| Basic Information | |
|---|---|
| Family ID | F051019 |
| Family Type | Metagenome |
| Number of Sequences | 144 |
| Average Sequence Length | 42 residues |
| Representative Sequence | RENVDLVIEFSLRGPKRLHDQVMIALLHHPSVRTVSTGE |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.13 % |
| % of genes near scaffold ends (potentially truncated) | 95.83 % |
| % of genes from short scaffolds (< 2000 bps) | 83.33 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.833 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.222 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.056 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.778 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.40% β-sheet: 0.00% Coil/Unstructured: 80.60% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF02826 | 2-Hacid_dh_C | 42.36 |
| PF00437 | T2SSE | 6.25 |
| PF00701 | DHDPS | 3.47 |
| PF01663 | Phosphodiest | 2.78 |
| PF04389 | Peptidase_M28 | 2.08 |
| PF00596 | Aldolase_II | 0.69 |
| PF02308 | MgtC | 0.69 |
| PF05635 | 23S_rRNA_IVP | 0.69 |
| PF02597 | ThiS | 0.69 |
| PF01676 | Metalloenzyme | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 6.94 |
| COG1285 | Magnesium uptake protein YhiD/SapB, involved in acid resistance | Inorganic ion transport and metabolism [P] | 0.69 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.69 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.69 |
| COG3174 | Membrane component of predicted Mg2+ transport system, contains DUF4010 domain | Inorganic ion transport and metabolism [P] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.83 % |
| Unclassified | root | N/A | 4.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_119121897 | Not Available | 596 | Open in IMG/M |
| 3300002558|JGI25385J37094_10005876 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 4327 | Open in IMG/M |
| 3300002558|JGI25385J37094_10119412 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 754 | Open in IMG/M |
| 3300002562|JGI25382J37095_10006048 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 4319 | Open in IMG/M |
| 3300005166|Ga0066674_10411583 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 625 | Open in IMG/M |
| 3300005171|Ga0066677_10708621 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 563 | Open in IMG/M |
| 3300005172|Ga0066683_10815236 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 541 | Open in IMG/M |
| 3300005174|Ga0066680_10619899 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 675 | Open in IMG/M |
| 3300005176|Ga0066679_10104490 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1726 | Open in IMG/M |
| 3300005179|Ga0066684_10178786 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1362 | Open in IMG/M |
| 3300005294|Ga0065705_11110968 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 520 | Open in IMG/M |
| 3300005440|Ga0070705_100672734 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 810 | Open in IMG/M |
| 3300005446|Ga0066686_10696303 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 686 | Open in IMG/M |
| 3300005447|Ga0066689_10115729 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1557 | Open in IMG/M |
| 3300005447|Ga0066689_10995002 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 516 | Open in IMG/M |
| 3300005536|Ga0070697_101146793 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 692 | Open in IMG/M |
| 3300005536|Ga0070697_101796403 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 548 | Open in IMG/M |
| 3300005552|Ga0066701_10533960 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 722 | Open in IMG/M |
| 3300005553|Ga0066695_10381714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 878 | Open in IMG/M |
| 3300005558|Ga0066698_10358926 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1006 | Open in IMG/M |
| 3300005559|Ga0066700_10580222 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 782 | Open in IMG/M |
| 3300005560|Ga0066670_10008143 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4342 | Open in IMG/M |
| 3300005560|Ga0066670_10009272 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4127 | Open in IMG/M |
| 3300005569|Ga0066705_10896200 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
| 3300005574|Ga0066694_10473457 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 585 | Open in IMG/M |
| 3300005586|Ga0066691_10599987 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 655 | Open in IMG/M |
| 3300005598|Ga0066706_10284436 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1297 | Open in IMG/M |
| 3300006034|Ga0066656_10929061 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 557 | Open in IMG/M |
| 3300006796|Ga0066665_10211119 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1513 | Open in IMG/M |
| 3300006797|Ga0066659_11084819 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 669 | Open in IMG/M |
| 3300006806|Ga0079220_10927734 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 680 | Open in IMG/M |
| 3300006853|Ga0075420_101192534 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 654 | Open in IMG/M |
| 3300006871|Ga0075434_102130460 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300006914|Ga0075436_100826808 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 691 | Open in IMG/M |
| 3300006969|Ga0075419_10049244 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2646 | Open in IMG/M |
| 3300007004|Ga0079218_11118869 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 806 | Open in IMG/M |
| 3300009012|Ga0066710_102605265 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 727 | Open in IMG/M |
| 3300009038|Ga0099829_10308004 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1300 | Open in IMG/M |
| 3300009090|Ga0099827_10036116 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3615 | Open in IMG/M |
| 3300009090|Ga0099827_11722106 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 546 | Open in IMG/M |
| 3300009137|Ga0066709_103529063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300009143|Ga0099792_11145984 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
| 3300009147|Ga0114129_10281765 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
| 3300009822|Ga0105066_1066202 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 771 | Open in IMG/M |
| 3300010304|Ga0134088_10608835 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 544 | Open in IMG/M |
| 3300010320|Ga0134109_10136572 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 875 | Open in IMG/M |
| 3300010321|Ga0134067_10059952 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1242 | Open in IMG/M |
| 3300010322|Ga0134084_10034514 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300010336|Ga0134071_10526355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300010336|Ga0134071_10700056 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300010399|Ga0134127_10858063 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 960 | Open in IMG/M |
| 3300010401|Ga0134121_11353127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300011269|Ga0137392_11062470 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 664 | Open in IMG/M |
| 3300011437|Ga0137429_1168406 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 683 | Open in IMG/M |
| 3300011440|Ga0137433_1054768 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1189 | Open in IMG/M |
| 3300012039|Ga0137421_1007494 | All Organisms → cellular organisms → Bacteria | 2301 | Open in IMG/M |
| 3300012096|Ga0137389_11014274 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 711 | Open in IMG/M |
| 3300012200|Ga0137382_10251396 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1225 | Open in IMG/M |
| 3300012204|Ga0137374_10027696 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 6269 | Open in IMG/M |
| 3300012208|Ga0137376_10255002 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1521 | Open in IMG/M |
| 3300012208|Ga0137376_10407905 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1180 | Open in IMG/M |
| 3300012209|Ga0137379_10198153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1921 | Open in IMG/M |
| 3300012210|Ga0137378_10331683 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 1414 | Open in IMG/M |
| 3300012232|Ga0137435_1275447 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
| 3300012285|Ga0137370_10186407 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1213 | Open in IMG/M |
| 3300012285|Ga0137370_10823570 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 575 | Open in IMG/M |
| 3300012349|Ga0137387_11077772 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 573 | Open in IMG/M |
| 3300012351|Ga0137386_11037613 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 582 | Open in IMG/M |
| 3300012355|Ga0137369_10219285 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 1458 | Open in IMG/M |
| 3300012359|Ga0137385_11647313 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 505 | Open in IMG/M |
| 3300012362|Ga0137361_10450504 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1182 | Open in IMG/M |
| 3300012363|Ga0137390_10144662 | All Organisms → cellular organisms → Bacteria | 2360 | Open in IMG/M |
| 3300012683|Ga0137398_11031734 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 569 | Open in IMG/M |
| 3300012685|Ga0137397_10587566 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 828 | Open in IMG/M |
| 3300012918|Ga0137396_10370063 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1061 | Open in IMG/M |
| 3300012929|Ga0137404_12149806 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 522 | Open in IMG/M |
| 3300012930|Ga0137407_12304612 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 515 | Open in IMG/M |
| 3300012944|Ga0137410_11858651 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 533 | Open in IMG/M |
| 3300012976|Ga0134076_10107738 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1111 | Open in IMG/M |
| 3300014157|Ga0134078_10495121 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 567 | Open in IMG/M |
| 3300014166|Ga0134079_10413099 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 631 | Open in IMG/M |
| 3300014166|Ga0134079_10467271 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 602 | Open in IMG/M |
| 3300014861|Ga0180061_1081814 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 543 | Open in IMG/M |
| 3300014879|Ga0180062_1118651 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 607 | Open in IMG/M |
| 3300015054|Ga0137420_1329048 | All Organisms → cellular organisms → Bacteria | 3345 | Open in IMG/M |
| 3300015358|Ga0134089_10210193 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 785 | Open in IMG/M |
| 3300015358|Ga0134089_10410640 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 580 | Open in IMG/M |
| 3300017654|Ga0134069_1236492 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 632 | Open in IMG/M |
| 3300017657|Ga0134074_1280415 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 604 | Open in IMG/M |
| 3300017657|Ga0134074_1386635 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 519 | Open in IMG/M |
| 3300017659|Ga0134083_10056309 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1489 | Open in IMG/M |
| 3300017659|Ga0134083_10105380 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1115 | Open in IMG/M |
| 3300017659|Ga0134083_10220239 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 788 | Open in IMG/M |
| 3300018063|Ga0184637_10341995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
| 3300018071|Ga0184618_10169459 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300018077|Ga0184633_10287226 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 840 | Open in IMG/M |
| 3300018082|Ga0184639_10087947 | All Organisms → cellular organisms → Bacteria | 1636 | Open in IMG/M |
| 3300018433|Ga0066667_10235188 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300018433|Ga0066667_12225203 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
| 3300018468|Ga0066662_11599323 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 680 | Open in IMG/M |
| 3300018482|Ga0066669_10412397 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1148 | Open in IMG/M |
| 3300019868|Ga0193720_1021434 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 916 | Open in IMG/M |
| 3300019880|Ga0193712_1003657 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3120 | Open in IMG/M |
| 3300020022|Ga0193733_1149785 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 631 | Open in IMG/M |
| 3300021073|Ga0210378_10337306 | Not Available | 563 | Open in IMG/M |
| 3300021086|Ga0179596_10590647 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 563 | Open in IMG/M |
| 3300022756|Ga0222622_11365903 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 521 | Open in IMG/M |
| 3300024317|Ga0247660_1079628 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 557 | Open in IMG/M |
| 3300025326|Ga0209342_10052064 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3876 | Open in IMG/M |
| 3300026285|Ga0209438_1117391 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 758 | Open in IMG/M |
| 3300026296|Ga0209235_1164102 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 855 | Open in IMG/M |
| 3300026297|Ga0209237_1036872 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2601 | Open in IMG/M |
| 3300026298|Ga0209236_1226984 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 642 | Open in IMG/M |
| 3300026301|Ga0209238_1156904 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 685 | Open in IMG/M |
| 3300026312|Ga0209153_1263384 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 552 | Open in IMG/M |
| 3300026316|Ga0209155_1016337 | All Organisms → cellular organisms → Bacteria | 3166 | Open in IMG/M |
| 3300026316|Ga0209155_1198596 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 633 | Open in IMG/M |
| 3300026326|Ga0209801_1345820 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 524 | Open in IMG/M |
| 3300026329|Ga0209375_1005053 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 8860 | Open in IMG/M |
| 3300026329|Ga0209375_1144869 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300026529|Ga0209806_1072714 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| 3300026538|Ga0209056_10371604 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 916 | Open in IMG/M |
| 3300026538|Ga0209056_10448863 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 735 | Open in IMG/M |
| 3300026548|Ga0209161_10148994 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300027765|Ga0209073_10008209 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2720 | Open in IMG/M |
| 3300027787|Ga0209074_10195230 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 757 | Open in IMG/M |
| 3300027875|Ga0209283_10540155 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 746 | Open in IMG/M |
| 3300027880|Ga0209481_10019254 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3007 | Open in IMG/M |
| 3300027882|Ga0209590_10037932 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2603 | Open in IMG/M |
| 3300027903|Ga0209488_10834901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 651 | Open in IMG/M |
| 3300027961|Ga0209853_1077436 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 873 | Open in IMG/M |
| 3300028536|Ga0137415_10196040 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1840 | Open in IMG/M |
| 3300028802|Ga0307503_10569513 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300028819|Ga0307296_10038629 | All Organisms → cellular organisms → Bacteria | 2519 | Open in IMG/M |
| 3300031965|Ga0326597_10710921 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1056 | Open in IMG/M |
| 3300032180|Ga0307471_101215801 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 917 | Open in IMG/M |
| 3300033407|Ga0214472_10176636 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2078 | Open in IMG/M |
| 3300033417|Ga0214471_10669082 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 818 | Open in IMG/M |
| 3300033551|Ga0247830_10673448 | Not Available | 821 | Open in IMG/M |
| 3300033815|Ga0364946_046331 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 895 | Open in IMG/M |
| 3300034113|Ga0364937_099666 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 593 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.86% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.17% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.08% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.39% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.39% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.39% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.69% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014861 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10D | Environmental | Open in IMG/M |
| 3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
| 3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1191218971 | 3300000956 | Soil | LDIERLESRHENVDMVVDLDLRGPKRLHDQLLLAVMHYPGVRAVSSGE* |
| JGI25385J37094_100058765 | 3300002558 | Grasslands Soil | GLDIVQQQSRRENVDLVVDFELRGPKRLHDQVMVALLHHPGVRTVSSGE* |
| JGI25385J37094_101194121 | 3300002558 | Grasslands Soil | VSSRQENVDLVIDLDMRGSRRLHDQVMITLLHHDHVRTVSTGE* |
| JGI25382J37095_100060481 | 3300002562 | Grasslands Soil | IVQQQSRRENVDLVVDFELRGPKRLHDQVMVALLHHPGVRTVSSGE* |
| Ga0066674_104115832 | 3300005166 | Soil | VESRRENVDLVIEYDVRGPKRLHDQVMIAILHHPIVRTVSTGE* |
| Ga0066677_107086212 | 3300005171 | Soil | RENVDLVIEFTLRGPKRLHDEVMIALLHHPGVRTVSTGE* |
| Ga0066683_108152362 | 3300005172 | Soil | VESRRENVDLVIEYDVRGPKRLHDQVMIAILHHPVVRTVSTGE* |
| Ga0066680_106198992 | 3300005174 | Soil | QASRRENVDLVIDFTLLGPKRLHDEVMVALLHEPGVRTVSTGE* |
| Ga0066679_101044901 | 3300005176 | Soil | LEIERQASRRENVDLVIEFTLRGPKRLHDEVMIALLHQPGVRTVSTGE* |
| Ga0066684_101787861 | 3300005179 | Soil | GLAIERQASRRENIDLVIDFTLRGPKRLHDQVMIALLHHPSVRTVSTGE* |
| Ga0065705_111109681 | 3300005294 | Switchgrass Rhizosphere | IIRHESRRENVDLVIDFDLSGPKRLHDQVMIALLHHPAVRTVSTGE* |
| Ga0070705_1006727341 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | QENVDLVIEMELRGSKRLYDQAVVTLLHHNHVRTVSTGE* |
| Ga0066686_106963032 | 3300005446 | Soil | EIERQASRRENVDLVIEFTLRGPKRLHDEVMIALLHQPGVRTVSTGE* |
| Ga0066689_101157291 | 3300005447 | Soil | QQQSRRENVDLVVDFELRGPKRLHDQVMVALLHHPGVRTVSSGE* |
| Ga0066689_109950021 | 3300005447 | Soil | ILTVSSRQENVDLVIDLELRGSKRLHDQAMITLLHHDHVRTVSTGE* |
| Ga0070697_1011467931 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SRQENVDLVIEFDLRGPKRLHDQARTAVLHHPGVRSVTTGE* |
| Ga0070697_1017964032 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SRQENVDLVIDFDLRGSKRLHDQLMITLLHHDHVRTVSTGE* |
| Ga0066701_105339601 | 3300005552 | Soil | SRRENVDVVIDFTLRGPKRLHDEAMIALLHHPSVRTVSTGE* |
| Ga0066695_103817142 | 3300005553 | Soil | HRENVDLVVELELKGPRRLHDQALIACVHHPSVRSISSGE* |
| Ga0066698_103589261 | 3300005558 | Soil | LEVERVESRRENVDLVIEYDVRGPKRLHDQVMIAILHHPIVRTVSTGE* |
| Ga0066700_105802222 | 3300005559 | Soil | ESSRRENVDLVVEFELRGPKRLHDELLVSVVRHPAVRAVSTGE* |
| Ga0066670_100081431 | 3300005560 | Soil | LEIERQASRRENVDLVIEFTLRGPKRLHDEVMIALLHHPGVRTVSTGE* |
| Ga0066670_100092725 | 3300005560 | Soil | DLVIEFTLRGPKRLHDEVMIALLHHPGVRTVSTGE* |
| Ga0066705_108962002 | 3300005569 | Soil | GLAIERQASRRENIDLVIDFTLRGPKRLHDQVMIALLHHPSVRAVSTGE* |
| Ga0066694_104734572 | 3300005574 | Soil | DLVIELELRGSKRLYDQAVVTLLHHNHVRTVSTGE* |
| Ga0066691_105999871 | 3300005586 | Soil | NVDLVIDFTLRGPKRLHDEVMIALLHQPGVRTVSTGE* |
| Ga0066706_102844363 | 3300005598 | Soil | TGLEIERQASRRENVDLVIEFTLRGPKRLHDEVMIALLHHPGVRTVSTGE* |
| Ga0066656_109290611 | 3300006034 | Soil | DLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE* |
| Ga0066665_102111191 | 3300006796 | Soil | VDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE* |
| Ga0066659_110848191 | 3300006797 | Soil | VDLVIDFTLRGPKRLHDQVMIALLNHPGVRTVSTGE* |
| Ga0079220_109277341 | 3300006806 | Agricultural Soil | ALISSESRRENVDLVLELDLRGPKRLHDQALIAVLHHPMVRTVSTGE* |
| Ga0075420_1011925342 | 3300006853 | Populus Rhizosphere | SRRENVDLVLEFELRGPKRLHDQVLIAVLHHPGVRGVSTGE* |
| Ga0075434_1021304601 | 3300006871 | Populus Rhizosphere | RIEARQENVDLVIELEARGARRLHDQLLIGLMHHAGVRSVSSGE* |
| Ga0075436_1008268081 | 3300006914 | Populus Rhizosphere | ILKVANRQENVDLVIEFELRGSKRLYDQAIVTLLHHDHVRTVSTGE* |
| Ga0075419_100492441 | 3300006969 | Populus Rhizosphere | DLVIEFDLRGPKRLHDQARTAVLHHPGVRSVTTGE* |
| Ga0079218_111188692 | 3300007004 | Agricultural Soil | DLVIDFDIRGSKRLHDQVMITLLHHDHVRTVSTGE* |
| Ga0066710_1016246142 | 3300009012 | Grasslands Soil | VTRTGLELERIEARQENVDLVVELELRGPKRLHDQLLIGLMHHPGVRSVSSGE |
| Ga0066710_1026052651 | 3300009012 | Grasslands Soil | VDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE |
| Ga0099829_103080041 | 3300009038 | Vadose Zone Soil | ENVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE* |
| Ga0099827_100361165 | 3300009090 | Vadose Zone Soil | RENVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE* |
| Ga0099827_117221061 | 3300009090 | Vadose Zone Soil | RQENVDLVIDFELRGSKWLYDQAIVTLLHHDHVRTVSTGE* |
| Ga0066709_1035290632 | 3300009137 | Grasslands Soil | ARQENVDLVVELEARGPRRRHDQLLIGLMHHPGVRSVSSGE* |
| Ga0099792_111459841 | 3300009143 | Vadose Zone Soil | RRENVDLVIELDLGGPKRLHDQALIAVLHHPMVRSVSTGE* |
| Ga0114129_102817651 | 3300009147 | Populus Rhizosphere | LELERIEARQENVDLVIELEARGARRLHDQLLIGLMHHAGVRSVSSGE* |
| Ga0075423_123273212 | 3300009162 | Populus Rhizosphere | RQENVDLVMEFDLRGPHRLHDQALVALQHAPGVRSVSTGE* |
| Ga0126374_104948681 | 3300009792 | Tropical Forest Soil | RSGLELQRIETRQEDVDLVVELEVQGPKRLHDQLLIGLMHHPAVRSVSTGE* |
| Ga0105066_10662022 | 3300009822 | Groundwater Sand | DLVIEFELRGPKRLHDQVLIAMLHHPGVRGVSTGE* |
| Ga0134088_106088351 | 3300010304 | Grasslands Soil | VDLVIDFDLRGSKRLHDQVMITLLHHDHVRTVSTGE* |
| Ga0134109_101365721 | 3300010320 | Grasslands Soil | GLDVLTISNRQENVDLVIELELRGSKRLYDQAVVTLLHHNHVRTVSTGE* |
| Ga0134067_100599521 | 3300010321 | Grasslands Soil | RQASRRENIDLVIDFTLRGPKRLHDQVMIALLHHPSVRTVSTGE* |
| Ga0134084_100345143 | 3300010322 | Grasslands Soil | QENVDLVIEFNIRGSKRLHDQVMMTLLHHDHVRTVSTGE* |
| Ga0134071_105263551 | 3300010336 | Grasslands Soil | TSFHRENVDLVVELELKGPRRLHDQALIACVHHPSVRSVSSGE* |
| Ga0134071_107000561 | 3300010336 | Grasslands Soil | QENVDLVVELDARGPKRLHDQLLIALMHHPTVRSVSSAE* |
| Ga0134127_108580631 | 3300010399 | Terrestrial Soil | NVDLVIDFDLSGPKRLHDQVMIALLHHPAVRTVSTGE* |
| Ga0134121_113531271 | 3300010401 | Terrestrial Soil | ELERLEARQENVDLVIDLEARGPKRLHDQLLIGLMHHPSVRSVSSGE* |
| Ga0137392_110624702 | 3300011269 | Vadose Zone Soil | RRENVDLVVDFELRGPKRLHDQVMVALLHHPGVRTVSSGE* |
| Ga0137429_11684061 | 3300011437 | Soil | EQRRENVDLVLEFELRGAKRLQDQVLIALLHHPSVRTVSRGE* |
| Ga0137433_10547681 | 3300011440 | Soil | QENVDLVIDFAIRGSKRLHDQLMITLLHHDHVRTVSTGE* |
| Ga0137421_10074943 | 3300012039 | Soil | LEVTSVASRQENVDLVIDFAIRGSKRLHDQLMITLLHHDHVRTVSTGE* |
| Ga0137389_110142742 | 3300012096 | Vadose Zone Soil | SRQENVDLVIDFDLRGSKRLHDQVMITLLHHDHVRTVSTGE* |
| Ga0137382_102513962 | 3300012200 | Vadose Zone Soil | LEVSAVASRQENVDLVIEFNIRGSKRLHDQVMITLLHHDHVRTVSTGE* |
| Ga0137374_100276967 | 3300012204 | Vadose Zone Soil | SSRQENVDLVIDFDIRGSKRLHDQLMITLLHHDHVRTVSTGE* |
| Ga0137376_102550023 | 3300012208 | Vadose Zone Soil | QASRRENVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE* |
| Ga0137376_104079051 | 3300012208 | Vadose Zone Soil | LVIDFDIRGSKRLHDQVMITLLHHDHVRTVSTGE* |
| Ga0137379_101981532 | 3300012209 | Vadose Zone Soil | RQENVDLVVELELRGPKRLHDQLLIALMHHAGVRSVSSGE* |
| Ga0137378_103316833 | 3300012210 | Vadose Zone Soil | LVVEFELRGSKRLYDQAIITLLHHDHVRTVSTGE* |
| Ga0137435_12754472 | 3300012232 | Soil | RHENVDLVVELDLRGPKRLHDQAMLSLLHHPGVRTVSTGE* |
| Ga0137370_101864071 | 3300012285 | Vadose Zone Soil | RQASRRENVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE* |
| Ga0137370_108235701 | 3300012285 | Vadose Zone Soil | SRQENVDLVIDLDLRGSKRLHDQVMITLLHHDLVRTVSTGE* |
| Ga0137387_110777722 | 3300012349 | Vadose Zone Soil | DLVIDFELRGSKRLYDQAIVTLLHHDHVRTVSTGE* |
| Ga0137386_110376131 | 3300012351 | Vadose Zone Soil | LVIELELRGSKRLYDQAIVTLLHHDHVRTVSTGE* |
| Ga0137369_102192851 | 3300012355 | Vadose Zone Soil | RVSNRQENVDLVIDFELRGSKRLYDQTIIALLHHDHVRTVSTGE* |
| Ga0137385_116473131 | 3300012359 | Vadose Zone Soil | RENVDLVIELDLAGPKRLHDQALIAVLHHPMVRSVSTGE* |
| Ga0137361_104505042 | 3300012362 | Vadose Zone Soil | VDLVIDFDLRGSKRLHDQVMITLLHHDYVRTVSTGE* |
| Ga0137390_101446621 | 3300012363 | Vadose Zone Soil | ENVDLVIDVELSGPKRLHDQALIAVLHHPMVRTVSTGE* |
| Ga0137398_110317341 | 3300012683 | Vadose Zone Soil | LVIELELRGLKRLYDQAIVTLLHHDHVRTVSTGE* |
| Ga0137397_105875662 | 3300012685 | Vadose Zone Soil | HESRRENVDLVVDFDLSGPKRLHDQVMIALLHHPAVRTVSTGE* |
| Ga0137396_103700632 | 3300012918 | Vadose Zone Soil | AGLEVSSVSSRQENVDLVIDFDLRGSKRLHDQVMITLLHHDHVRTVSTGE* |
| Ga0137404_121498062 | 3300012929 | Vadose Zone Soil | SISNRQENVDLVIELELRGSKRLYDQAIVTLLHHNHVRTVSTGE* |
| Ga0137407_123046122 | 3300012930 | Vadose Zone Soil | IVRHESRRENVDLVVDFDLSGPKRLHDQVMIALLHHPAVRTVSTGE* |
| Ga0137410_118586512 | 3300012944 | Vadose Zone Soil | GLEISAVSSRQENVDLVIEFNIRGSKRLHDQVMITLLHHDHVRTVSTGE* |
| Ga0134076_101077381 | 3300012976 | Grasslands Soil | GLEVERTVSRHENVDLVIEFDVRGPKRLHDQLLAGIVHHPGVRSVSTGE* |
| Ga0134078_104951211 | 3300014157 | Grasslands Soil | IDLVIDFTLRGPKRLHDQVMIALLHHPSVRAVSTGE* |
| Ga0134079_104130992 | 3300014166 | Grasslands Soil | LVIDFTLRGPKRLHDQVMLALLHHPSVRTVSTGE* |
| Ga0134079_104672712 | 3300014166 | Grasslands Soil | ERQASRRENVDLVIEFTLRGPKRLHDEVMIALLHHPGVRTVSTGE* |
| Ga0180061_10818141 | 3300014861 | Soil | VDLVIDFAIRGSKRLHDQLMITLLHHDHVRTVSTGE* |
| Ga0180062_11186511 | 3300014879 | Soil | VTGVASRQENVDLVIDFDIRGSKRLHDQLMITLLHHNHVRTVSTGE* |
| Ga0137420_13290484 | 3300015054 | Vadose Zone Soil | VDLVIDFTLRGPKRLHDEVMIALLHQPGVRTVSTGE* |
| Ga0134089_102101932 | 3300015358 | Grasslands Soil | RENVDLVIEFSLRGPKRLHDQVMIALLHHPSVRTVSTGE* |
| Ga0134089_104106401 | 3300015358 | Grasslands Soil | QENVDLVIDFDLRGSKRLHDQVMITLLHHDHVRTVSTGE* |
| Ga0134069_12364922 | 3300017654 | Grasslands Soil | ERQASRRENVDLVIDFTLLGPKRLHDEVMVALLHQPGVRTVSTGE |
| Ga0134074_12804152 | 3300017657 | Grasslands Soil | RTGLDIVQQQSRRENVDLVVVFELRGPKRLHDQVMVALLHHPGVRTVSSGE |
| Ga0134074_13866352 | 3300017657 | Grasslands Soil | DLVIDLELRGSKRLHDQAMITLLHHDHVRTVSTGE |
| Ga0134083_100563093 | 3300017659 | Grasslands Soil | RQASRRENVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE |
| Ga0134083_101053802 | 3300017659 | Grasslands Soil | GLEVERVESRKENVDLVIELDIRGPKRLHDQVMIAILHTPVVRTVSTGE |
| Ga0134083_102202392 | 3300017659 | Grasslands Soil | TGLEIERQASRRENVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE |
| Ga0184637_103419951 | 3300018063 | Groundwater Sediment | VERSKSRQENVDLVIELELRGPQRLHSQAVTAILHAPGVRTVSTGE |
| Ga0184618_101694592 | 3300018071 | Groundwater Sediment | AVSSRQENVDLVIEFNIRGSKRLHDQVMITLVHHDHVRTVSAGE |
| Ga0184633_102872262 | 3300018077 | Groundwater Sediment | TQSRRENVDMVVEFDLRGPKRLHDQALVGILHHPSVRAVSTGE |
| Ga0184639_100879471 | 3300018082 | Groundwater Sediment | DLTRVESRRENVDLVVEFELRGPKRLHDQVLIAILHHPGVRGVSTGE |
| Ga0066667_102351881 | 3300018433 | Grasslands Soil | VDLVVDFELRGPKRLHDQVMVALLHHPGVRTVSSGE |
| Ga0066667_122252032 | 3300018433 | Grasslands Soil | DVVIDFTLRGPKRLHDEAMIALLHHPSVRTVSTGE |
| Ga0066662_115993232 | 3300018468 | Grasslands Soil | EIERLASRRENVDLVIDFTLLGPKRLHDEVMVALLHEPGVRTVSTGE |
| Ga0066669_104123971 | 3300018482 | Grasslands Soil | GLAIERQASRRENIDLVIDFTLRGPKRLHDQVMIALLHHPSVRAVSTGE |
| Ga0193720_10214342 | 3300019868 | Soil | RTGLEIERQASRQENVDLVIDYTLRGSKRLHDQVMIALLHHPSVRTVSTGE |
| Ga0193712_10036571 | 3300019880 | Soil | SRRENVDVVCEFYLSGPKRLHDQVMIALLHHPAVRTVSTGE |
| Ga0193733_11497851 | 3300020022 | Soil | DLVIDYTLRGSKRLHDQVMIALLHHPSVRTVSTGE |
| Ga0210378_103373062 | 3300021073 | Groundwater Sediment | TQQRREDPDLVVDFELRGAKRLHDAAMVGLLHQPGVRTVSTGE |
| Ga0179596_105906471 | 3300021086 | Vadose Zone Soil | QASRRENVDLVIDVELSGPKRLHDQALIAVLHHPMVRTVSTGE |
| Ga0222622_113659032 | 3300022756 | Groundwater Sediment | SAVSSRQENVDLVIEFNIRGSKRLHDQVMITLVHHDHVRTVSAGE |
| Ga0247660_10796282 | 3300024317 | Soil | ARVESRRENVDLVVEFELRGPKRLHDQAKLSILHHPLVRTVSTGE |
| Ga0209342_100520641 | 3300025326 | Soil | IERTASRRENVDLVIEFDLRGARRLHDQALIGVLHHPGVRAVSTGE |
| Ga0209438_11173911 | 3300026285 | Grasslands Soil | RQENVDLVIDFNIRGSKRLHDQVMITLLHHDQVRTVSTGE |
| Ga0209235_11641022 | 3300026296 | Grasslands Soil | VDLVIDFTLRGPKRLHDQVMIALLNHPGVRTVSTGE |
| Ga0209237_10368721 | 3300026297 | Grasslands Soil | ENVDMVIDFTLRGPKRLHDEVMIALLHHPGVRTVSTGE |
| Ga0209236_12269842 | 3300026298 | Grasslands Soil | SRRENVDLVIDFTLRGPKRLHDEAMIALLHHPSVRSVSTGE |
| Ga0209238_11569041 | 3300026301 | Grasslands Soil | ASRQENVDLVIDFDLRGSKRLHDQLMITLLHHDHVRTVSTGE |
| Ga0209153_12633841 | 3300026312 | Soil | GLQILTVASRQENVDLVIDLEMRGSKRLHDQAIITLLHHDHVRTVSTGE |
| Ga0209155_10163374 | 3300026316 | Soil | IERQASRRENIDLVIDFTLRGPKRLHDQVMIALLHHPSVRTVSTGE |
| Ga0209155_11985961 | 3300026316 | Soil | IERQASRRENIDLVIDFTLRGPKRLHDQVMIALLHHPSVRAVSTGE |
| Ga0209801_13458201 | 3300026326 | Soil | GLEIERQASRRENVDLVIEFTLRGPKRLHDEVMIALLHQPGVRTVSTGE |
| Ga0209375_10050539 | 3300026329 | Soil | ENVDLVIEYDIRGPKRLHDQVMIAILHHPVVRTVSTGE |
| Ga0209375_11448692 | 3300026329 | Soil | IEARQENVDLVVELDARGPKRLHDQLLIGLMHHPTVRSVSSGE |
| Ga0209806_10727143 | 3300026529 | Soil | DIVQQQSRRENVDLVVDFELRGPKRLHDQVMVALLHHPGVRTVSSGE |
| Ga0209056_103716041 | 3300026538 | Soil | DLVIDLEMRGSKRLHDQAMITLLHHDHVRTVSTGE |
| Ga0209056_104488631 | 3300026538 | Soil | ENVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE |
| Ga0209161_101489943 | 3300026548 | Soil | EIERQASRRENVDLVIDFTLLGPKRLHDEVMVALLHEPGVRTVSTGE |
| Ga0209073_100082094 | 3300027765 | Agricultural Soil | WVEVERTESRRENVDLVVELDLRGPRRLHEQAMISILHHPLVRTVSTGE |
| Ga0209074_101952301 | 3300027787 | Agricultural Soil | SRRENVDLVLELDLRGPKRLHDQALIAVLHHPMVRTVSTGE |
| Ga0209283_105401551 | 3300027875 | Vadose Zone Soil | VDLVIEYELRGPKRLHDQVMIALLHHPSVRTVSTGE |
| Ga0209481_100192544 | 3300027880 | Populus Rhizosphere | VESRQENVDLVIEFDLRGPKRLHDQARTAVLHHPGVRSVTTGE |
| Ga0209590_100379321 | 3300027882 | Vadose Zone Soil | RRENVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE |
| Ga0209488_108349013 | 3300027903 | Vadose Zone Soil | TGLDIVQQQSRRENVDLVVDFELRGPKRLHDQVLVALLHHPGVRTVSSGE |
| Ga0209853_10774362 | 3300027961 | Groundwater Sand | VESRKENVDLVIEFELHGPKRLHDQVLIAMLHHPGVRGVSTGE |
| Ga0137415_101960401 | 3300028536 | Vadose Zone Soil | DLVIEYDLRGPKRLHDQVMIALLHHPSVRTVSTGE |
| Ga0307503_105695131 | 3300028802 | Soil | VRGVGLTIERVVARHENVDLVIELSLRGPHRLHDQALLAVLHHPGVRGVSSGE |
| Ga0307296_100386294 | 3300028819 | Soil | TIVRHESRRENVDLVVDFDLSGPKRLHDQVMIALLHHPAVRTVSTGE |
| Ga0326597_107109212 | 3300031965 | Soil | TGLELTRVESRRENVDLVVEFELRGPKRLHDQVLIAILHHPGVRGVSTGE |
| Ga0307471_1012158011 | 3300032180 | Hardwood Forest Soil | LEVSAVASRQENVDLVIDFDLRGSKRLHDQLMITLLHHDHVRTVSTGE |
| Ga0214472_101766363 | 3300033407 | Soil | QENVDLVLEFELRGPKRLHDEVMIGLLHHDKVRTVSTGE |
| Ga0214471_106690821 | 3300033417 | Soil | SRQETVDLVLEFELRGPKRLHDEVMIGLLHHDKVRTVSTGE |
| Ga0247830_106734482 | 3300033551 | Soil | TQSRVENVDLVIEFDLRGPKRLHDQVVLATVQHPGVRSVSTGE |
| Ga0364946_046331_753_863 | 3300033815 | Sediment | VDLVIDFDVRGSKRLHDQVMITLLHHDHVRTVSTGE |
| Ga0364937_099666_484_591 | 3300034113 | Sediment | DLVVDFELRGPKRLHDAAMLGLLHQPGVRTVATGE |
| ⦗Top⦘ |