| Basic Information | |
|---|---|
| Family ID | F051043 |
| Family Type | Metagenome |
| Number of Sequences | 144 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VLPNKRLKLAGGDRFKGNGVLCPGGHGLSSTTLAPAGESPAA |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 41.35 % |
| % of genes near scaffold ends (potentially truncated) | 59.72 % |
| % of genes from short scaffolds (< 2000 bps) | 61.81 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.639 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (46.528 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.694 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (79.861 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF14534 | DUF4440 | 4.17 |
| PF12681 | Glyoxalase_2 | 2.78 |
| PF03681 | Obsolete Pfam Family | 2.08 |
| PF03544 | TonB_C | 2.08 |
| PF12680 | SnoaL_2 | 1.39 |
| PF11528 | DUF3224 | 1.39 |
| PF07883 | Cupin_2 | 1.39 |
| PF05163 | DinB | 0.69 |
| PF12867 | DinB_2 | 0.69 |
| PF07929 | PRiA4_ORF3 | 0.69 |
| PF00150 | Cellulase | 0.69 |
| PF00313 | CSD | 0.69 |
| PF09932 | DUF2164 | 0.69 |
| PF09720 | Unstab_antitox | 0.69 |
| PF02517 | Rce1-like | 0.69 |
| PF01965 | DJ-1_PfpI | 0.69 |
| PF12876 | Cellulase-like | 0.69 |
| PF07606 | DUF1569 | 0.69 |
| PF12762 | DDE_Tnp_IS1595 | 0.69 |
| PF00484 | Pro_CA | 0.69 |
| PF01872 | RibD_C | 0.69 |
| PF12704 | MacB_PCD | 0.69 |
| PF01548 | DEDD_Tnp_IS110 | 0.69 |
| PF12697 | Abhydrolase_6 | 0.69 |
| PF12158 | DUF3592 | 0.69 |
| PF00106 | adh_short | 0.69 |
| PF14526 | Cass2 | 0.69 |
| PF04365 | BrnT_toxin | 0.69 |
| PF10077 | DUF2314 | 0.69 |
| PF13857 | Ank_5 | 0.69 |
| PF06736 | TMEM175 | 0.69 |
| PF05016 | ParE_toxin | 0.69 |
| PF15569 | Imm40 | 0.69 |
| PF01980 | TrmO | 0.69 |
| PF10754 | DUF2569 | 0.69 |
| PF00903 | Glyoxalase | 0.69 |
| PF07681 | DoxX | 0.69 |
| PF13476 | AAA_23 | 0.69 |
| PF07045 | DUF1330 | 0.69 |
| PF02371 | Transposase_20 | 0.69 |
| PF14384 | BrnA_antitoxin | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 2.08 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.39 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.69 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.69 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG1720 | tRNA (Thr-GGU) A37 N6-methylase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.69 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.69 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.69 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.69 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.69 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.69 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.69 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.69 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.69 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.03 % |
| Unclassified | root | N/A | 15.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10028939 | All Organisms → cellular organisms → Bacteria | 1959 | Open in IMG/M |
| 3300002558|JGI25385J37094_10148347 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300002558|JGI25385J37094_10213774 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 515 | Open in IMG/M |
| 3300002560|JGI25383J37093_10067261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1121 | Open in IMG/M |
| 3300002561|JGI25384J37096_10038310 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1863 | Open in IMG/M |
| 3300002561|JGI25384J37096_10046882 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1654 | Open in IMG/M |
| 3300002561|JGI25384J37096_10179529 | Not Available | 638 | Open in IMG/M |
| 3300002562|JGI25382J37095_10046808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1672 | Open in IMG/M |
| 3300002562|JGI25382J37095_10124870 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 873 | Open in IMG/M |
| 3300002562|JGI25382J37095_10142948 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300002908|JGI25382J43887_10107737 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300002908|JGI25382J43887_10214542 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300002908|JGI25382J43887_10269610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300005167|Ga0066672_10137494 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300005167|Ga0066672_10221379 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300005167|Ga0066672_10727765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 632 | Open in IMG/M |
| 3300005171|Ga0066677_10005335 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 5186 | Open in IMG/M |
| 3300005174|Ga0066680_10014062 | All Organisms → cellular organisms → Bacteria | 4208 | Open in IMG/M |
| 3300005174|Ga0066680_10192181 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1288 | Open in IMG/M |
| 3300005174|Ga0066680_10391593 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 883 | Open in IMG/M |
| 3300005174|Ga0066680_10591213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300005175|Ga0066673_10291743 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 950 | Open in IMG/M |
| 3300005176|Ga0066679_10220853 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300005180|Ga0066685_10114284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_13_63_9 | 1814 | Open in IMG/M |
| 3300005180|Ga0066685_10961965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agariperforans | 567 | Open in IMG/M |
| 3300005187|Ga0066675_10071618 | All Organisms → cellular organisms → Bacteria | 2206 | Open in IMG/M |
| 3300005187|Ga0066675_10174445 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300005446|Ga0066686_10197519 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1347 | Open in IMG/M |
| 3300005447|Ga0066689_10613296 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005450|Ga0066682_10110735 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1730 | Open in IMG/M |
| 3300005450|Ga0066682_10409519 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 867 | Open in IMG/M |
| 3300005540|Ga0066697_10046298 | All Organisms → cellular organisms → Bacteria | 2455 | Open in IMG/M |
| 3300005553|Ga0066695_10573801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300005554|Ga0066661_10008868 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4914 | Open in IMG/M |
| 3300005554|Ga0066661_10023894 | All Organisms → cellular organisms → Bacteria | 3290 | Open in IMG/M |
| 3300005555|Ga0066692_10007755 | All Organisms → cellular organisms → Bacteria | 4909 | Open in IMG/M |
| 3300005556|Ga0066707_10031172 | All Organisms → cellular organisms → Bacteria | 2953 | Open in IMG/M |
| 3300005556|Ga0066707_10182942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1344 | Open in IMG/M |
| 3300005556|Ga0066707_10436306 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 850 | Open in IMG/M |
| 3300005557|Ga0066704_10377974 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 945 | Open in IMG/M |
| 3300005558|Ga0066698_10429444 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300005559|Ga0066700_10050986 | All Organisms → cellular organisms → Bacteria | 2543 | Open in IMG/M |
| 3300005559|Ga0066700_10061715 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
| 3300005560|Ga0066670_10520672 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 729 | Open in IMG/M |
| 3300005569|Ga0066705_10543785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300005574|Ga0066694_10426560 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300005576|Ga0066708_10278672 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300005576|Ga0066708_10960418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 532 | Open in IMG/M |
| 3300005586|Ga0066691_10884619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300005586|Ga0066691_10884626 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 525 | Open in IMG/M |
| 3300006031|Ga0066651_10026504 | All Organisms → cellular organisms → Bacteria | 2554 | Open in IMG/M |
| 3300006031|Ga0066651_10562225 | Not Available | 605 | Open in IMG/M |
| 3300006034|Ga0066656_10058775 | All Organisms → cellular organisms → Bacteria | 2240 | Open in IMG/M |
| 3300006034|Ga0066656_10146078 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300006034|Ga0066656_10420785 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300006755|Ga0079222_11283087 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300006796|Ga0066665_10094872 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2174 | Open in IMG/M |
| 3300006796|Ga0066665_10236828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1437 | Open in IMG/M |
| 3300006796|Ga0066665_11069159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300006796|Ga0066665_11311264 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300006797|Ga0066659_10256248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 1312 | Open in IMG/M |
| 3300006797|Ga0066659_11611431 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006800|Ga0066660_10553376 | Not Available | 965 | Open in IMG/M |
| 3300006804|Ga0079221_10896360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
| 3300009012|Ga0066710_100165113 | All Organisms → cellular organisms → Bacteria | 3103 | Open in IMG/M |
| 3300009088|Ga0099830_10227310 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300009090|Ga0099827_10127996 | All Organisms → cellular organisms → Bacteria | 2053 | Open in IMG/M |
| 3300009137|Ga0066709_100485067 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1737 | Open in IMG/M |
| 3300009137|Ga0066709_101675196 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 904 | Open in IMG/M |
| 3300010304|Ga0134088_10034704 | All Organisms → cellular organisms → Bacteria | 2285 | Open in IMG/M |
| 3300010322|Ga0134084_10053629 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1195 | Open in IMG/M |
| 3300010323|Ga0134086_10089011 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1081 | Open in IMG/M |
| 3300010325|Ga0134064_10011655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2374 | Open in IMG/M |
| 3300010326|Ga0134065_10115230 | Not Available | 907 | Open in IMG/M |
| 3300010333|Ga0134080_10209738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300010335|Ga0134063_10296447 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 777 | Open in IMG/M |
| 3300012198|Ga0137364_10062307 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2525 | Open in IMG/M |
| 3300012198|Ga0137364_10069106 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2411 | Open in IMG/M |
| 3300012198|Ga0137364_10274855 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1247 | Open in IMG/M |
| 3300012198|Ga0137364_10319514 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300012198|Ga0137364_11223788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300012200|Ga0137382_10006112 | Not Available | 6061 | Open in IMG/M |
| 3300012200|Ga0137382_10072500 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2211 | Open in IMG/M |
| 3300012201|Ga0137365_10011117 | All Organisms → cellular organisms → Bacteria | 7103 | Open in IMG/M |
| 3300012201|Ga0137365_10759651 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 708 | Open in IMG/M |
| 3300012206|Ga0137380_10016865 | All Organisms → cellular organisms → Bacteria | 6681 | Open in IMG/M |
| 3300012206|Ga0137380_10033063 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4771 | Open in IMG/M |
| 3300012207|Ga0137381_10049598 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3463 | Open in IMG/M |
| 3300012208|Ga0137376_10423647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1156 | Open in IMG/M |
| 3300012208|Ga0137376_10761935 | Not Available | 834 | Open in IMG/M |
| 3300012209|Ga0137379_10162641 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2144 | Open in IMG/M |
| 3300012211|Ga0137377_11086187 | Not Available | 730 | Open in IMG/M |
| 3300012211|Ga0137377_11425458 | Not Available | 620 | Open in IMG/M |
| 3300012356|Ga0137371_10548060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 890 | Open in IMG/M |
| 3300012359|Ga0137385_10864728 | Not Available | 749 | Open in IMG/M |
| 3300012359|Ga0137385_11474842 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012360|Ga0137375_10652127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 867 | Open in IMG/M |
| 3300012927|Ga0137416_12026267 | Not Available | 528 | Open in IMG/M |
| 3300012972|Ga0134077_10013938 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2673 | Open in IMG/M |
| 3300012976|Ga0134076_10071291 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300012976|Ga0134076_10152568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 947 | Open in IMG/M |
| 3300012976|Ga0134076_10196046 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 845 | Open in IMG/M |
| 3300014157|Ga0134078_10409832 | Not Available | 610 | Open in IMG/M |
| 3300015241|Ga0137418_10011504 | All Organisms → cellular organisms → Bacteria | 8159 | Open in IMG/M |
| 3300015357|Ga0134072_10277757 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 615 | Open in IMG/M |
| 3300015359|Ga0134085_10023193 | All Organisms → cellular organisms → Bacteria | 2378 | Open in IMG/M |
| 3300017657|Ga0134074_1057862 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300017657|Ga0134074_1073306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1165 | Open in IMG/M |
| 3300017659|Ga0134083_10153645 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300017659|Ga0134083_10374960 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 616 | Open in IMG/M |
| 3300018431|Ga0066655_10221533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1186 | Open in IMG/M |
| 3300018433|Ga0066667_10926174 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 750 | Open in IMG/M |
| 3300018482|Ga0066669_10076325 | All Organisms → cellular organisms → Bacteria | 2237 | Open in IMG/M |
| 3300026298|Ga0209236_1027637 | All Organisms → cellular organisms → Bacteria | 3075 | Open in IMG/M |
| 3300026301|Ga0209238_1115948 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 889 | Open in IMG/M |
| 3300026307|Ga0209469_1015999 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2704 | Open in IMG/M |
| 3300026309|Ga0209055_1013965 | All Organisms → cellular organisms → Bacteria | 4078 | Open in IMG/M |
| 3300026312|Ga0209153_1013936 | All Organisms → cellular organisms → Bacteria | 2571 | Open in IMG/M |
| 3300026313|Ga0209761_1020517 | All Organisms → cellular organisms → Bacteria | 4143 | Open in IMG/M |
| 3300026313|Ga0209761_1113862 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1327 | Open in IMG/M |
| 3300026318|Ga0209471_1013631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 4214 | Open in IMG/M |
| 3300026329|Ga0209375_1014665 | All Organisms → cellular organisms → Bacteria | 4702 | Open in IMG/M |
| 3300026330|Ga0209473_1213551 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300026331|Ga0209267_1151024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 956 | Open in IMG/M |
| 3300026342|Ga0209057_1010107 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 5934 | Open in IMG/M |
| 3300026538|Ga0209056_10014367 | All Organisms → cellular organisms → Bacteria | 7904 | Open in IMG/M |
| 3300026538|Ga0209056_10066776 | All Organisms → cellular organisms → Bacteria | 3111 | Open in IMG/M |
| 3300026538|Ga0209056_10069879 | All Organisms → cellular organisms → Bacteria | 3019 | Open in IMG/M |
| 3300026538|Ga0209056_10197033 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1479 | Open in IMG/M |
| 3300026538|Ga0209056_10645115 | Not Available | 534 | Open in IMG/M |
| 3300026540|Ga0209376_1012343 | All Organisms → cellular organisms → Bacteria | 6187 | Open in IMG/M |
| 3300027706|Ga0209581_1001926 | All Organisms → cellular organisms → Bacteria | 21960 | Open in IMG/M |
| 3300027882|Ga0209590_10019316 | All Organisms → cellular organisms → Bacteria | 3407 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 46.53% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 16.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.39% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_100289393 | 3300002558 | Grasslands Soil | MENLAPRQLPNKRLKLAGGDRFKGNGVLCPGGHGLSSNDLAPAGESPAA |
| JGI25385J37094_101483471 | 3300002558 | Grasslands Soil | MGPPNKRLKLTGGYRSKESGVLCVNAHNYRSITIAPAGESPAA* |
| JGI25385J37094_102137741 | 3300002558 | Grasslands Soil | MLPNKRLKLTGGDRFKGNGVLCPGGHELSSTTLAPAGGSPAA |
| JGI25383J37093_100672611 | 3300002560 | Grasslands Soil | MLPPNKRLKLAGGDRSKGSGVLCPDGHELTSNTLARASQSPAA* |
| JGI25384J37096_100383102 | 3300002561 | Grasslands Soil | VLKRSFPYESLFAGLRNKRLKLTGGDRPKGSGVLCPGGHGLTSHKLAPARGSPAA* |
| JGI25384J37096_100468821 | 3300002561 | Grasslands Soil | MENLAPRQLPNKRLKLAGGDRFKGNGVLCPGGHGLSSNDLAPAGESPAA* |
| JGI25384J37096_101795291 | 3300002561 | Grasslands Soil | SNKRLKLTGGDRSKGSGVLCAGADRLPPNSLAPAGESPAA* |
| JGI25382J37095_100468082 | 3300002562 | Grasslands Soil | MLPPNKRLKLTGGDRSKGTGVLCPGGHGLSSTTLAPAGESPAA* |
| JGI25382J37095_101248702 | 3300002562 | Grasslands Soil | MLPNKRLKLTGGDRFKGNGVLCPGGHELSSTTLAPAGGSPAA* |
| JGI25382J37095_101429483 | 3300002562 | Grasslands Soil | ELWRAALPNKRLKLTGGDRSKGIGVLCPGGHGLSSTTLALVGGSPAA* |
| JGI25382J43887_101077372 | 3300002908 | Grasslands Soil | VSALPNKRLKLAGGDRFKGSGVLCPCGHGLSSTSLAPTGESPAA* |
| JGI25382J43887_102145423 | 3300002908 | Grasslands Soil | WRAALPNKRLKLTGGDRSKGIGVLCPGGHGLSSTTLALVGGSPAA* |
| JGI25382J43887_102696101 | 3300002908 | Grasslands Soil | RKVRLSSRYPMLPPNKRLKLAGGDRSKGSGVLCPDGHELTSNTLARASQSPAA* |
| Ga0062594_1021453581 | 3300005093 | Soil | REARLRSCVLPNMRLKVPGGDRFRETECLRPGGRGLASHILAPAGESPAA* |
| Ga0066672_101374941 | 3300005167 | Soil | MNESLWGTLPNKRLKLAGGDRFKGSGVLCPGGHGLSSTTLAPTGESPAA* |
| Ga0066672_102213791 | 3300005167 | Soil | AAPNKRLKLAGGDRSKGSGVLCPGGHGLSSTTLAPAGGSPAV* |
| Ga0066672_107277652 | 3300005167 | Soil | VPSNKRLKLTGVYRSKGDGVLCPGGHGLSSINLAPAGESPAA |
| Ga0066677_100053359 | 3300005171 | Soil | MLLPNKRLKLAGGDRFSGSEVLSPGGHGLSSTTLAPAGESPAA* |
| Ga0066683_102697583 | 3300005172 | Soil | GSRSVLSNKRLKLAGGDRLRGIGVLRPSGRGLSSATLAPAGGSPAA* |
| Ga0066683_105021252 | 3300005172 | Soil | AFVGSAHDSPRPNKRLKLAGGDRLKGSGVLCPGGHGLSSHTLAPADGSPAA* |
| Ga0066680_100140625 | 3300005174 | Soil | MLPPNKRLKLAGDDRSKGSGVLCPGGHGLSSTTLAPAGESPAA* |
| Ga0066680_101921811 | 3300005174 | Soil | MQAAASKRLKLPGGDRFKGIGVLCAGGHELSFTVLAPAGESPAA* |
| Ga0066680_103915931 | 3300005174 | Soil | PNKRLKLAGGDRSKGTGVVALTGHGLSSLTLALASESPAA* |
| Ga0066680_105912131 | 3300005174 | Soil | PNKRLKLAGGDRSKGNGVLCPGGHGLSSTTLAPAGGSPAA* |
| Ga0066673_102917433 | 3300005175 | Soil | MLPPNKRLKVAGGDRSKGSGVLCPDGHELTSNTLARASQSPAA |
| Ga0066679_102208533 | 3300005176 | Soil | MNEQLPNKRLKLAGGDRFKDTECCAPGGARTSSTTLAPAGESPAA* |
| Ga0066685_101142844 | 3300005180 | Soil | MLPPNKRLKLAGDDRSKGSGVLCPGGHGLSSTTLAPAGESPAA |
| Ga0066685_109619652 | 3300005180 | Soil | LPNKRLKLAGGDRSKGNGVLCPGGHGLSSNALAPTGESPAA* |
| Ga0066678_102893902 | 3300005181 | Soil | MYPVCTGQRPNKRLKLAGGIALKETECLRPGGRGLSSHTLAPAGESPAA* |
| Ga0066675_100716182 | 3300005187 | Soil | VPEPVLPNKRLKLAGADRSKGSAVLCPGGHGLSSTTLAPVGGSPAA* |
| Ga0066675_101744452 | 3300005187 | Soil | MASRLGAERALPNKRLKLTGDDRSKGNGVLCPGGHGLSSNTLAPVGESPAA* |
| Ga0066686_101975194 | 3300005446 | Soil | LPNKRLKLAGGDRFKGSGVLCPSGHGRSSTTLAPAGESPAA* |
| Ga0066686_102212812 | 3300005446 | Soil | MVALPNKRLKLPGGDRFRGIGVLCAGALRLTLSHLVPAGESPAA* |
| Ga0066689_106132962 | 3300005447 | Soil | PNKRLKLAGGDRFKGSGVLCPGGHGLSSTTLAPPGGSPAA* |
| Ga0066682_101107353 | 3300005450 | Soil | LTTDDLLRLLPNKRLKLTGGDRSKGNGVLCPGGHGLSSNTLAPASGSPAA* |
| Ga0066682_104095191 | 3300005450 | Soil | MVEVLVSQLPNKRLKLTGDDRFKGSGVLCPGGHGLSSVTLAPAGGSPAA* |
| Ga0066697_100462982 | 3300005540 | Soil | MLLPNKRLKLAGGDRLKGSGALCPGGHGLSSQGLAPAGESPAA* |
| Ga0066695_105738012 | 3300005553 | Soil | VLPNKRLKLAGGDRLKGSVVLCPGGHGLSSTTFAPAGES |
| Ga0066661_100088681 | 3300005554 | Soil | LRPNKRLKLAGGDRFKGSGVVPLAGHGLSSTTLAPVSESPAA* |
| Ga0066661_100238946 | 3300005554 | Soil | MNESLWGTLPNKRLKLAGGDRFKGSGVLCPGGHGLSSTTLAPT |
| Ga0066661_106066502 | 3300005554 | Soil | MRLKLMGGARFKGSGVLCATAHELSFNIEALAGESPAA* |
| Ga0066692_1000775513 | 3300005555 | Soil | MVLQSALLPNKRLKLAGGDRSKGSGVLCPDGHGLSSTTLAPPGGSPAA* |
| Ga0066707_100311725 | 3300005556 | Soil | MRRLPNKRLKLAGDRSKGVGVLCPGEHGLSSSSLAPAGESPAA* |
| Ga0066707_101829421 | 3300005556 | Soil | MTGVLPNKRLKLAGGDRFKGNGVLCPGGHGLSSTTLAPAGESPAA* |
| Ga0066707_104363063 | 3300005556 | Soil | LPNKRLKLAGGDRLKGIGVLCPGGHGLSSTALAPAGGSPAA* |
| Ga0066704_103779741 | 3300005557 | Soil | PNKRLKLAGGDRSKGSGVLCPDGHELTSNTLAQASQSPAA* |
| Ga0066698_104294443 | 3300005558 | Soil | PNKRLKLTGGDRSKGNGVLRPGERGRASTTLAPGSESPAA* |
| Ga0066700_100509861 | 3300005559 | Soil | MNESLWGTLPNKRLKLAGGDRFKGSGVLCPGGHGLSSTTLAPTDESPAA* |
| Ga0066700_100617156 | 3300005559 | Soil | VKRLPSNKRLKLPGAERSKGTGVLCPGGHGLSSTTLAPA |
| Ga0066670_105206722 | 3300005560 | Soil | PNKRLKLTGGDRSKGSGVLCPGGARTSSHTLAPAGESPAA* |
| Ga0066705_105437851 | 3300005569 | Soil | VLPNKRLKLAGGDRFKGNGVLCPGGHGLSSTTLAPAGESPAA* |
| Ga0066694_104265601 | 3300005574 | Soil | ALPNKRLKLAGGDRFKGNGALCPGGHGLSSTTLVPAGESPAA* |
| Ga0066708_102786721 | 3300005576 | Soil | KRLKLAGGDRSKGSGLLCPGGHELSSTTLAPASGSPAA* |
| Ga0066708_109604183 | 3300005576 | Soil | SPVSRMPNKRLKLAGGDRSKGNGASRPGGHGLSSTTLAAAGGSPAA* |
| Ga0066691_108846191 | 3300005586 | Soil | VLPNKRLKLAGGDRSKGSGVLCPGGHGLSSTTLAPA |
| Ga0066691_108846262 | 3300005586 | Soil | PNKRLKLAGDDRFKGSGVLCLGGHGLSSTTLAPAAESPAA* |
| Ga0066651_100265043 | 3300006031 | Soil | VPPNKRLLAGRDRPKGVGVLCPGGHGLSSYDLAPAGGSPAA* |
| Ga0066651_105622251 | 3300006031 | Soil | LRPNKRLKLTGGYRRNGTGVLCPSGHGLTSTNLAPTDGSPAA* |
| Ga0066656_100587753 | 3300006034 | Soil | VQVTQLPNKRLKLAGGDRSKGSGVLYPGGHGLSSTTLAPAGGSPAA* |
| Ga0066656_101460781 | 3300006034 | Soil | LLPNKRLKLAGGDRFKGNGVLCPGGIQLSSNSLAPAGGSPAA* |
| Ga0066656_104207853 | 3300006034 | Soil | LSMRARPNKRLKLAGGDRLKGIGVLCPGGHGLSSTTLAPAGESPAA* |
| Ga0079222_112830872 | 3300006755 | Agricultural Soil | VAKREAMQRPNKRLKLTGGDRFSGSGVLCAGAHKLSFNDGSLAGESPAA* |
| Ga0066665_100948725 | 3300006796 | Soil | PNKRLKLAGGDRLKGNGALCPGGHRLSSTTLAPASESPAA* |
| Ga0066665_102368281 | 3300006796 | Soil | LKAPPNKRLKLAGGDRFKGNGVLCAGAHDLSFNGLAPAGGSPAA* |
| Ga0066665_110691592 | 3300006796 | Soil | EALPNKRLKLAGGDRFKGNGVLCAGAHELSFIYTAPAGGSPAA* |
| Ga0066665_113112641 | 3300006796 | Soil | GAANKRLKLAGGDRLKGIGVLCPGGHGLSSTTLAPAGESPAA* |
| Ga0066659_102562483 | 3300006797 | Soil | PNKRLKLTGGDRSKGNGVLCPGGHGLSSTTLAPASESPAA* |
| Ga0066659_116114311 | 3300006797 | Soil | VTFKVPLSNKRLKLAGGDRFKGSGVLSPGGHGLSSTTLAPAGGSPAA* |
| Ga0066660_105533762 | 3300006800 | Soil | LPGGDRFKGSGVLFPGGARTSSRTLAPASESPAA* |
| Ga0079221_108963601 | 3300006804 | Agricultural Soil | GLGVPPNKRLKLAGGHRSKGNGVLCPGGHGLSSTSLAPAGESPAA* |
| Ga0066710_1001651131 | 3300009012 | Grasslands Soil | KRLKLAGGDRLKGIGVLCPSRSARSSIILALASESPAA |
| Ga0099830_102273104 | 3300009088 | Vadose Zone Soil | SNKRLKLAGGDRSKGTGVLCAGAHELTSTSLAPAGESPAA* |
| Ga0099827_101279964 | 3300009090 | Vadose Zone Soil | MVSSVICPRALSNMRLKLAGADRSKGNGVLCAGAHELSFNDTAPAGESPAA* |
| Ga0066709_1004850672 | 3300009137 | Grasslands Soil | RRVPLSSRYPMLPPNKRLKLPGGDRSKGNGVLYAGVHRLTSTNLALAGESPAA* |
| Ga0066709_1016751961 | 3300009137 | Grasslands Soil | MRLKLAGGDRFKGSGVLCAGGHGLSSKTLAPAGESPAA* |
| Ga0114129_109047363 | 3300009147 | Populus Rhizosphere | KLPGGDRSKGSGVLCAGAHELSFIYTAPADESPAA* |
| Ga0134088_100347043 | 3300010304 | Grasslands Soil | MVLVKVQPNKRLKLTGAYRLSGIGVLCPGGHRLSSHTLAPAGESPAA* |
| Ga0134084_100536293 | 3300010322 | Grasslands Soil | CERAVKPRPNKRLKLPGGDRFKGSGVLCAGGHGLSSKTLAPAGESPAA* |
| Ga0134086_100890111 | 3300010323 | Grasslands Soil | NKRLKLAADDRFKGNGVLCPWRDTGLSSRSLAPAGESPAA* |
| Ga0134064_100116554 | 3300010325 | Grasslands Soil | NKRLKLAGGDRFKGSGVVPLTGHGLSSNYLAPAGESPAA* |
| Ga0134065_101152301 | 3300010326 | Grasslands Soil | GTQPPNKRLKLAGGARFKGTGVLCSGGRGLSSTTLAPTGESPAA* |
| Ga0134080_102097382 | 3300010333 | Grasslands Soil | GAVPEPVLPNKRLKLAGADRSKGSGVLCPGGHGLSSTTLAPVGGSPAA* |
| Ga0134063_102964472 | 3300010335 | Grasslands Soil | PPNKRLKLAGGDRFRGNGVLCPGGHGLSSNDLAPAGESPAA* |
| Ga0137364_100623072 | 3300012198 | Vadose Zone Soil | MAPNKRLKLTGDDRSKGDGVLCPGMHGRSSNSLAPAGESPAA* |
| Ga0137364_100691062 | 3300012198 | Vadose Zone Soil | VLPNKRLKLPGGDRSKGSGVLCADAHELTFTYIAPAGESPAA* |
| Ga0137364_102748553 | 3300012198 | Vadose Zone Soil | PNKRLKLAGGDRFKGSGALCPGGHGLSSNELAPAGESPAA* |
| Ga0137364_103195141 | 3300012198 | Vadose Zone Soil | KRLKLAGGDRFKGSGVLAPWRAKNLVHTLAPASESPAA* |
| Ga0137364_112237882 | 3300012198 | Vadose Zone Soil | APELVGALPNKRLKLAGGDRFRGSGVLCPAALELPFTVLAPAGESPAA* |
| Ga0137383_100063072 | 3300012199 | Vadose Zone Soil | MVRLRSNKRVKLAGGDRFRGIGVLSASAHQLTPSALAPAGESPAA* |
| Ga0137382_100061126 | 3300012200 | Vadose Zone Soil | MMGVRPNKRLKLAALIVLVEAECWAPGGARTSSAILAPTGESPAA* |
| Ga0137382_100725003 | 3300012200 | Vadose Zone Soil | MKVQMCQQLPNKRLKLAGAIVLMEAECCAPGGARTSSHNLALAGESPAA* |
| Ga0137365_100111179 | 3300012201 | Vadose Zone Soil | MVRWLPNKRLKLPGDYRFNGSGVLCPGGHGLSSTTLALAGESPAA* |
| Ga0137365_107596512 | 3300012201 | Vadose Zone Soil | LKLTGDDRSKGDGVLCPGMHGRSSNSLAPAGESPAA* |
| Ga0137380_1001686510 | 3300012206 | Vadose Zone Soil | MGLPNKRLKLTGGDRSKGNVVLCPGGQGLSSITLAPAGESPAA* |
| Ga0137380_100330636 | 3300012206 | Vadose Zone Soil | MAPNKRLKLAGGDRFKENGVLCPGGARTSSTTLAPAGESPAA* |
| Ga0137381_100495986 | 3300012207 | Vadose Zone Soil | MRRLPNKRLKMAGDCSKGVGVLCPGEHGLLSSSLAPAGESPAA* |
| Ga0137376_104236473 | 3300012208 | Vadose Zone Soil | PFVGGVKPAPNKRLKLTGGDRLKGIGVLCPGGHGLSSTTLAPTGESPAA* |
| Ga0137376_107619351 | 3300012208 | Vadose Zone Soil | MIGQGSVRCLPNKRLKLAGGDRYKGNGVLCPGGHGLSSHDLAPTG |
| Ga0137379_101626413 | 3300012209 | Vadose Zone Soil | VLPNKRLKLAGGDRSKGTGVLCPGGHGLSSTSLAPASGSPAA* |
| Ga0137377_110861871 | 3300012211 | Vadose Zone Soil | VRLVESLPNKRLKLTGGDRLKRIGVLCPGGHGLSSTTLAP |
| Ga0137377_114254582 | 3300012211 | Vadose Zone Soil | VLPNKRLKLTGGDRSTESGALCPGRHGLSSTTLAPAGESP |
| Ga0137367_111333012 | 3300012353 | Vadose Zone Soil | MRLKLPGGDRSKGSGVLCAGAHELSLNYTAPAGGSP |
| Ga0137371_105480602 | 3300012356 | Vadose Zone Soil | RVPPPNKRLKLAGADRFKGTGVLCPWRARKLSSTTLAPAGESPAA* |
| Ga0137385_108647281 | 3300012359 | Vadose Zone Soil | MAQVATPKKRLKLAGVDRSKGIRVLCAGGHGLSSRSLAPAGESSAA |
| Ga0137385_114748421 | 3300012359 | Vadose Zone Soil | MPLSNKRLKLAGGDRFKGSGVLCPGGHGLSSTTLAPAGESPAA |
| Ga0137375_106521272 | 3300012360 | Vadose Zone Soil | SNKRLKLTGVDRSKGIGVFAPGGDGLASTSLAPTGESPAA* |
| Ga0137416_120262672 | 3300012927 | Vadose Zone Soil | MWSRTREGLDALPNMRLKLTGGDRSKGIGVLCPGGHELTFNIAGPVGGSP |
| Ga0134077_100139382 | 3300012972 | Grasslands Soil | VLPNKRLKLAGGDRLKGIGVLCPGGHGLSSTALAPAGGSPAA* |
| Ga0134076_100712911 | 3300012976 | Grasslands Soil | IALSRPPNKRLKLAGGDRLKGSVVLCPGGHGLSSTTFAPAGESPAA* |
| Ga0134076_101525683 | 3300012976 | Grasslands Soil | PNKRLKLAGGDRFKGSGVLCPDGHELSFNILAAAGGSPAA* |
| Ga0134076_101960462 | 3300012976 | Grasslands Soil | MLPPNKRLKLAGGDRFRGTGVLCPGVHELTFNTTAPCGESPAAKRDPLDG |
| Ga0134078_104098321 | 3300014157 | Grasslands Soil | MRLPNKRLKLTGGDRFNGIGVLCPRGHGLTSNTLAPA |
| Ga0137418_100115047 | 3300015241 | Vadose Zone Soil | MIVPSWRALPNKRLKLAGGDRFKGSGVLCPGGHGLSSTGLALASGSPAA* |
| Ga0134072_102777571 | 3300015357 | Grasslands Soil | VLPNKRLKLTGGDRFKGSGVLCPGGQGLSPTTLAPAGGSPAARVVDDS |
| Ga0134085_100231931 | 3300015359 | Grasslands Soil | MRLKLAGGDRSSGNGVLCARGHGLTSTTLAPASESP |
| Ga0134074_10578623 | 3300017657 | Grasslands Soil | NKRLKLAGGDRFKGNGVLCAGAHDLSFNGLAPAGGSPAA |
| Ga0134074_10733061 | 3300017657 | Grasslands Soil | EAILTSAVVKLLPNKRLKLAGGDRFKGNGVLCPGGIQLSSNSLAPAGGSPAA |
| Ga0134083_101536452 | 3300017659 | Grasslands Soil | DWGQPPNKRLKLAGGDRFKGNGVLRPGGHGLSSTALAPAGESPAA |
| Ga0134083_103749601 | 3300017659 | Grasslands Soil | PLHDPVAAMPLPNKRLKLAGDDRFKGSGVLCLGGHGLSSTTLAPAAESPAA |
| Ga0066655_102215333 | 3300018431 | Grasslands Soil | YGFCSGHRIARQLPNKRLTLTGGDRCKGSGVLCAGAHELSFNDTAPTGESPAA |
| Ga0066667_107811532 | 3300018433 | Grasslands Soil | RPLVSQPILDLPLPNKRLKLAGDDRFKGSGVLCPGGHGLSSNTLAPAGESPAA |
| Ga0066667_109261743 | 3300018433 | Grasslands Soil | MLLPNKRLKLPGDERSNGTGVLCPWRARTSSHTRAPASGSPAAYTLHH |
| Ga0066669_100763251 | 3300018482 | Grasslands Soil | CALLRFALSEERLKLAGVDRFKGIGVLCPCGHGLSSTTLAPARESPAA |
| Ga0209236_10276371 | 3300026298 | Grasslands Soil | VLPNKRLKLTGGDRFKGNGVLCPGGRGLTSNGLAPA |
| Ga0209238_11159481 | 3300026301 | Grasslands Soil | VLPNKRLKLTGGDRFKGNGVLCPGGRGLTSNGLAPAD |
| Ga0209469_10159996 | 3300026307 | Soil | MTTLLNKRLKLAGVDRSREAECCAPGGARTSSLTLAPASES |
| Ga0209055_10139656 | 3300026309 | Soil | MRRLPNKRLKLAGDRSKGVGVLCPGEHGLSSSSLAPAGESPAA |
| Ga0209153_10139364 | 3300026312 | Soil | MLLPNKRLKLAGGDRFSGSEVLSPGGHGLSSTTLAPAGESPAA |
| Ga0209761_10205177 | 3300026313 | Grasslands Soil | HVLLPNKRLKLAGAARFKGSGVLCPGGHGLSSTGLAPAGESPAA |
| Ga0209761_11138623 | 3300026313 | Grasslands Soil | VTPPPNKRLKLTGGDRSKGKRSVGALAGAGLSSHSLAPAG |
| Ga0209471_10136312 | 3300026318 | Soil | VLASRVALKPNKRLKLTGVYRSKGDGVLCPGGHGLSSINLAPAGESPAA |
| Ga0209471_11010791 | 3300026318 | Soil | GKQSERCGRSWRGVAPNKGLKLAGGDRSKGNGVLCPGGHGLSSTTLAPAGGSPAA |
| Ga0209375_10146651 | 3300026329 | Soil | PNKRLKLTGGERFKGNVVLCPGGHGLSPHTLAPAGESPAA |
| Ga0209473_12135512 | 3300026330 | Soil | VLPNKRLKLAGGDRLKGTGVLCPGEHRLSPNNLAPARG |
| Ga0209267_11510241 | 3300026331 | Soil | ESLWGTLPNKRLKLAGGDRFKGSGVLCPGGHGLSSTTLAPTDESPAA |
| Ga0209057_10101075 | 3300026342 | Soil | MLLPNKRLKLAGGDRLKGSGALCPGGHGLSSQGLAPAGESPAA |
| Ga0209056_100143672 | 3300026538 | Soil | MTVAEAPPNKRLKLAGGDRFKGNGALCPGGHGLTSTTLAPGGESPAA |
| Ga0209056_100667763 | 3300026538 | Soil | MQPPNKRLKLTGGNRSKGSGVLCPGKHGLSSHTLAPAGGSPAA |
| Ga0209056_100698795 | 3300026538 | Soil | MTGVLPNKRLKLAGGDRFKGNGVLCPGGHGLSSTTLAPAGESPAA |
| Ga0209056_101970333 | 3300026538 | Soil | VIVARAETRLPNKRLKLAGGDRFKGSGVLCPSGHGRSSTTLAPAGESPAA |
| Ga0209056_106451152 | 3300026538 | Soil | MPSDVIGKVLPNKRLKLTGGDRFKGSGVLCPGGHRLSSNTLAPA |
| Ga0209376_101234311 | 3300026540 | Soil | MVLVKVQPNKRLKLTGAYRLSGIGVLCPGGHRLSSHTLAPAGESPAA |
| Ga0209581_100192631 | 3300027706 | Surface Soil | MKAALPNMRLKLAGGDRSKEAECLRPGGHGLSSNILAPASGSPAA |
| Ga0209590_100193161 | 3300027882 | Vadose Zone Soil | VRPNKRLKLPGGDRSKESGVFCPGVHGLSSTTLAPAGESPAA |
| ⦗Top⦘ |