHHVVIAVVAIVVAIALVLNYYLW* |
| Ga0120191_100214752 | 3300012022 | Terrestrial | MNRTQAPLPPFQRHHVVIAIIAIMVAVALVLNYYLW* |
| Ga0137364_100095287 | 3300012198 | Vadose Zone Soil | MNRPQPPLPRFQRHHVVIAIIAILVAVALVLNYYLW* |
| Ga0137365_1000341713 | 3300012201 | Vadose Zone Soil | MTRPNTPLPPFQRHHIVIAVVAIVVAVALVLNYYLW* |
| Ga0137363_102111132 | 3300012202 | Vadose Zone Soil | VKRPNTPLPGLQRHHIVIAVVAIVVAVALVLNYYLW* |
| Ga0137399_117412502 | 3300012203 | Vadose Zone Soil | MNRPRTPQSGLQRHHVVIAVVAIVVAIAMVLNYYLW* |
| Ga0137374_100629813 | 3300012204 | Vadose Zone Soil | MNRPQPPLPSFQRHHVVIAIIAILVAVALVLNYYLW* |
| Ga0137380_102175073 | 3300012206 | Vadose Zone Soil | MKRSQVPPPFQRHHLVIATIAIVIAVALVLNYYLW* |
| Ga0137380_113321113 | 3300012206 | Vadose Zone Soil | MTRPNTPLPRFQRHHIVIAAVAIVVAVALVLNYYLW* |
| Ga0137376_112778922 | 3300012208 | Vadose Zone Soil | MNRPQPPLPSFQRHHVVIAIIAIVVAVALVLNYYLW* |
| Ga0137386_106164663 | 3300012351 | Vadose Zone Soil | MKRSQVPPPFQRHHLIIVTIAIVIAVALVLNYYLW* |
| Ga0137366_104520093 | 3300012354 | Vadose Zone Soil | MTRPNTPLPRFQRHHIVIAVVAIVVAVALVLNYYLW* |
| Ga0137368_100932093 | 3300012358 | Vadose Zone Soil | MNRPRTPVPRFQRHHLVIAVIAIVVAVALVLNYYLW* |
| Ga0137396_107342532 | 3300012918 | Vadose Zone Soil | MNHPRAPSIQRHHVAIAIVAIVVAVALVLNYYLW* |
| Ga0164308_105943912 | 3300012985 | Soil | MNRPRTPRSGLQRHHVVIAVVAIVIAIALVMNYYLW* |
| Ga0164305_104538391 | 3300012989 | Soil | PMNRPRTPQSGLQRHHVVIAVVAIVVAIALALNYYLW* |
| Ga0134081_100362611 | 3300014150 | Grasslands Soil | RSQVPLPPFQRHHLVIATIAIVIAVALVLNYYLW* |
| Ga0134078_100041594 | 3300014157 | Grasslands Soil | MRRSQVPLPPFQRHHLIIATIAIVIAVALVLNYYLW* |
| Ga0132258_133967642 | 3300015371 | Arabidopsis Rhizosphere | VKRPSTPPPRLQRHHVVIAIIAVAVALALVLNYYLW* |
| Ga0132255_1060580931 | 3300015374 | Arabidopsis Rhizosphere | GARAMNRPEGPTPYLQKHHIVAAIVAIVVAIALVLNYYLW* |
| Ga0182037_101994021 | 3300016404 | Soil | VKRSSTPPPRLQRHHVVIAIIALVVAVALVLNYYL |
| Ga0184619_104702571 | 3300018061 | Groundwater Sediment | MNRPDTSLPRFQRHHIVIAIIAIVVAVALVLNYYLW |
| Ga0184639_101432082 | 3300018082 | Groundwater Sediment | VEAKGKGVMMQKPHTPLLRLQRHHIVISVVAIVVAVALMLNYYLW |
| Ga0066655_100927791 | 3300018431 | Grasslands Soil | RAMKRSQVPLPPFQRHHLIIATIAIVIAVALVLNYYLW |
| Ga0066667_103032672 | 3300018433 | Grasslands Soil | MNRPQPPLAGFQRHHVVIAIVAIVVAVALVLNYYLW |
| Ga0066662_101437532 | 3300018468 | Grasslands Soil | VKRPSTPPPRLQRHHVVLAIIAVVVAVALVLNYYLW |
| Ga0066662_105581852 | 3300018468 | Grasslands Soil | MNRPQPPLPPFQRHHVVIAIIAILVAVALVLNYYLW |
| Ga0210407_103997231 | 3300020579 | Soil | MNRPRTPQSGLQRHHVVIAVVAIVVAIALALNYYLW |
| Ga0210408_100961972 | 3300021178 | Soil | MKRLSTPPPRLQWHHVVLAIIAVVVAVALVLNYYLW |
| Ga0213872_104207532 | 3300021361 | Rhizosphere | MKRPSTPPPRLQRHHVVIAIIAVVIAVALVLNYYLW |
| Ga0210384_114194722 | 3300021432 | Soil | MKRLSTPPPRLQRHHVVLAIIAVVVAVALVLNYYLW |
| Ga0210402_104432182 | 3300021478 | Soil | MKRPSTPPPRLQRHHVVLAIIAVVVAVALVLNYYLW |
| Ga0126371_104047043 | 3300021560 | Tropical Forest Soil | MKEPRASLPTFQRHHVIIAIIAILVAVALVLNYYLW |
| Ga0126371_112662222 | 3300021560 | Tropical Forest Soil | VKRPSTPPPRLQRHHVVIAIIAVVVAVALVLNYYLW |
| Ga0209468_10099882 | 3300026306 | Soil | MKRSQVPLPPFQRHHLIIATIAIVIAVALVLNYYLW |
| Ga0257180_10225691 | 3300026354 | Soil | ARAMNHPRAPSIQRHHVAIAIVAIVVAVALVLNYYLW |
| Ga0209729_10022221 | 3300027061 | Forest Soil | GAHAMKKASTPPPRLQQHHVVLAIIAVVVAVALVLNYYLW |
| Ga0209522_10139162 | 3300027119 | Forest Soil | GARAMKRLRTPQGGLQRHHVVMAVVAIAVAIALVLNYYLW |
| Ga0209003_10461122 | 3300027576 | Forest Soil | MKKASTPPPRLQRHHVVLAIIAVVVAVALVLNYYLW |
| Ga0209466_10211693 | 3300027646 | Tropical Forest Soil | MKRPNAPLPGLKRHHIVIAVIAIVVAVALVLNYYLW |
| Ga0209799_10201322 | 3300027654 | Tropical Forest Soil | VKRPDTPLPGLQRHHIVIAVIAIVVAVALVLNYYLW |
| Ga0209814_100575673 | 3300027873 | Populus Rhizosphere | MNRPQAPLPPFQRHHVVIAIIAIVVAVALVLNYYLW |
| Ga0209465_100565252 | 3300027874 | Tropical Forest Soil | MKRPSTPVPRLQRHHVVIAIIALVVAVALVLNYYLW |
| Ga0209283_102587212 | 3300027875 | Vadose Zone Soil | MKKPDTPFPRYRLHHVVIAIVAIVAAVALVLNYYTW |
| Ga0209590_102974862 | 3300027882 | Vadose Zone Soil | VKRPNTPLPGLQRHHIVISIVAILVAVALVLNYYLW |
| Ga0209382_101184783 | 3300027909 | Populus Rhizosphere | MNRPEGPTPYLQKHHIVAAIIAIVVAIALVLNYYLW |
| Ga0209382_114271161 | 3300027909 | Populus Rhizosphere | MNRPEGPTPYLQKHHIVAAIVAIVVAIALVLNYYLW |
| Ga0307322_102039672 | 3300028710 | Soil | MNRPRTPRSGLQRHHVVIAVVAIVIAIALVMNYYLW |
| Ga0307278_101374083 | 3300028878 | Soil | MNRPDASLPRFQRHHIVIAVIAIVVAVAMALNYYLW |
| Ga0307278_102147052 | 3300028878 | Soil | MNRPDTSLPRFQRHHIVIAVIAIVVAVAMALNYYLW |
| Ga0307277_1000037815 | 3300028881 | Soil | MKRLRTPQGGLQRHHIVMAVVAIAVAIALVLNYYLW |
| Ga0318516_100129865 | 3300031543 | Soil | MKRPSMPPPRLRRHHVVIAIIAVVIAVALVLNYYLW |
| Ga0318516_100550843 | 3300031543 | Soil | MKRPNTPLPGLQRHHIVIAVIAIVVAVALVLNYYLW |
| Ga0318516_100655963 | 3300031543 | Soil | MKRPDTPLPGLQRHHIVIAIIAIVVAVALVLNYYLW |
| Ga0318516_107555052 | 3300031543 | Soil | VKRPSTPLPRLQRHHVVIAIIAVVVAVALVLNYYLW |
| Ga0318534_102857892 | 3300031544 | Soil | VKRPTTPLPRLQRHHVVIAIIAVVVAVALVLNYYLW |
| Ga0318528_100070124 | 3300031561 | Soil | VKRPTTPLPRLQRHHVVIAIIAVVVAVALALNYYLW |
| Ga0318560_101902783 | 3300031682 | Soil | KRPDTPLPGLQRHHIVIAIIAIVVAVALVLNYYLW |
| Ga0306917_106425552 | 3300031719 | Soil | AMKEPRASLPTFQRHHVIIAIIAILVAVALVLNYYLW |
| Ga0318493_106087221 | 3300031723 | Soil | QGARAVKRSSTPPPRLQRHHVVIAIIAAVVAVALVLNYYLW |
| Ga0318502_100027621 | 3300031747 | Soil | MKRPSMPPPRLRRHHVVIAIIAVVIAVALVLNYYL |
| Ga0318552_106300822 | 3300031782 | Soil | MKRLSTPPPRLQQHHVVLAIIAVVVAVALVLNYYLW |
| Ga0318557_105681051 | 3300031795 | Soil | CRQGARAMKRPDTPLPGLKRHHIVIAVIAIVVALALVLNYYLW |
| Ga0318520_108235222 | 3300031897 | Soil | MKRPSTPLPRLQRHHVVIAIIAVVIAVALVLNYYLW |
| Ga0318559_102485271 | 3300032039 | Soil | VKRSSTPPPRLQRHHVVIAIIAAVVAVALVLNYYLW |
| Ga0318510_104547021 | 3300032064 | Soil | GARAVKRPTTPLPRLQRHHVVIAIIAVVVAVALVLNYYLW |
| Ga0307471_1000696251 | 3300032180 | Hardwood Forest Soil | MTRPHAPPRLKRHHVVAALVAIVVAVALVLNYYLW |
| Ga0306920_1006834673 | 3300032261 | Soil | MKRPSTPLPRLQRHHVVIAIIAVVVAVALVLNYYLW |
| Ga0318519_101270222 | 3300033290 | Soil | VTRPTTPLPRLQRHHVVIAIIAVVVAVALALNYYLW |
| ⦗Top⦘ |