NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F051019

Metagenome Family F051019

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051019
Family Type Metagenome
Number of Sequences 144
Average Sequence Length 42 residues
Representative Sequence RENVDLVIEFSLRGPKRLHDQVMIALLHHPSVRTVSTGE
Number of Associated Samples 126
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.13 %
% of genes near scaffold ends (potentially truncated) 95.83 %
% of genes from short scaffolds (< 2000 bps) 83.33 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.833 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(22.222 % of family members)
Environment Ontology (ENVO) Unclassified
(43.056 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.778 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.40%    β-sheet: 0.00%    Coil/Unstructured: 80.60%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 144 Family Scaffolds
PF028262-Hacid_dh_C 42.36
PF00437T2SSE 6.25
PF00701DHDPS 3.47
PF01663Phosphodiest 2.78
PF04389Peptidase_M28 2.08
PF00596Aldolase_II 0.69
PF02308MgtC 0.69
PF0563523S_rRNA_IVP 0.69
PF02597ThiS 0.69
PF01676Metalloenzyme 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 144 Family Scaffolds
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 6.94
COG1285Magnesium uptake protein YhiD/SapB, involved in acid resistanceInorganic ion transport and metabolism [P] 0.69
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 0.69
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 0.69
COG3174Membrane component of predicted Mg2+ transport system, contains DUF4010 domainInorganic ion transport and metabolism [P] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.83 %
UnclassifiedrootN/A4.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_119121897Not Available596Open in IMG/M
3300002558|JGI25385J37094_10005876All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca4327Open in IMG/M
3300002558|JGI25385J37094_10119412All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium754Open in IMG/M
3300002562|JGI25382J37095_10006048All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca4319Open in IMG/M
3300005166|Ga0066674_10411583All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium625Open in IMG/M
3300005171|Ga0066677_10708621All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium563Open in IMG/M
3300005172|Ga0066683_10815236All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium541Open in IMG/M
3300005174|Ga0066680_10619899All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium675Open in IMG/M
3300005176|Ga0066679_10104490All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1726Open in IMG/M
3300005179|Ga0066684_10178786All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1362Open in IMG/M
3300005294|Ga0065705_11110968All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium520Open in IMG/M
3300005440|Ga0070705_100672734All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium810Open in IMG/M
3300005446|Ga0066686_10696303All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium686Open in IMG/M
3300005447|Ga0066689_10115729All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1557Open in IMG/M
3300005447|Ga0066689_10995002All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes516Open in IMG/M
3300005536|Ga0070697_101146793All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium692Open in IMG/M
3300005536|Ga0070697_101796403All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes548Open in IMG/M
3300005552|Ga0066701_10533960All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium722Open in IMG/M
3300005553|Ga0066695_10381714All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium878Open in IMG/M
3300005558|Ga0066698_10358926All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1006Open in IMG/M
3300005559|Ga0066700_10580222All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium782Open in IMG/M
3300005560|Ga0066670_10008143All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis4342Open in IMG/M
3300005560|Ga0066670_10009272All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis4127Open in IMG/M
3300005569|Ga0066705_10896200All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium526Open in IMG/M
3300005574|Ga0066694_10473457All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium585Open in IMG/M
3300005586|Ga0066691_10599987All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium655Open in IMG/M
3300005598|Ga0066706_10284436All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1297Open in IMG/M
3300006034|Ga0066656_10929061All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium557Open in IMG/M
3300006796|Ga0066665_10211119All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1513Open in IMG/M
3300006797|Ga0066659_11084819All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium669Open in IMG/M
3300006806|Ga0079220_10927734All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium680Open in IMG/M
3300006853|Ga0075420_101192534All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium654Open in IMG/M
3300006871|Ga0075434_102130460All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300006914|Ga0075436_100826808All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes691Open in IMG/M
3300006969|Ga0075419_10049244All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2646Open in IMG/M
3300007004|Ga0079218_11118869All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium806Open in IMG/M
3300009012|Ga0066710_102605265All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium727Open in IMG/M
3300009038|Ga0099829_10308004All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1300Open in IMG/M
3300009090|Ga0099827_10036116All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis3615Open in IMG/M
3300009090|Ga0099827_11722106All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes546Open in IMG/M
3300009137|Ga0066709_103529063All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300009143|Ga0099792_11145984All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium526Open in IMG/M
3300009147|Ga0114129_10281765All Organisms → cellular organisms → Bacteria2220Open in IMG/M
3300009822|Ga0105066_1066202All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium771Open in IMG/M
3300010304|Ga0134088_10608835All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes544Open in IMG/M
3300010320|Ga0134109_10136572All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium875Open in IMG/M
3300010321|Ga0134067_10059952All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1242Open in IMG/M
3300010322|Ga0134084_10034514All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300010336|Ga0134071_10526355All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300010336|Ga0134071_10700056All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300010399|Ga0134127_10858063All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium960Open in IMG/M
3300010401|Ga0134121_11353127All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium720Open in IMG/M
3300011269|Ga0137392_11062470All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium664Open in IMG/M
3300011437|Ga0137429_1168406All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium683Open in IMG/M
3300011440|Ga0137433_1054768All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1189Open in IMG/M
3300012039|Ga0137421_1007494All Organisms → cellular organisms → Bacteria2301Open in IMG/M
3300012096|Ga0137389_11014274All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes711Open in IMG/M
3300012200|Ga0137382_10251396All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1225Open in IMG/M
3300012204|Ga0137374_10027696All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae6269Open in IMG/M
3300012208|Ga0137376_10255002All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1521Open in IMG/M
3300012208|Ga0137376_10407905All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1180Open in IMG/M
3300012209|Ga0137379_10198153All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1921Open in IMG/M
3300012210|Ga0137378_10331683All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca1414Open in IMG/M
3300012232|Ga0137435_1275447All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium509Open in IMG/M
3300012285|Ga0137370_10186407All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1213Open in IMG/M
3300012285|Ga0137370_10823570All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium575Open in IMG/M
3300012349|Ga0137387_11077772All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes573Open in IMG/M
3300012351|Ga0137386_11037613All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes582Open in IMG/M
3300012355|Ga0137369_10219285All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca1458Open in IMG/M
3300012359|Ga0137385_11647313All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium505Open in IMG/M
3300012362|Ga0137361_10450504All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1182Open in IMG/M
3300012363|Ga0137390_10144662All Organisms → cellular organisms → Bacteria2360Open in IMG/M
3300012683|Ga0137398_11031734All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes569Open in IMG/M
3300012685|Ga0137397_10587566All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium828Open in IMG/M
3300012918|Ga0137396_10370063All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1061Open in IMG/M
3300012929|Ga0137404_12149806All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium522Open in IMG/M
3300012930|Ga0137407_12304612All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium515Open in IMG/M
3300012944|Ga0137410_11858651All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes533Open in IMG/M
3300012976|Ga0134076_10107738All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1111Open in IMG/M
3300014157|Ga0134078_10495121All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium567Open in IMG/M
3300014166|Ga0134079_10413099All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium631Open in IMG/M
3300014166|Ga0134079_10467271All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium602Open in IMG/M
3300014861|Ga0180061_1081814All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes543Open in IMG/M
3300014879|Ga0180062_1118651All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes607Open in IMG/M
3300015054|Ga0137420_1329048All Organisms → cellular organisms → Bacteria3345Open in IMG/M
3300015358|Ga0134089_10210193All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium785Open in IMG/M
3300015358|Ga0134089_10410640All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes580Open in IMG/M
3300017654|Ga0134069_1236492All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium632Open in IMG/M
3300017657|Ga0134074_1280415All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium604Open in IMG/M
3300017657|Ga0134074_1386635All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes519Open in IMG/M
3300017659|Ga0134083_10056309All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1489Open in IMG/M
3300017659|Ga0134083_10105380All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1115Open in IMG/M
3300017659|Ga0134083_10220239All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium788Open in IMG/M
3300018063|Ga0184637_10341995All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium900Open in IMG/M
3300018071|Ga0184618_10169459All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300018077|Ga0184633_10287226All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes840Open in IMG/M
3300018082|Ga0184639_10087947All Organisms → cellular organisms → Bacteria1636Open in IMG/M
3300018433|Ga0066667_10235188All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300018433|Ga0066667_12225203All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium511Open in IMG/M
3300018468|Ga0066662_11599323All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium680Open in IMG/M
3300018482|Ga0066669_10412397All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1148Open in IMG/M
3300019868|Ga0193720_1021434All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium916Open in IMG/M
3300019880|Ga0193712_1003657All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae3120Open in IMG/M
3300020022|Ga0193733_1149785All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium631Open in IMG/M
3300021073|Ga0210378_10337306Not Available563Open in IMG/M
3300021086|Ga0179596_10590647All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium563Open in IMG/M
3300022756|Ga0222622_11365903All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes521Open in IMG/M
3300024317|Ga0247660_1079628All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium557Open in IMG/M
3300025326|Ga0209342_10052064All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae3876Open in IMG/M
3300026285|Ga0209438_1117391All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium758Open in IMG/M
3300026296|Ga0209235_1164102All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium855Open in IMG/M
3300026297|Ga0209237_1036872All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2601Open in IMG/M
3300026298|Ga0209236_1226984All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium642Open in IMG/M
3300026301|Ga0209238_1156904All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes685Open in IMG/M
3300026312|Ga0209153_1263384All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium552Open in IMG/M
3300026316|Ga0209155_1016337All Organisms → cellular organisms → Bacteria3166Open in IMG/M
3300026316|Ga0209155_1198596All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium633Open in IMG/M
3300026326|Ga0209801_1345820All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium524Open in IMG/M
3300026329|Ga0209375_1005053All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae8860Open in IMG/M
3300026329|Ga0209375_1144869All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300026529|Ga0209806_1072714All Organisms → cellular organisms → Bacteria1541Open in IMG/M
3300026538|Ga0209056_10371604All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium916Open in IMG/M
3300026538|Ga0209056_10448863All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium735Open in IMG/M
3300026548|Ga0209161_10148994All Organisms → cellular organisms → Bacteria1353Open in IMG/M
3300027765|Ga0209073_10008209All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2720Open in IMG/M
3300027787|Ga0209074_10195230All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium757Open in IMG/M
3300027875|Ga0209283_10540155All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium746Open in IMG/M
3300027880|Ga0209481_10019254All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes3007Open in IMG/M
3300027882|Ga0209590_10037932All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2603Open in IMG/M
3300027903|Ga0209488_10834901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales651Open in IMG/M
3300027961|Ga0209853_1077436All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium873Open in IMG/M
3300028536|Ga0137415_10196040All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1840Open in IMG/M
3300028802|Ga0307503_10569513All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300028819|Ga0307296_10038629All Organisms → cellular organisms → Bacteria2519Open in IMG/M
3300031965|Ga0326597_10710921All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1056Open in IMG/M
3300032180|Ga0307471_101215801All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium917Open in IMG/M
3300033407|Ga0214472_10176636All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2078Open in IMG/M
3300033417|Ga0214471_10669082All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium818Open in IMG/M
3300033551|Ga0247830_10673448Not Available821Open in IMG/M
3300033815|Ga0364946_046331All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium895Open in IMG/M
3300034113|Ga0364937_099666All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes593Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil22.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil20.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil12.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil10.42%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.86%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil4.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.17%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.08%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.08%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.39%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.39%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.39%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.69%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.69%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.69%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300012039Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014861Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10DEnvironmentalOpen in IMG/M
3300014879Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10DEnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019868Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1EnvironmentalOpen in IMG/M
3300019880Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024317Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027961Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033815Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17EnvironmentalOpen in IMG/M
3300034113Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_11912189713300000956SoilLDIERLESRHENVDMVVDLDLRGPKRLHDQLLLAVMHYPGVRAVSSGE*
JGI25385J37094_1000587653300002558Grasslands SoilGLDIVQQQSRRENVDLVVDFELRGPKRLHDQVMVALLHHPGVRTVSSGE*
JGI25385J37094_1011941213300002558Grasslands SoilVSSRQENVDLVIDLDMRGSRRLHDQVMITLLHHDHVRTVSTGE*
JGI25382J37095_1000604813300002562Grasslands SoilIVQQQSRRENVDLVVDFELRGPKRLHDQVMVALLHHPGVRTVSSGE*
Ga0066674_1041158323300005166SoilVESRRENVDLVIEYDVRGPKRLHDQVMIAILHHPIVRTVSTGE*
Ga0066677_1070862123300005171SoilRENVDLVIEFTLRGPKRLHDEVMIALLHHPGVRTVSTGE*
Ga0066683_1081523623300005172SoilVESRRENVDLVIEYDVRGPKRLHDQVMIAILHHPVVRTVSTGE*
Ga0066680_1061989923300005174SoilQASRRENVDLVIDFTLLGPKRLHDEVMVALLHEPGVRTVSTGE*
Ga0066679_1010449013300005176SoilLEIERQASRRENVDLVIEFTLRGPKRLHDEVMIALLHQPGVRTVSTGE*
Ga0066684_1017878613300005179SoilGLAIERQASRRENIDLVIDFTLRGPKRLHDQVMIALLHHPSVRTVSTGE*
Ga0065705_1111096813300005294Switchgrass RhizosphereIIRHESRRENVDLVIDFDLSGPKRLHDQVMIALLHHPAVRTVSTGE*
Ga0070705_10067273413300005440Corn, Switchgrass And Miscanthus RhizosphereQENVDLVIEMELRGSKRLYDQAVVTLLHHNHVRTVSTGE*
Ga0066686_1069630323300005446SoilEIERQASRRENVDLVIEFTLRGPKRLHDEVMIALLHQPGVRTVSTGE*
Ga0066689_1011572913300005447SoilQQQSRRENVDLVVDFELRGPKRLHDQVMVALLHHPGVRTVSSGE*
Ga0066689_1099500213300005447SoilILTVSSRQENVDLVIDLELRGSKRLHDQAMITLLHHDHVRTVSTGE*
Ga0070697_10114679313300005536Corn, Switchgrass And Miscanthus RhizosphereSRQENVDLVIEFDLRGPKRLHDQARTAVLHHPGVRSVTTGE*
Ga0070697_10179640323300005536Corn, Switchgrass And Miscanthus RhizosphereSRQENVDLVIDFDLRGSKRLHDQLMITLLHHDHVRTVSTGE*
Ga0066701_1053396013300005552SoilSRRENVDVVIDFTLRGPKRLHDEAMIALLHHPSVRTVSTGE*
Ga0066695_1038171423300005553SoilHRENVDLVVELELKGPRRLHDQALIACVHHPSVRSISSGE*
Ga0066698_1035892613300005558SoilLEVERVESRRENVDLVIEYDVRGPKRLHDQVMIAILHHPIVRTVSTGE*
Ga0066700_1058022223300005559SoilESSRRENVDLVVEFELRGPKRLHDELLVSVVRHPAVRAVSTGE*
Ga0066670_1000814313300005560SoilLEIERQASRRENVDLVIEFTLRGPKRLHDEVMIALLHHPGVRTVSTGE*
Ga0066670_1000927253300005560SoilDLVIEFTLRGPKRLHDEVMIALLHHPGVRTVSTGE*
Ga0066705_1089620023300005569SoilGLAIERQASRRENIDLVIDFTLRGPKRLHDQVMIALLHHPSVRAVSTGE*
Ga0066694_1047345723300005574SoilDLVIELELRGSKRLYDQAVVTLLHHNHVRTVSTGE*
Ga0066691_1059998713300005586SoilNVDLVIDFTLRGPKRLHDEVMIALLHQPGVRTVSTGE*
Ga0066706_1028443633300005598SoilTGLEIERQASRRENVDLVIEFTLRGPKRLHDEVMIALLHHPGVRTVSTGE*
Ga0066656_1092906113300006034SoilDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE*
Ga0066665_1021111913300006796SoilVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE*
Ga0066659_1108481913300006797SoilVDLVIDFTLRGPKRLHDQVMIALLNHPGVRTVSTGE*
Ga0079220_1092773413300006806Agricultural SoilALISSESRRENVDLVLELDLRGPKRLHDQALIAVLHHPMVRTVSTGE*
Ga0075420_10119253423300006853Populus RhizosphereSRRENVDLVLEFELRGPKRLHDQVLIAVLHHPGVRGVSTGE*
Ga0075434_10213046013300006871Populus RhizosphereRIEARQENVDLVIELEARGARRLHDQLLIGLMHHAGVRSVSSGE*
Ga0075436_10082680813300006914Populus RhizosphereILKVANRQENVDLVIEFELRGSKRLYDQAIVTLLHHDHVRTVSTGE*
Ga0075419_1004924413300006969Populus RhizosphereDLVIEFDLRGPKRLHDQARTAVLHHPGVRSVTTGE*
Ga0079218_1111886923300007004Agricultural SoilDLVIDFDIRGSKRLHDQVMITLLHHDHVRTVSTGE*
Ga0066710_10162461423300009012Grasslands SoilVTRTGLELERIEARQENVDLVVELELRGPKRLHDQLLIGLMHHPGVRSVSSGE
Ga0066710_10260526513300009012Grasslands SoilVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE
Ga0099829_1030800413300009038Vadose Zone SoilENVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE*
Ga0099827_1003611653300009090Vadose Zone SoilRENVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE*
Ga0099827_1172210613300009090Vadose Zone SoilRQENVDLVIDFELRGSKWLYDQAIVTLLHHDHVRTVSTGE*
Ga0066709_10352906323300009137Grasslands SoilARQENVDLVVELEARGPRRRHDQLLIGLMHHPGVRSVSSGE*
Ga0099792_1114598413300009143Vadose Zone SoilRRENVDLVIELDLGGPKRLHDQALIAVLHHPMVRSVSTGE*
Ga0114129_1028176513300009147Populus RhizosphereLELERIEARQENVDLVIELEARGARRLHDQLLIGLMHHAGVRSVSSGE*
Ga0075423_1232732123300009162Populus RhizosphereRQENVDLVMEFDLRGPHRLHDQALVALQHAPGVRSVSTGE*
Ga0126374_1049486813300009792Tropical Forest SoilRSGLELQRIETRQEDVDLVVELEVQGPKRLHDQLLIGLMHHPAVRSVSTGE*
Ga0105066_106620223300009822Groundwater SandDLVIEFELRGPKRLHDQVLIAMLHHPGVRGVSTGE*
Ga0134088_1060883513300010304Grasslands SoilVDLVIDFDLRGSKRLHDQVMITLLHHDHVRTVSTGE*
Ga0134109_1013657213300010320Grasslands SoilGLDVLTISNRQENVDLVIELELRGSKRLYDQAVVTLLHHNHVRTVSTGE*
Ga0134067_1005995213300010321Grasslands SoilRQASRRENIDLVIDFTLRGPKRLHDQVMIALLHHPSVRTVSTGE*
Ga0134084_1003451433300010322Grasslands SoilQENVDLVIEFNIRGSKRLHDQVMMTLLHHDHVRTVSTGE*
Ga0134071_1052635513300010336Grasslands SoilTSFHRENVDLVVELELKGPRRLHDQALIACVHHPSVRSVSSGE*
Ga0134071_1070005613300010336Grasslands SoilQENVDLVVELDARGPKRLHDQLLIALMHHPTVRSVSSAE*
Ga0134127_1085806313300010399Terrestrial SoilNVDLVIDFDLSGPKRLHDQVMIALLHHPAVRTVSTGE*
Ga0134121_1135312713300010401Terrestrial SoilELERLEARQENVDLVIDLEARGPKRLHDQLLIGLMHHPSVRSVSSGE*
Ga0137392_1106247023300011269Vadose Zone SoilRRENVDLVVDFELRGPKRLHDQVMVALLHHPGVRTVSSGE*
Ga0137429_116840613300011437SoilEQRRENVDLVLEFELRGAKRLQDQVLIALLHHPSVRTVSRGE*
Ga0137433_105476813300011440SoilQENVDLVIDFAIRGSKRLHDQLMITLLHHDHVRTVSTGE*
Ga0137421_100749433300012039SoilLEVTSVASRQENVDLVIDFAIRGSKRLHDQLMITLLHHDHVRTVSTGE*
Ga0137389_1101427423300012096Vadose Zone SoilSRQENVDLVIDFDLRGSKRLHDQVMITLLHHDHVRTVSTGE*
Ga0137382_1025139623300012200Vadose Zone SoilLEVSAVASRQENVDLVIEFNIRGSKRLHDQVMITLLHHDHVRTVSTGE*
Ga0137374_1002769673300012204Vadose Zone SoilSSRQENVDLVIDFDIRGSKRLHDQLMITLLHHDHVRTVSTGE*
Ga0137376_1025500233300012208Vadose Zone SoilQASRRENVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE*
Ga0137376_1040790513300012208Vadose Zone SoilLVIDFDIRGSKRLHDQVMITLLHHDHVRTVSTGE*
Ga0137379_1019815323300012209Vadose Zone SoilRQENVDLVVELELRGPKRLHDQLLIALMHHAGVRSVSSGE*
Ga0137378_1033168333300012210Vadose Zone SoilLVVEFELRGSKRLYDQAIITLLHHDHVRTVSTGE*
Ga0137435_127544723300012232SoilRHENVDLVVELDLRGPKRLHDQAMLSLLHHPGVRTVSTGE*
Ga0137370_1018640713300012285Vadose Zone SoilRQASRRENVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE*
Ga0137370_1082357013300012285Vadose Zone SoilSRQENVDLVIDLDLRGSKRLHDQVMITLLHHDLVRTVSTGE*
Ga0137387_1107777223300012349Vadose Zone SoilDLVIDFELRGSKRLYDQAIVTLLHHDHVRTVSTGE*
Ga0137386_1103761313300012351Vadose Zone SoilLVIELELRGSKRLYDQAIVTLLHHDHVRTVSTGE*
Ga0137369_1021928513300012355Vadose Zone SoilRVSNRQENVDLVIDFELRGSKRLYDQTIIALLHHDHVRTVSTGE*
Ga0137385_1164731313300012359Vadose Zone SoilRENVDLVIELDLAGPKRLHDQALIAVLHHPMVRSVSTGE*
Ga0137361_1045050423300012362Vadose Zone SoilVDLVIDFDLRGSKRLHDQVMITLLHHDYVRTVSTGE*
Ga0137390_1014466213300012363Vadose Zone SoilENVDLVIDVELSGPKRLHDQALIAVLHHPMVRTVSTGE*
Ga0137398_1103173413300012683Vadose Zone SoilLVIELELRGLKRLYDQAIVTLLHHDHVRTVSTGE*
Ga0137397_1058756623300012685Vadose Zone SoilHESRRENVDLVVDFDLSGPKRLHDQVMIALLHHPAVRTVSTGE*
Ga0137396_1037006323300012918Vadose Zone SoilAGLEVSSVSSRQENVDLVIDFDLRGSKRLHDQVMITLLHHDHVRTVSTGE*
Ga0137404_1214980623300012929Vadose Zone SoilSISNRQENVDLVIELELRGSKRLYDQAIVTLLHHNHVRTVSTGE*
Ga0137407_1230461223300012930Vadose Zone SoilIVRHESRRENVDLVVDFDLSGPKRLHDQVMIALLHHPAVRTVSTGE*
Ga0137410_1185865123300012944Vadose Zone SoilGLEISAVSSRQENVDLVIEFNIRGSKRLHDQVMITLLHHDHVRTVSTGE*
Ga0134076_1010773813300012976Grasslands SoilGLEVERTVSRHENVDLVIEFDVRGPKRLHDQLLAGIVHHPGVRSVSTGE*
Ga0134078_1049512113300014157Grasslands SoilIDLVIDFTLRGPKRLHDQVMIALLHHPSVRAVSTGE*
Ga0134079_1041309923300014166Grasslands SoilLVIDFTLRGPKRLHDQVMLALLHHPSVRTVSTGE*
Ga0134079_1046727123300014166Grasslands SoilERQASRRENVDLVIEFTLRGPKRLHDEVMIALLHHPGVRTVSTGE*
Ga0180061_108181413300014861SoilVDLVIDFAIRGSKRLHDQLMITLLHHDHVRTVSTGE*
Ga0180062_111865113300014879SoilVTGVASRQENVDLVIDFDIRGSKRLHDQLMITLLHHNHVRTVSTGE*
Ga0137420_132904843300015054Vadose Zone SoilVDLVIDFTLRGPKRLHDEVMIALLHQPGVRTVSTGE*
Ga0134089_1021019323300015358Grasslands SoilRENVDLVIEFSLRGPKRLHDQVMIALLHHPSVRTVSTGE*
Ga0134089_1041064013300015358Grasslands SoilQENVDLVIDFDLRGSKRLHDQVMITLLHHDHVRTVSTGE*
Ga0134069_123649223300017654Grasslands SoilERQASRRENVDLVIDFTLLGPKRLHDEVMVALLHQPGVRTVSTGE
Ga0134074_128041523300017657Grasslands SoilRTGLDIVQQQSRRENVDLVVVFELRGPKRLHDQVMVALLHHPGVRTVSSGE
Ga0134074_138663523300017657Grasslands SoilDLVIDLELRGSKRLHDQAMITLLHHDHVRTVSTGE
Ga0134083_1005630933300017659Grasslands SoilRQASRRENVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE
Ga0134083_1010538023300017659Grasslands SoilGLEVERVESRKENVDLVIELDIRGPKRLHDQVMIAILHTPVVRTVSTGE
Ga0134083_1022023923300017659Grasslands SoilTGLEIERQASRRENVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE
Ga0184637_1034199513300018063Groundwater SedimentVERSKSRQENVDLVIELELRGPQRLHSQAVTAILHAPGVRTVSTGE
Ga0184618_1016945923300018071Groundwater SedimentAVSSRQENVDLVIEFNIRGSKRLHDQVMITLVHHDHVRTVSAGE
Ga0184633_1028722623300018077Groundwater SedimentTQSRRENVDMVVEFDLRGPKRLHDQALVGILHHPSVRAVSTGE
Ga0184639_1008794713300018082Groundwater SedimentDLTRVESRRENVDLVVEFELRGPKRLHDQVLIAILHHPGVRGVSTGE
Ga0066667_1023518813300018433Grasslands SoilVDLVVDFELRGPKRLHDQVMVALLHHPGVRTVSSGE
Ga0066667_1222520323300018433Grasslands SoilDVVIDFTLRGPKRLHDEAMIALLHHPSVRTVSTGE
Ga0066662_1159932323300018468Grasslands SoilEIERLASRRENVDLVIDFTLLGPKRLHDEVMVALLHEPGVRTVSTGE
Ga0066669_1041239713300018482Grasslands SoilGLAIERQASRRENIDLVIDFTLRGPKRLHDQVMIALLHHPSVRAVSTGE
Ga0193720_102143423300019868SoilRTGLEIERQASRQENVDLVIDYTLRGSKRLHDQVMIALLHHPSVRTVSTGE
Ga0193712_100365713300019880SoilSRRENVDVVCEFYLSGPKRLHDQVMIALLHHPAVRTVSTGE
Ga0193733_114978513300020022SoilDLVIDYTLRGSKRLHDQVMIALLHHPSVRTVSTGE
Ga0210378_1033730623300021073Groundwater SedimentTQQRREDPDLVVDFELRGAKRLHDAAMVGLLHQPGVRTVSTGE
Ga0179596_1059064713300021086Vadose Zone SoilQASRRENVDLVIDVELSGPKRLHDQALIAVLHHPMVRTVSTGE
Ga0222622_1136590323300022756Groundwater SedimentSAVSSRQENVDLVIEFNIRGSKRLHDQVMITLVHHDHVRTVSAGE
Ga0247660_107962823300024317SoilARVESRRENVDLVVEFELRGPKRLHDQAKLSILHHPLVRTVSTGE
Ga0209342_1005206413300025326SoilIERTASRRENVDLVIEFDLRGARRLHDQALIGVLHHPGVRAVSTGE
Ga0209438_111739113300026285Grasslands SoilRQENVDLVIDFNIRGSKRLHDQVMITLLHHDQVRTVSTGE
Ga0209235_116410223300026296Grasslands SoilVDLVIDFTLRGPKRLHDQVMIALLNHPGVRTVSTGE
Ga0209237_103687213300026297Grasslands SoilENVDMVIDFTLRGPKRLHDEVMIALLHHPGVRTVSTGE
Ga0209236_122698423300026298Grasslands SoilSRRENVDLVIDFTLRGPKRLHDEAMIALLHHPSVRSVSTGE
Ga0209238_115690413300026301Grasslands SoilASRQENVDLVIDFDLRGSKRLHDQLMITLLHHDHVRTVSTGE
Ga0209153_126338413300026312SoilGLQILTVASRQENVDLVIDLEMRGSKRLHDQAIITLLHHDHVRTVSTGE
Ga0209155_101633743300026316SoilIERQASRRENIDLVIDFTLRGPKRLHDQVMIALLHHPSVRTVSTGE
Ga0209155_119859613300026316SoilIERQASRRENIDLVIDFTLRGPKRLHDQVMIALLHHPSVRAVSTGE
Ga0209801_134582013300026326SoilGLEIERQASRRENVDLVIEFTLRGPKRLHDEVMIALLHQPGVRTVSTGE
Ga0209375_100505393300026329SoilENVDLVIEYDIRGPKRLHDQVMIAILHHPVVRTVSTGE
Ga0209375_114486923300026329SoilIEARQENVDLVVELDARGPKRLHDQLLIGLMHHPTVRSVSSGE
Ga0209806_107271433300026529SoilDIVQQQSRRENVDLVVDFELRGPKRLHDQVMVALLHHPGVRTVSSGE
Ga0209056_1037160413300026538SoilDLVIDLEMRGSKRLHDQAMITLLHHDHVRTVSTGE
Ga0209056_1044886313300026538SoilENVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE
Ga0209161_1014899433300026548SoilEIERQASRRENVDLVIDFTLLGPKRLHDEVMVALLHEPGVRTVSTGE
Ga0209073_1000820943300027765Agricultural SoilWVEVERTESRRENVDLVVELDLRGPRRLHEQAMISILHHPLVRTVSTGE
Ga0209074_1019523013300027787Agricultural SoilSRRENVDLVLELDLRGPKRLHDQALIAVLHHPMVRTVSTGE
Ga0209283_1054015513300027875Vadose Zone SoilVDLVIEYELRGPKRLHDQVMIALLHHPSVRTVSTGE
Ga0209481_1001925443300027880Populus RhizosphereVESRQENVDLVIEFDLRGPKRLHDQARTAVLHHPGVRSVTTGE
Ga0209590_1003793213300027882Vadose Zone SoilRRENVDLVIDFTLRGPKRLHDEVMLALLHQPGVRTVSTGE
Ga0209488_1083490133300027903Vadose Zone SoilTGLDIVQQQSRRENVDLVVDFELRGPKRLHDQVLVALLHHPGVRTVSSGE
Ga0209853_107743623300027961Groundwater SandVESRKENVDLVIEFELHGPKRLHDQVLIAMLHHPGVRGVSTGE
Ga0137415_1019604013300028536Vadose Zone SoilDLVIEYDLRGPKRLHDQVMIALLHHPSVRTVSTGE
Ga0307503_1056951313300028802SoilVRGVGLTIERVVARHENVDLVIELSLRGPHRLHDQALLAVLHHPGVRGVSSGE
Ga0307296_1003862943300028819SoilTIVRHESRRENVDLVVDFDLSGPKRLHDQVMIALLHHPAVRTVSTGE
Ga0326597_1071092123300031965SoilTGLELTRVESRRENVDLVVEFELRGPKRLHDQVLIAILHHPGVRGVSTGE
Ga0307471_10121580113300032180Hardwood Forest SoilLEVSAVASRQENVDLVIDFDLRGSKRLHDQLMITLLHHDHVRTVSTGE
Ga0214472_1017663633300033407SoilQENVDLVLEFELRGPKRLHDEVMIGLLHHDKVRTVSTGE
Ga0214471_1066908213300033417SoilSRQETVDLVLEFELRGPKRLHDEVMIGLLHHDKVRTVSTGE
Ga0247830_1067344823300033551SoilTQSRVENVDLVIEFDLRGPKRLHDQVVLATVQHPGVRSVSTGE
Ga0364946_046331_753_8633300033815SedimentVDLVIDFDVRGSKRLHDQVMITLLHHDHVRTVSTGE
Ga0364937_099666_484_5913300034113SedimentDLVVDFELRGPKRLHDAAMLGLLHQPGVRTVATGE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.