Basic Information | |
---|---|
Family ID | F051021 |
Family Type | Metagenome |
Number of Sequences | 144 |
Average Sequence Length | 38 residues |
Representative Sequence | MIVIPASLRSDFIHMAGMTIHIALESTIHIVGIRT |
Number of Associated Samples | 132 |
Number of Associated Scaffolds | 144 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 57.04 % |
% of genes near scaffold ends (potentially truncated) | 63.19 % |
% of genes from short scaffolds (< 2000 bps) | 35.42 % |
Associated GOLD sequencing projects | 126 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.361 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.083 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.361 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.86% β-sheet: 22.86% Coil/Unstructured: 54.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 144 Family Scaffolds |
---|---|---|
PF08483 | Obsolete Pfam Family | 35.42 |
PF00665 | rve | 20.83 |
PF01695 | IstB_IS21 | 9.03 |
PF00589 | Phage_integrase | 1.39 |
PF08241 | Methyltransf_11 | 0.69 |
PF02416 | TatA_B_E | 0.69 |
PF05935 | Arylsulfotrans | 0.69 |
PF03544 | TonB_C | 0.69 |
PF09250 | Prim-Pol | 0.69 |
PF14690 | zf-ISL3 | 0.69 |
PF01979 | Amidohydro_1 | 0.69 |
PF13385 | Laminin_G_3 | 0.69 |
PF00196 | GerE | 0.69 |
PF13517 | FG-GAP_3 | 0.69 |
PF05534 | HicB | 0.69 |
PF08808 | RES | 0.69 |
COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
---|---|---|---|
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 20.83 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 20.83 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 20.83 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 20.83 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 9.03 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG1598 | Antitoxin component HicB of the HicAB toxin-antitoxin system | Defense mechanisms [V] | 0.69 |
COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.69 |
COG4226 | Predicted nuclease of the RNAse H fold, HicB family | General function prediction only [R] | 0.69 |
COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.36 % |
Unclassified | root | N/A | 7.64 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000597|AF_2010_repII_A1DRAFT_10006093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3309 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10095607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300001100|JGI12703J13194_104759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
3300001545|JGI12630J15595_10000775 | All Organisms → cellular organisms → Bacteria | 6575 | Open in IMG/M |
3300001593|JGI12635J15846_10226541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1216 | Open in IMG/M |
3300005445|Ga0070708_100146822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2191 | Open in IMG/M |
3300005559|Ga0066700_10571225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
3300005602|Ga0070762_10339362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 955 | Open in IMG/M |
3300005764|Ga0066903_102096440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1088 | Open in IMG/M |
3300005952|Ga0080026_10019779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1632 | Open in IMG/M |
3300006796|Ga0066665_10055795 | All Organisms → cellular organisms → Bacteria | 2743 | Open in IMG/M |
3300009090|Ga0099827_10025982 | All Organisms → cellular organisms → Bacteria | 4157 | Open in IMG/M |
3300009552|Ga0116138_1007584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3977 | Open in IMG/M |
3300009617|Ga0116123_1004704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5781 | Open in IMG/M |
3300009623|Ga0116133_1003878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3865 | Open in IMG/M |
3300009639|Ga0116122_1010347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3562 | Open in IMG/M |
3300009762|Ga0116130_1007844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4023 | Open in IMG/M |
3300010048|Ga0126373_10353436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1482 | Open in IMG/M |
3300010048|Ga0126373_10555502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
3300010048|Ga0126373_12164465 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300010325|Ga0134064_10159583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
3300010361|Ga0126378_10524838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1299 | Open in IMG/M |
3300010376|Ga0126381_103927298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
3300010398|Ga0126383_10080652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2840 | Open in IMG/M |
3300011269|Ga0137392_10144103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1918 | Open in IMG/M |
3300012189|Ga0137388_10082814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2710 | Open in IMG/M |
3300012205|Ga0137362_10107083 | All Organisms → cellular organisms → Bacteria | 2360 | Open in IMG/M |
3300012925|Ga0137419_10415869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1053 | Open in IMG/M |
3300014165|Ga0181523_10435823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
3300014201|Ga0181537_10046997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2932 | Open in IMG/M |
3300014654|Ga0181525_10039053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2771 | Open in IMG/M |
3300016422|Ga0182039_10177034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1680 | Open in IMG/M |
3300017929|Ga0187849_1019609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3856 | Open in IMG/M |
3300017931|Ga0187877_1017733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3975 | Open in IMG/M |
3300017932|Ga0187814_10028155 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
3300017940|Ga0187853_10019230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3826 | Open in IMG/M |
3300017946|Ga0187879_10003939 | All Organisms → cellular organisms → Bacteria | 9945 | Open in IMG/M |
3300017948|Ga0187847_10009554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6483 | Open in IMG/M |
3300017955|Ga0187817_10023299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3699 | Open in IMG/M |
3300017961|Ga0187778_11030314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
3300017998|Ga0187870_1018253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3603 | Open in IMG/M |
3300018015|Ga0187866_1015827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4020 | Open in IMG/M |
3300018023|Ga0187889_10024123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3578 | Open in IMG/M |
3300018026|Ga0187857_10028467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3025 | Open in IMG/M |
3300018037|Ga0187883_10058166 | Not Available | 2039 | Open in IMG/M |
3300020581|Ga0210399_11454054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300020582|Ga0210395_10041848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3354 | Open in IMG/M |
3300020583|Ga0210401_10032036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5009 | Open in IMG/M |
3300021171|Ga0210405_10022603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5081 | Open in IMG/M |
3300021180|Ga0210396_10047828 | All Organisms → cellular organisms → Bacteria | 3924 | Open in IMG/M |
3300021181|Ga0210388_10012951 | All Organisms → cellular organisms → Bacteria | 6657 | Open in IMG/M |
3300021404|Ga0210389_10352041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1156 | Open in IMG/M |
3300021406|Ga0210386_10283311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1418 | Open in IMG/M |
3300021432|Ga0210384_10053671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3652 | Open in IMG/M |
3300021474|Ga0210390_10091888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2527 | Open in IMG/M |
3300021560|Ga0126371_10151041 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
3300022557|Ga0212123_10113917 | All Organisms → cellular organisms → Bacteria | 2170 | Open in IMG/M |
3300022557|Ga0212123_10200819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1478 | Open in IMG/M |
3300022733|Ga0224562_1007607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
3300023259|Ga0224551_1001062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4621 | Open in IMG/M |
3300023259|Ga0224551_1061424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
3300025412|Ga0208194_1002414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3694 | Open in IMG/M |
3300025419|Ga0208036_1002222 | All Organisms → cellular organisms → Bacteria | 6994 | Open in IMG/M |
3300025432|Ga0208821_1004887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4018 | Open in IMG/M |
3300025439|Ga0208323_1005567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3625 | Open in IMG/M |
3300025444|Ga0208189_1005425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3683 | Open in IMG/M |
3300025453|Ga0208455_1004708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3667 | Open in IMG/M |
3300025454|Ga0208039_1005660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3648 | Open in IMG/M |
3300025460|Ga0208562_1005058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3643 | Open in IMG/M |
3300025473|Ga0208190_1004945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3707 | Open in IMG/M |
3300025477|Ga0208192_1007269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3643 | Open in IMG/M |
3300025480|Ga0208688_1006332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3736 | Open in IMG/M |
3300025501|Ga0208563_1008450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3629 | Open in IMG/M |
3300025506|Ga0208937_1004499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4012 | Open in IMG/M |
3300025612|Ga0208691_1006051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3377 | Open in IMG/M |
3300025922|Ga0207646_10050192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3734 | Open in IMG/M |
3300026469|Ga0257169_1000056 | All Organisms → cellular organisms → Bacteria | 3783 | Open in IMG/M |
3300027545|Ga0209008_1037697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1115 | Open in IMG/M |
3300027590|Ga0209116_1003803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3234 | Open in IMG/M |
3300027590|Ga0209116_1126609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300027629|Ga0209422_1001519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5623 | Open in IMG/M |
3300027671|Ga0209588_1213728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
3300027825|Ga0209039_10018401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3633 | Open in IMG/M |
3300027846|Ga0209180_10018607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3662 | Open in IMG/M |
3300027875|Ga0209283_10024757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3709 | Open in IMG/M |
3300027884|Ga0209275_10798594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300027903|Ga0209488_10092549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2260 | Open in IMG/M |
3300028759|Ga0302224_10007403 | All Organisms → cellular organisms → Bacteria | 4111 | Open in IMG/M |
3300028776|Ga0302303_10038028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1938 | Open in IMG/M |
3300028780|Ga0302225_10064120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1808 | Open in IMG/M |
3300028798|Ga0302222_10011725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3612 | Open in IMG/M |
3300028871|Ga0302230_10035952 | All Organisms → cellular organisms → Bacteria | 2162 | Open in IMG/M |
3300029882|Ga0311368_10148441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1920 | Open in IMG/M |
3300029889|Ga0246001_1009127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3636 | Open in IMG/M |
3300029951|Ga0311371_10403833 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
3300030042|Ga0302300_1018460 | All Organisms → cellular organisms → Bacteria | 2631 | Open in IMG/M |
3300030618|Ga0311354_10126729 | All Organisms → cellular organisms → Bacteria | 2817 | Open in IMG/M |
3300031234|Ga0302325_10136110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4453 | Open in IMG/M |
3300031236|Ga0302324_100341636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2268 | Open in IMG/M |
3300031236|Ga0302324_102244122 | Not Available | 675 | Open in IMG/M |
3300031545|Ga0318541_10018767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3275 | Open in IMG/M |
3300031564|Ga0318573_10018823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3080 | Open in IMG/M |
3300031668|Ga0318542_10009667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3605 | Open in IMG/M |
3300031679|Ga0318561_10017966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3235 | Open in IMG/M |
3300031680|Ga0318574_10778933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
3300031715|Ga0307476_10255085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1281 | Open in IMG/M |
3300031719|Ga0306917_10022492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3916 | Open in IMG/M |
3300031751|Ga0318494_10330561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
3300031754|Ga0307475_10047026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3226 | Open in IMG/M |
3300031763|Ga0318537_10153345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
3300031764|Ga0318535_10013162 | All Organisms → cellular organisms → Bacteria | 3018 | Open in IMG/M |
3300031768|Ga0318509_10013638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3605 | Open in IMG/M |
3300031770|Ga0318521_10015241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3451 | Open in IMG/M |
3300031771|Ga0318546_10046273 | All Organisms → cellular organisms → Bacteria | 2684 | Open in IMG/M |
3300031821|Ga0318567_10856462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300031833|Ga0310917_10025418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3450 | Open in IMG/M |
3300031890|Ga0306925_10407576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1456 | Open in IMG/M |
3300031890|Ga0306925_11307921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
3300031912|Ga0306921_11294446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
3300031947|Ga0310909_10088875 | All Organisms → cellular organisms → Bacteria | 2463 | Open in IMG/M |
3300031954|Ga0306926_10066219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4360 | Open in IMG/M |
3300031954|Ga0306926_10205867 | All Organisms → cellular organisms → Bacteria | 2441 | Open in IMG/M |
3300031954|Ga0306926_10455338 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
3300031962|Ga0307479_10074747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3277 | Open in IMG/M |
3300032001|Ga0306922_10605746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1160 | Open in IMG/M |
3300032025|Ga0318507_10131407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1062 | Open in IMG/M |
3300032035|Ga0310911_10537761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
3300032041|Ga0318549_10007814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3604 | Open in IMG/M |
3300032042|Ga0318545_10040804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1549 | Open in IMG/M |
3300032052|Ga0318506_10140820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1052 | Open in IMG/M |
3300032059|Ga0318533_11430505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300032094|Ga0318540_10010866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3551 | Open in IMG/M |
3300032261|Ga0306920_100761709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1423 | Open in IMG/M |
3300032261|Ga0306920_101203707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1094 | Open in IMG/M |
3300033289|Ga0310914_10829343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.00% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 13.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.72% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.72% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.94% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.25% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.86% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.86% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.08% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.08% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.39% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.39% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.39% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.39% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.39% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.39% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.69% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.69% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.69% |
Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300001100 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 | Environmental | Open in IMG/M |
3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
3300025419 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes) | Environmental | Open in IMG/M |
3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A1DRAFT_100060934 | 3300000597 | Forest Soil | MIATPASLRSDFIHIVGMVIYIAPESTNHITGIRSS |
AF_2010_repII_A001DRAFT_100956071 | 3300000793 | Forest Soil | MIATPASLRSDFIHIVGMAIHIAPERTNHITGIRT |
JGI12703J13194_1047591 | 3300001100 | Forest Soil | MIVVPASLRSDFIHMAGMTIHIALESTIHIAGIRTNAA |
JGI12630J15595_100007751 | 3300001545 | Forest Soil | MIEISASLRSDFIHIAGTAIHIAPECTIHITGIRSLPRHRS |
JGI12635J15846_102265411 | 3300001593 | Forest Soil | MSGMIVTPASLRSDFIHMAGMTIHIALESTIHIAGIR |
Ga0070708_1001468224 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LINVQVSGMIVIPASLRSDFIHVAGMTTHIALESTIHIAGIR |
Ga0066700_105712252 | 3300005559 | Soil | VSGMIVIPASLRSDFIHTAGMTIHIALESTIHIVGIRIYDS* |
Ga0070762_103393621 | 3300005602 | Soil | MIVIPASLRSDFIHMAGMTIHIALESTIHIVGIRS* |
Ga0066903_1020964402 | 3300005764 | Tropical Forest Soil | MIAIPASLGSNFIHIAGMPIHIAPEYTIHIIGIRTHQDDQVSSA* |
Ga0080026_100197792 | 3300005952 | Permafrost Soil | MIVIPASLRSDFIHMAGMTIHIALESSIHIVGIRSGRLL* |
Ga0066665_100557957 | 3300006796 | Soil | MIVIPASLRSDFIHIAGMTIHIALESTIHIVGIRSSDA* |
Ga0099827_100259821 | 3300009090 | Vadose Zone Soil | MSKVSGMIAIPASLRSDFIHIPGTPIHIALESTIH |
Ga0116138_10075844 | 3300009552 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRS* |
Ga0116123_10047042 | 3300009617 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRR* |
Ga0116133_10038784 | 3300009623 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRNQ* |
Ga0116122_10103471 | 3300009639 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRTWIG* |
Ga0116130_10078445 | 3300009762 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRN* |
Ga0126373_103534361 | 3300010048 | Tropical Forest Soil | MIATPASLRSDFIHIVGMAIYIAPESTNHITGIRT |
Ga0126373_105555021 | 3300010048 | Tropical Forest Soil | ATPASLRSDFIHIVGMAIYIAPESTNHITGIRTLAMN* |
Ga0126373_121644651 | 3300010048 | Tropical Forest Soil | MVSGMIPIPASLRSDFIHIPGTLIHIALESTIHIIGISTP |
Ga0134064_101595831 | 3300010325 | Grasslands Soil | MIVIPASLRSDFIHMAGMTIHIALESTIHIVGIRTLGSGLS |
Ga0126378_105248383 | 3300010361 | Tropical Forest Soil | MIATPASLRSDFIHIVGMAIYIAPESTNHITGIRT* |
Ga0126381_1039272981 | 3300010376 | Tropical Forest Soil | MIATPASLRSDSIHIVGMAIYIAPESTNHITGIRTSLVA |
Ga0126383_100806521 | 3300010398 | Tropical Forest Soil | MIAIPASLGSNFIHIAGMSIHIAPEYTIHIIGIRKVC* |
Ga0137392_101441031 | 3300011269 | Vadose Zone Soil | MIVIPASLRSDFIHMAGMTIHIALESTIHIVGIRTFRRCESVAG* |
Ga0137388_100828143 | 3300012189 | Vadose Zone Soil | MIVIPASLRSDFIHIDGMTIHIALESTIHIVGIRSHWQNLQE* |
Ga0137362_101070834 | 3300012205 | Vadose Zone Soil | MIVIPASLRSDFIHIAGMTIHIALESTIHIVGIRSHWQNLQE* |
Ga0137419_104158691 | 3300012925 | Vadose Zone Soil | MSKVSGMIAIPASLRSDFIHITGTPIHIALESTIHITGIRS |
Ga0181523_104358231 | 3300014165 | Bog | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRI |
Ga0181537_100469972 | 3300014201 | Bog | MIVIPASLRSDFIHIVGMPIHIPLESTVHIAGIRTLRPARSRGR* |
Ga0181525_100390534 | 3300014654 | Bog | MPKGSGMIVIPASLRSDFIHIVGMPIHIPLESTVHIAGIR |
Ga0182037_106302943 | 3300016404 | Soil | MVSGMIPIPASLRSDLIHIPGTLIHIALESTIHIVGIRTGAQSIV |
Ga0182039_101770341 | 3300016422 | Soil | MVSGMIAIPASLRSDFIHIPGTLIHIALESTIHIVGIRIHPV |
Ga0187849_10196091 | 3300017929 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRTRPRVH |
Ga0187877_10177334 | 3300017931 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRTTRIR |
Ga0187814_100281554 | 3300017932 | Freshwater Sediment | MIAIPASLRSDFIHIAGMTIHIALESTIHIIGIVSHQ |
Ga0187853_100192301 | 3300017940 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRTHPHLRAFT |
Ga0187879_100039391 | 3300017946 | Peatland | ISKVSGMIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRS |
Ga0187847_1000955410 | 3300017948 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRN |
Ga0187817_100232994 | 3300017955 | Freshwater Sediment | MIAIPASLRSDFIHIAGMTIHIALESTIHIIGIVT |
Ga0187778_110303141 | 3300017961 | Tropical Peatland | STLSGMIAIPASLRSDFIHIAGMLIHIALESTIHIIGISRQV |
Ga0187870_10182531 | 3300017998 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRIIDAEMTSAVIEN |
Ga0187866_10158275 | 3300018015 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRTGFYKDV |
Ga0187889_100241234 | 3300018023 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRNQ |
Ga0187857_100284674 | 3300018026 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRSDLSNF |
Ga0187883_100581664 | 3300018037 | Peatland | RSDFIHMAGMTIHIALESTIHIVGIRTHPHLRAFT |
Ga0210399_114540542 | 3300020581 | Soil | MIVIPASLRSDFIHMAGMTIHIALESTIHIVGIRTR |
Ga0210395_100418481 | 3300020582 | Soil | MIVIPASLRSDFIHMAGMTIHIALESTIHIVGIRTT |
Ga0210401_100320361 | 3300020583 | Soil | MIVIPASLRSDFIHMAGMTIHIALESTIHIVGIRIAT |
Ga0210405_100226035 | 3300021171 | Soil | MIVIPASLRSDFIHMAGMTIHIALESTIHIVGIRSEP |
Ga0210396_100478284 | 3300021180 | Soil | MIVIPASLSSDFIHMAGMTIHIALESTIHIAGIRNYTL |
Ga0210388_100129511 | 3300021181 | Soil | MIVIPASLRSDFIHIAGMPIHIPLESIIHIAGIRSRPISR |
Ga0210389_103520413 | 3300021404 | Soil | MIVIPASLSSDFIHMAGMTIHIALESTIHIAGIRNKPK |
Ga0210386_102833111 | 3300021406 | Soil | MIVIPASLSSDFIHMAGMTIHIALESTIHIAGIRS |
Ga0210384_100536714 | 3300021432 | Soil | MIVIPASLRSDFIHMAGMTIHIALESTIHIVGIRTTRICV |
Ga0210390_100918885 | 3300021474 | Soil | MIVIPASLRSDFIHMAGMTIHIALESTIHIVGIRNRLKSAQA |
Ga0126371_101510411 | 3300021560 | Tropical Forest Soil | MIATPASLRSDFIHIVGMAIYIAPESTNHITGIRNCATVCVS |
Ga0212123_101139171 | 3300022557 | Iron-Sulfur Acid Spring | MIVIPASLRSDFIHMPGMTIHIALESTIHIAGIRNP |
Ga0212123_102008191 | 3300022557 | Iron-Sulfur Acid Spring | MIVVPASLRSDFIHMAGITIHIALESTIHIVGIRN |
Ga0224562_10076071 | 3300022733 | Soil | MIVIPASLRSDFIHMAGMTIHIALESTIHIVGIRT |
Ga0224551_10010625 | 3300023259 | Soil | MIVIPASLRSDFIHMAGMTIHIALESTIHIVGIRTSLRRF |
Ga0224551_10614242 | 3300023259 | Soil | MIVIPASLSSAFIHMAGMTIHIALESTIHIAGIRSM |
Ga0208194_10024141 | 3300025412 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRTIL |
Ga0208036_100222210 | 3300025419 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRRHATFA |
Ga0208821_10048871 | 3300025432 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRTD |
Ga0208323_10055671 | 3300025439 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRR |
Ga0208189_10054251 | 3300025444 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRNLGFVVAVSFG |
Ga0208455_10047084 | 3300025453 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRS |
Ga0208039_10056601 | 3300025454 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRSMPHL |
Ga0208562_10050581 | 3300025460 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRTRHHGGD |
Ga0208190_10049451 | 3300025473 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRRL |
Ga0208192_10072694 | 3300025477 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRNN |
Ga0208688_10063325 | 3300025480 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRSEF |
Ga0208563_10084504 | 3300025501 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRMSG |
Ga0208937_10044991 | 3300025506 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRTIPT |
Ga0208691_10060514 | 3300025612 | Peatland | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRSYQGI |
Ga0207646_100501921 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVIPASLRSDFIHMAGMTIHIALESTIHIVGIRIPVCNAI |
Ga0257169_10000564 | 3300026469 | Soil | MIVIPASLRSDFIHIAGMPIHIPLESTIHIAGIRNFA |
Ga0209008_10376972 | 3300027545 | Forest Soil | MIVIPASLRSDFIHMAGMTIHIALESTIHIVGIRSEGLADEF |
Ga0209116_10038034 | 3300027590 | Forest Soil | MSGMIVTPASLRSDFIHMAGMTIHIALESTIHIAGIRSLTAFLS |
Ga0209116_11266091 | 3300027590 | Forest Soil | MIVIPASLSSDFIHIAGMTIPIALESTIHITGIRKQETEPSQAGLRW |
Ga0209422_10015195 | 3300027629 | Forest Soil | MSGMIVVPASLRSDFIHMAGMTIHIALESTIHIAGIRSLSLIIVT |
Ga0209588_12137283 | 3300027671 | Vadose Zone Soil | MSKVSGMIAIPASLRSDFIHITGTPIHIALESTIHITG |
Ga0209039_100184012 | 3300027825 | Bog Forest Soil | MIATPASLRSDFIHIAGTSIHIALESSIHIAGIAT |
Ga0209180_100186071 | 3300027846 | Vadose Zone Soil | MIAIPASLRSDFIHIPGTPIHIALESTIHITGIRS |
Ga0209283_100247571 | 3300027875 | Vadose Zone Soil | MIAIPASLRSDFIHIPGTPIHIALESTIHITGIRR |
Ga0209275_107985941 | 3300027884 | Soil | MSGMIVIPASLRSDFIHMAGMTIHIALESTIHIAGIRNRR |
Ga0209488_100925494 | 3300027903 | Vadose Zone Soil | MIVIPASLRSDFIHIAGMTIHIALESTIHIVGIRSHWQNLQE |
Ga0302224_100074031 | 3300028759 | Palsa | MIVIPASLRSDFIHIVGMPIHIPLESTVHIAGIRTLT |
Ga0302303_100380284 | 3300028776 | Palsa | MIVIPASLRSDFIHMPGMTIHIALESTIHIVGIRI |
Ga0302225_100641203 | 3300028780 | Palsa | MPKGSGIIVIPASLRSDFIHIVGMPIHIPLESTVH |
Ga0302222_100117255 | 3300028798 | Palsa | MIVIPASLRSDFIHMPGMTIHIALESTIHIVGIRILA |
Ga0302230_100359521 | 3300028871 | Palsa | MIVIPASLRSDFIHIVGMPIHIPLESTVHIAGIRIGCGCAWTA |
Ga0311368_101484411 | 3300029882 | Palsa | MIVIPASLRSDFIHMPGMTIHIALESTIHIVGIRTEPPAK |
Ga0246001_10091271 | 3300029889 | Peat | MIVVPASLRSDFIHMAGMTIHIALESTIHIVGIRSME |
Ga0311363_100906385 | 3300029922 | Fen | MPKGSGIIVIPASLRSDFIHIVGMPIHIPLESTVHIAGI |
Ga0311352_102293911 | 3300029944 | Palsa | MPKGSGIIVIPASLRSDFIHIVGMPIHIPLESTVHIAGIRI |
Ga0311371_104038334 | 3300029951 | Palsa | SLRSDFIHIVGMPIHIPLESTVHIAGIRIQLTAVLL |
Ga0302300_10184601 | 3300030042 | Palsa | MIVIPASLRSDFIHIVGMPIHIPLESTVHIAGIRR |
Ga0302181_100217644 | 3300030056 | Palsa | MPKGSGIIVIPASLRSDFIHIVGMPIHIPLESTVHIAG |
Ga0311354_101267294 | 3300030618 | Palsa | MIVIPASLRSDFIHMPGMTIHIALESTIHIVGIRSQSLKV |
Ga0302325_101361103 | 3300031234 | Palsa | MIVIPESLRSDFIHMPGMNIHIALESTIHIVGIRTGHQTKPDRLP |
Ga0302324_1003416362 | 3300031236 | Palsa | MIVIPASLRSDFIHIAGMPIHIPLESTIHIAGIRSLTAHMLH |
Ga0302324_1022441221 | 3300031236 | Palsa | GMIVIPASLRSDFIHIVGMPIHIPLESTVHIAGIRTLTRSASEIQ |
Ga0318541_100187671 | 3300031545 | Soil | MIATPASLRSDFIHIVGMAIHIAPECTNHITGIRKLR |
Ga0318573_100188231 | 3300031564 | Soil | MIATPASLRSDFIHIVGMAIHIAPECTNHITGIRSQE |
Ga0318542_100096671 | 3300031668 | Soil | MIATPASLRSDFIHIVGMAIHIAPECTNHITGIRSQQAVYRE |
Ga0318561_100179664 | 3300031679 | Soil | MIATPASLRSDFIHIVGMAIHIAPECTNHITGIRTLAVSEL |
Ga0318574_107789331 | 3300031680 | Soil | MIATPASLRSDFIHIVGMAIHIAPECTNHITGIRTE |
Ga0307476_102550853 | 3300031715 | Hardwood Forest Soil | MIVIPASLRSDFIHMAGMTIHIALESTIHIVGIRR |
Ga0306917_100224921 | 3300031719 | Soil | MIATPASLRSDFIHIVGMAIHIAPECTNHITGIRSQQAV |
Ga0318494_103305612 | 3300031751 | Soil | MIATPASLRSDFIHIVGMAIHIAPECTNHITGIRSLRTASKTDS |
Ga0307475_100470264 | 3300031754 | Hardwood Forest Soil | MIVIPASLRSDFIHMAGMTIHIALESTIHIVGIRTCKLRCG |
Ga0318537_101533452 | 3300031763 | Soil | MIATPASLRSDFIHIVGMAIHIAPECTNHITGIRN |
Ga0318535_100131621 | 3300031764 | Soil | MIATPASLRSDFIHIVGMAIHIAPECTNHITGIRTQRFCPIFAQLG |
Ga0318509_100136381 | 3300031768 | Soil | MIATPASLRSDFIHIVGMAIHIAPECTNHITGIRR |
Ga0318521_100152414 | 3300031770 | Soil | MIATSASLRSDFIHIVGMAIHIAPECTNHITGIRRES |
Ga0318546_100462731 | 3300031771 | Soil | MIATPASLRSDFIHIVGMAIHIAPECTNHITGIRSR |
Ga0318567_108564621 | 3300031821 | Soil | MIATSASLRSDFIHIVGMAIHIAPECTNHITGIRTDQQVT |
Ga0310917_100254181 | 3300031833 | Soil | MIATPASLRSDFIHIVGMAIHIAPECTNHITGIRRRRKK |
Ga0306925_104075761 | 3300031890 | Soil | MIATSASLRSDFIHIVGMAIHIAPECTNHITGIRILR |
Ga0306925_113079213 | 3300031890 | Soil | MIAIPASLRSDFIHIPGTLIHIALESTIHITGIGSWLG |
Ga0306923_104791181 | 3300031910 | Soil | MIAIPAKLCSDFILIPGTAIHIALEHTIHIAGIPT |
Ga0306921_112944462 | 3300031912 | Soil | MVSGMIPIPASPRSDLIHIPGTLIHIALESTIHIVGIRTGAQSIV |
Ga0310912_103214591 | 3300031941 | Soil | MIAIPAKLCSDFILIPGTAIHIALEHTIHIAGIPTS |
Ga0310916_114771822 | 3300031942 | Soil | MVLGMIPMPASLRSDFIHIPGTLIHIALESTIHIVGIRTGAQSIV |
Ga0310909_100415631 | 3300031947 | Soil | MIAIPAKLCSDFILIPGTAIHIALEHTIHIAGIPNP |
Ga0310909_100888754 | 3300031947 | Soil | MIATPASLRSDFIHIVGMAIHIAPECTNHITGIRTQSK |
Ga0306926_100662191 | 3300031954 | Soil | MIATPASLRSDFIHIVGMAIHIAPECTNHITGIRS |
Ga0306926_102058674 | 3300031954 | Soil | MIATSASLRSDFIHIVGMAIHIAPECTNHITGIRTDQQV |
Ga0306926_104553382 | 3300031954 | Soil | MIAIPASLRSDFIHIPGTLIHIALESTIHITGIGS |
Ga0306926_107988753 | 3300031954 | Soil | MIAIPAKLCSDFILIPGTAIHIALEHTIHIAGIPTSKE |
Ga0307479_100747474 | 3300031962 | Hardwood Forest Soil | MIVIPASLPSDFIHMAGMTIHIALESTVHIVGIRS |
Ga0306922_106057463 | 3300032001 | Soil | MIATPASLRSDFIHIVGMAIYIASETTNHIAGIRTQLLGECLQVVG |
Ga0318507_101314072 | 3300032025 | Soil | MIATSASLRSDFIHIVGMAIYIAPESTNHITGIRRHRRETGLGGST |
Ga0310911_105377611 | 3300032035 | Soil | MIAIPASLRSDFIHIPGTLIHIALESTIHITGIGSWL |
Ga0318549_100078141 | 3300032041 | Soil | MIATPASLRSDFIHIVGMAIHIAPECTNHITGIRT |
Ga0318545_100408043 | 3300032042 | Soil | MIATPASLRSDFIHIVGMAIHIAPECTNHITGIRTLR |
Ga0318506_101408201 | 3300032052 | Soil | MLATPASLRSDFIHIVGMAIYIAPESTNHITGIRSKCAT |
Ga0318533_114305051 | 3300032059 | Soil | MIATPASLRSDFIHIVGMAIYIASETTNHIAGIRSS |
Ga0318540_100108661 | 3300032094 | Soil | MIATPASLRSDFIHIVGMAIHIAPERANHITGIRT |
Ga0306920_1007617093 | 3300032261 | Soil | MLATPASLRSDFIHIVGMAIYIAPESTNHITGIRSVAKVERVCKKF |
Ga0306920_1012037072 | 3300032261 | Soil | MIAIPASLRSDFIHIPGTLIHIALESTIHITGIGTVVSEM |
Ga0310914_108293431 | 3300033289 | Soil | MPASLRSDFIHIPGTLIHIALESTIHIVGIRTGAQSI |
⦗Top⦘ |