| Basic Information | |
|---|---|
| Family ID | F050984 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MSERQGPGHGLSEHELSEIRMLIEERTGICFDESRERFFS |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.03 % |
| % of genes near scaffold ends (potentially truncated) | 97.92 % |
| % of genes from short scaffolds (< 2000 bps) | 93.75 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.611 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.306 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.861 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.250 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.29% β-sheet: 0.00% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF00015 | MCPsignal | 83.33 |
| PF00672 | HAMP | 6.94 |
| PF00072 | Response_reg | 2.08 |
| PF01584 | CheW | 2.08 |
| PF01739 | CheR | 2.08 |
| PF00512 | HisKA | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 166.67 |
| COG1352 | Methylase of chemotaxis methyl-accepting proteins | Signal transduction mechanisms [T] | 4.17 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 2.08 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.61 % |
| Unclassified | root | N/A | 1.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_17350694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300004080|Ga0062385_11003794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300004635|Ga0062388_102326583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300005171|Ga0066677_10556112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300005178|Ga0066688_10839176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300005293|Ga0065715_11008066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300005363|Ga0008090_14288026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300005445|Ga0070708_100731062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
| 3300005531|Ga0070738_10332833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300005545|Ga0070695_100231048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| 3300005552|Ga0066701_10627877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300005556|Ga0066707_10433596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300005561|Ga0066699_11185399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300005566|Ga0066693_10381424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300005569|Ga0066705_10090691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1801 | Open in IMG/M |
| 3300005607|Ga0070740_10274389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300005764|Ga0066903_103311425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300006032|Ga0066696_10677720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300006047|Ga0075024_100565901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300006047|Ga0075024_100786744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300006804|Ga0079221_11169666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300006806|Ga0079220_10553603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300006903|Ga0075426_10076503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2391 | Open in IMG/M |
| 3300007265|Ga0099794_10045000 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300007265|Ga0099794_10215404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300007265|Ga0099794_10346351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300009012|Ga0066710_104245645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300009088|Ga0099830_11723878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300009137|Ga0066709_103581265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300009143|Ga0099792_10866958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300009520|Ga0116214_1391655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300009522|Ga0116218_1442253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300009792|Ga0126374_10348571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
| 3300010046|Ga0126384_12493856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300010301|Ga0134070_10330280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300010343|Ga0074044_10490357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300010359|Ga0126376_12411589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300010360|Ga0126372_10013471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4513 | Open in IMG/M |
| 3300010360|Ga0126372_12488086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300010361|Ga0126378_12500253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300010376|Ga0126381_101653344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300011120|Ga0150983_12123853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1644 | Open in IMG/M |
| 3300011120|Ga0150983_16474940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300011269|Ga0137392_10726929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300011270|Ga0137391_11072106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300011271|Ga0137393_10224783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1589 | Open in IMG/M |
| 3300011271|Ga0137393_10762253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300011271|Ga0137393_11227895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300011271|Ga0137393_11425809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300012096|Ga0137389_10555007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300012096|Ga0137389_10579049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 964 | Open in IMG/M |
| 3300012096|Ga0137389_11410003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300012189|Ga0137388_11043566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300012203|Ga0137399_10330594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1263 | Open in IMG/M |
| 3300012205|Ga0137362_10435156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
| 3300012205|Ga0137362_11256202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300012349|Ga0137387_10129102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1787 | Open in IMG/M |
| 3300012362|Ga0137361_11178739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300012362|Ga0137361_11437981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300012362|Ga0137361_11761497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300012363|Ga0137390_10539630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1138 | Open in IMG/M |
| 3300012582|Ga0137358_10626265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300012683|Ga0137398_10965629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300012918|Ga0137396_11288156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300012923|Ga0137359_10202864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1771 | Open in IMG/M |
| 3300012923|Ga0137359_11541068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300012925|Ga0137419_10028010 | All Organisms → cellular organisms → Bacteria | 3408 | Open in IMG/M |
| 3300012925|Ga0137419_10613407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300012927|Ga0137416_10455597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
| 3300012927|Ga0137416_10669617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300012958|Ga0164299_10383961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
| 3300012964|Ga0153916_12383080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300014164|Ga0181532_10535619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300014657|Ga0181522_10562398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300015242|Ga0137412_10916030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300016294|Ga0182041_11006811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300016294|Ga0182041_12337985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300016341|Ga0182035_10107829 | All Organisms → cellular organisms → Bacteria | 2056 | Open in IMG/M |
| 3300016341|Ga0182035_10828636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300017966|Ga0187776_11396726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300018058|Ga0187766_11285022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300018088|Ga0187771_10959296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300020579|Ga0210407_10703606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300020580|Ga0210403_11360962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300020581|Ga0210399_10049403 | All Organisms → cellular organisms → Bacteria | 3378 | Open in IMG/M |
| 3300020581|Ga0210399_11464009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300020582|Ga0210395_10746351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300020583|Ga0210401_11279699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300021088|Ga0210404_10899738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300021168|Ga0210406_10147041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1979 | Open in IMG/M |
| 3300021170|Ga0210400_10243668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1469 | Open in IMG/M |
| 3300021180|Ga0210396_11231619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300021181|Ga0210388_10273348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1483 | Open in IMG/M |
| 3300021407|Ga0210383_10214040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1650 | Open in IMG/M |
| 3300021420|Ga0210394_11259734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300021475|Ga0210392_11291228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300021478|Ga0210402_10456518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1187 | Open in IMG/M |
| 3300021478|Ga0210402_10676496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300021559|Ga0210409_11498590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300022717|Ga0242661_1091870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300024187|Ga0247672_1094045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300024323|Ga0247666_1060459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300024331|Ga0247668_1079461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300025928|Ga0207700_11675769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300026285|Ga0209438_1152592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300026318|Ga0209471_1118669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
| 3300026482|Ga0257172_1021335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1140 | Open in IMG/M |
| 3300026507|Ga0257165_1069629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300026896|Ga0207730_1022883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300027043|Ga0207800_1025774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
| 3300027064|Ga0208724_1037424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300027603|Ga0209331_1110076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300027643|Ga0209076_1150880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300027765|Ga0209073_10506765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300027842|Ga0209580_10183253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300027846|Ga0209180_10752257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300027884|Ga0209275_10083830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1602 | Open in IMG/M |
| 3300027889|Ga0209380_10387578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300027898|Ga0209067_10303355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300027908|Ga0209006_10939971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300027911|Ga0209698_11119505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300027915|Ga0209069_10611076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300028065|Ga0247685_1046541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300028795|Ga0302227_10145159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
| 3300028879|Ga0302229_10547056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300030844|Ga0075377_11477172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300031231|Ga0170824_111219947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300031718|Ga0307474_10925946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300031718|Ga0307474_11389255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300031720|Ga0307469_10414338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1155 | Open in IMG/M |
| 3300031754|Ga0307475_11112864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300031754|Ga0307475_11525592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300031910|Ga0306923_12156149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300031962|Ga0307479_10367497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1422 | Open in IMG/M |
| 3300032001|Ga0306922_10993765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300032001|Ga0306922_12150761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300032052|Ga0318506_10016683 | All Organisms → cellular organisms → Bacteria | 2606 | Open in IMG/M |
| 3300032090|Ga0318518_10710263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300032180|Ga0307471_100292830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1710 | Open in IMG/M |
| 3300032770|Ga0335085_12101888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300032895|Ga0335074_11481853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300033480|Ga0316620_10880974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.47% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.08% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.08% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.08% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.08% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.39% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.39% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.39% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.39% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.69% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026896 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 71 (SPAdes) | Environmental | Open in IMG/M |
| 3300027043 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028065 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26 | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_173506941 | 3300000550 | Soil | QPQRLRKGGPVSLTEHELSEIRMLIEERTSIRFDE* |
| Ga0062385_110037942 | 3300004080 | Bog Forest Soil | LTGKSVKIMSERHGAEHGLSEHELSELRMLIEERTGIHFDAS |
| Ga0062388_1023265832 | 3300004635 | Bog Forest Soil | MSEPFGAAHELSEHELSEIRMLIEERTGIHFDVSRERFFST |
| Ga0066677_105561121 | 3300005171 | Soil | MSERQGHGQGLSEHELSEIRMLIEERTGICFDESRERFFSTRV |
| Ga0066688_108391761 | 3300005178 | Soil | MSERQGHVQGLSEHELSEIRMLIEERTGICFDESRERFFSTRV |
| Ga0065715_110080662 | 3300005293 | Miscanthus Rhizosphere | MSERQGPAARLTEHELSELRMLIEERTGIHFDESRDRFFS |
| Ga0008090_142880261 | 3300005363 | Tropical Rainforest Soil | MSERQRPGHGLSEHELSEIRMLIEERTGICFDESRERFFSTLLA |
| Ga0070708_1007310621 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTERQGHVPGLSEHELSEIRMLIEERTGICFDESRERFFST |
| Ga0070738_103328331 | 3300005531 | Surface Soil | MSERQGQGHGLSEHELSEIRMLIEERTGICFDDSRERFFS |
| Ga0070695_1002310481 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSERQGPVAGLSEHELSEIRMLIEERTGICFDESRERFFSTR |
| Ga0066701_106278771 | 3300005552 | Soil | MSERQGHLQELSEHELSEIRMLIEERTGICFDESRERFF |
| Ga0066707_104335961 | 3300005556 | Soil | MSERQGHGHELSEHELSEIRMLIEERTGICFDESRERFFS |
| Ga0066699_111853992 | 3300005561 | Soil | MSERQGQPVTLTEHELSEIRMLIEERTSIRFDESR |
| Ga0066693_103814242 | 3300005566 | Soil | MSERQGHGHELSEHELSEIRMLIEERTGICFDESRE |
| Ga0066705_100906913 | 3300005569 | Soil | MSERQGHGHELSEHELSEIRMLIEERTGICFDESRERFF |
| Ga0070740_102743891 | 3300005607 | Surface Soil | MSERSGHELSLTEHELGEIRMLIHERTGISFDESR |
| Ga0066903_1033114251 | 3300005764 | Tropical Forest Soil | MSERSGHELSLSEHELSEIRMLIHERTGISFDESRERFF |
| Ga0066696_106777202 | 3300006032 | Soil | MSERQGPVAGLSEHELSEIRMLIEERTGIHFDESRE |
| Ga0075024_1005659011 | 3300006047 | Watersheds | MMMSERQGSAAGLSEHELSEIRMFIEERTGICFDASRERFFSTRV |
| Ga0075024_1007867442 | 3300006047 | Watersheds | MSEPHGAAHELSEHELSEIRMLIEERTGICFDESRER |
| Ga0079221_111696661 | 3300006804 | Agricultural Soil | MSERQGSGHGLSEHELSEIRMLIEERTGICFDESRERFFS |
| Ga0079220_105536032 | 3300006806 | Agricultural Soil | MSERQGPGHGLSEHELSEIRMLIEERTGICFDESRERFFS |
| Ga0075426_100765031 | 3300006903 | Populus Rhizosphere | MTERLGHEISLTEHELSEIRMLIHERTGISFDESRERFFSTR |
| Ga0099794_100450001 | 3300007265 | Vadose Zone Soil | MSERQGQVHGLSEHELSEIRMLIEERTGICFDESRERF |
| Ga0099794_102154042 | 3300007265 | Vadose Zone Soil | MSERQGHGQGLSEHELSEIRMLIEERTGICFDESRERFFST |
| Ga0099794_103463511 | 3300007265 | Vadose Zone Soil | MSERQGHGQGPNEHELSEIRMLIEERTGICFDESRERFFST |
| Ga0066710_1042456452 | 3300009012 | Grasslands Soil | MTERPGPVLSEHELNEIRMLIEEQTGIHFDVSRERF |
| Ga0099830_117238782 | 3300009088 | Vadose Zone Soil | MSERQGHGQGFSEHELSEIRMLIEERTGICFDESRERFFST |
| Ga0066709_1035812651 | 3300009137 | Grasslands Soil | MSERQGHGQVLSEHELSEIRMLIEERTGICFDESRERFFSTRV |
| Ga0099792_108669582 | 3300009143 | Vadose Zone Soil | MNERQGHVEGLSEHELSEIRMLIEERTGICFDESRERFFS |
| Ga0116214_13916551 | 3300009520 | Peatlands Soil | MSERQGPVHGLSEHELSEIRMLIEERTGICFDASRERF |
| Ga0116218_14422532 | 3300009522 | Peatlands Soil | MSERHGAGHGLNEQQLSEIRMLIEERTGIHFDESRERFFS |
| Ga0126374_103485712 | 3300009792 | Tropical Forest Soil | MSERHGAGHGLSEHELSEIRMLIEERTGIHFDDSRER |
| Ga0126384_124938561 | 3300010046 | Tropical Forest Soil | MTMSERLGHAITLTEHELSEIRMLIHERTGISFDESRE |
| Ga0134070_103302802 | 3300010301 | Grasslands Soil | MRERQGPASGLTEHELSEIRMLIEERTGICFDESRARFFS |
| Ga0074044_104903572 | 3300010343 | Bog Forest Soil | MSERHGAGHGLSEHELSEIRMLIEERTGIHFDQSRE |
| Ga0126376_124115892 | 3300010359 | Tropical Forest Soil | MKMSERVGHEITLTEHELSEIRMLIHERTGISFDESRERF |
| Ga0126372_100134716 | 3300010360 | Tropical Forest Soil | VWGKSVMTMSERHGAGHGLSEHEWSEIRMLIEERTGIHFDE |
| Ga0126372_124880862 | 3300010360 | Tropical Forest Soil | MSERQERGAGLTEHELSEIRMLIEERTAICFDESRERFFS |
| Ga0126378_125002531 | 3300010361 | Tropical Forest Soil | MSERQGPGHGLSEHELSEIRMLIEERTGICFDESRERFFSTR |
| Ga0126381_1016533442 | 3300010376 | Tropical Forest Soil | VWGKSVMTMSERHGAGHGLSEHELSEIRMLIEERTGIHFDESRER |
| Ga0150983_121238531 | 3300011120 | Forest Soil | MSERQGPVGGLSEHELSEIRMLIEERTGICFDESRARFFSTR |
| Ga0150983_164749402 | 3300011120 | Forest Soil | MSERQGPAHGLSQHELSEIRMLIEERTGICFDQSRERFFSTR |
| Ga0137392_107269292 | 3300011269 | Vadose Zone Soil | MSERQGPVAGLSEHELSEIRMLIEERTGICFDESR |
| Ga0137391_110721061 | 3300011270 | Vadose Zone Soil | MSERQGGPVSLTEHELSEIRMLIEERTSIRFDESRERF |
| Ga0137393_102247831 | 3300011271 | Vadose Zone Soil | MTERQGSVHGPSEHELNEIRMLIEERTGICFDESRE |
| Ga0137393_107622531 | 3300011271 | Vadose Zone Soil | MSERQGQVHGLSEHELSEIRMLIEERTGICFDESRER |
| Ga0137393_112278951 | 3300011271 | Vadose Zone Soil | MSERQGQVQGPSEHELSEIRMLIEERTGICFDESRERFFSTRV |
| Ga0137393_114258092 | 3300011271 | Vadose Zone Soil | MSERQGRVDGLSEHELSEIRMLIEERTGICFDESRERFFSTRVQ |
| Ga0137389_105550071 | 3300012096 | Vadose Zone Soil | MSERQGPVAGLSEHELSEIRMLIEERTGICFDESRERFFST |
| Ga0137389_105790491 | 3300012096 | Vadose Zone Soil | MKMSEHQGPATDLSEHELSEIRMLIEERTGIHFDESR |
| Ga0137389_114100032 | 3300012096 | Vadose Zone Soil | MSERQGPVAGLSEHELSEIRMLIEERTGICFDESRERFF |
| Ga0137388_110435661 | 3300012189 | Vadose Zone Soil | MSERQGHGQLLSEHELSEIRMLIEERTGICFDESR |
| Ga0137399_103305942 | 3300012203 | Vadose Zone Soil | MSERQGQVQGLSEHELSEIRMLIEERTGICFDESRERFFS |
| Ga0137362_104351562 | 3300012205 | Vadose Zone Soil | MSERQGPVAGLSEHELSEIRMLIEERTGICFDESRERFFS |
| Ga0137362_112562022 | 3300012205 | Vadose Zone Soil | MSERQGGQVSLTEHELSEIRMLIEERTSIRFDESRERFF* |
| Ga0137387_101291021 | 3300012349 | Vadose Zone Soil | MSERHGQVQGPSEHELSEIRMLIEERTGICFDESRER |
| Ga0137361_111787391 | 3300012362 | Vadose Zone Soil | MTERHGHVHGLSEHELSEIRMLIEERTGICFDESRERFFSTRV |
| Ga0137361_114379811 | 3300012362 | Vadose Zone Soil | MSERQGPVAGLSEHELSEIRMLIEERTGICFDESRERFFSTRV |
| Ga0137361_117614972 | 3300012362 | Vadose Zone Soil | MTERQGHVQRLTEHELSEIRMLIEERTGICFDESRERFFS |
| Ga0137390_105396302 | 3300012363 | Vadose Zone Soil | MSERQGHGQVLSEHELSEIRMLIEERTGICFDESRE |
| Ga0137358_106262652 | 3300012582 | Vadose Zone Soil | MSERQGGPVSLSEHELSEIRMLIEERTSIRFDESRERFFS |
| Ga0137398_109656291 | 3300012683 | Vadose Zone Soil | MSERHGHGQVLSEHELSEIRMLIEERTGICFDESRERFFST |
| Ga0137396_112881562 | 3300012918 | Vadose Zone Soil | MSERQGQVHGLNEHELSEIRMLIEERTGICFDESRERFFST |
| Ga0137359_102028641 | 3300012923 | Vadose Zone Soil | MSERQGQLHGLNEHELSEIRMMIEERTGICFDESRERFFSTRV |
| Ga0137359_115410681 | 3300012923 | Vadose Zone Soil | MSERQGGPVSLTEHELSEIRMLIEERTSIRFDESRERFFST |
| Ga0137419_100280101 | 3300012925 | Vadose Zone Soil | MSERQGPVAGLSEHELSEIRMLIEERTGICFDESRE |
| Ga0137419_106134072 | 3300012925 | Vadose Zone Soil | MSERQGQVHGLSEHELSEIRMLIEERTGICFDESRERFFS |
| Ga0137416_104555971 | 3300012927 | Vadose Zone Soil | MTMSQSLGHEISLTEHELSEIRMLIHERTGISFDESRERF |
| Ga0137416_106696171 | 3300012927 | Vadose Zone Soil | MSERQGQVQGLSEHELSEIRMLIEERTGICFDESRERFFSTRV |
| Ga0164299_103839611 | 3300012958 | Soil | MSERQGGPVSLTEHELSELRMLIEERTSIRFDESRERF |
| Ga0153916_123830801 | 3300012964 | Freshwater Wetlands | MTERQNPKPELTDHELSEIRLLIEERTGIHFDKSRLRF |
| Ga0181532_105356191 | 3300014164 | Bog | MIMSERHGPEHSLSEHELSEIRMLIEERTGIHFDASRER |
| Ga0181522_105623982 | 3300014657 | Bog | MSDQGSAVRLSEHELSEIRMLIQERTGICFDESRERFFST |
| Ga0137412_109160302 | 3300015242 | Vadose Zone Soil | VTTMSERQGPAVRLSEHELSEIRMLIQERTGICFDESRERFLS |
| Ga0182041_110068112 | 3300016294 | Soil | MSERHGAPHGLSEHELSEIRMLIEERTGIHFDESR |
| Ga0182041_123379852 | 3300016294 | Soil | MTMSERHGAGHGLSEHELSEIRMLIEERTGIHFDDSR |
| Ga0182035_101078291 | 3300016341 | Soil | MSERHGAGHGLSEHELSEIRMLIEERTGIHFDSSRERFFST |
| Ga0182035_108286361 | 3300016341 | Soil | MSERHGAPHGLSEHELSEIRMLIEERTGIHFDESRERFFST |
| Ga0187776_113967262 | 3300017966 | Tropical Peatland | MSGNTMSDRHGAGHGLSEHELSEIRMLIEERTGIHFD |
| Ga0187766_112850222 | 3300018058 | Tropical Peatland | MTMSERQGAGHGLNKHELSEIRMFIEERTGIHFDDSR |
| Ga0187771_109592962 | 3300018088 | Tropical Peatland | MTMSERLGAGHGLSEHELGELRMMIEERTGIQFDAS |
| Ga0210407_107036061 | 3300020579 | Soil | MSERHGAGHGLTDHELSEIRMLIEERTGIHFDESRERFLST |
| Ga0210403_113609622 | 3300020580 | Soil | VTTMSERQGPAVRLSEHELSEIRMLIEERTGICFDESRERFFSTRVH |
| Ga0210399_100494031 | 3300020581 | Soil | MAMSERHAAGHGLTDHELSEIRMLIEERTGIHFDESRERF |
| Ga0210399_114640091 | 3300020581 | Soil | MSERQGPAHGLSEHELSEIRMLVEERTGICFDESRERFFST |
| Ga0210395_107463512 | 3300020582 | Soil | MSERQGPAARLTEHELSELRMLIEERTGICFDESREPF |
| Ga0210401_112796991 | 3300020583 | Soil | VTTMSERQGPAVRLSEHELSEIRMLIEERTGICFDESRERFFS |
| Ga0210404_108997382 | 3300021088 | Soil | MKMSERQGPAAGLSEHELSEIRMLIEERTGIRFDESRERFFSTRV |
| Ga0210406_101470411 | 3300021168 | Soil | VGTMSESQGPVAGPSEHELSEIRMLIEERTGICFDESRERFFST |
| Ga0210400_102436681 | 3300021170 | Soil | MTERQGHVHGLSEHELSEIRMLIEERTGICFDESRERFFSTR |
| Ga0210396_112316191 | 3300021180 | Soil | MSERHGAGHGLTDHELSEIRMLIEERTGIHFDESR |
| Ga0210388_102733481 | 3300021181 | Soil | MSERQAPAHSLSEHELSEIRMLIEERTGICFDESRE |
| Ga0210388_103820792 | 3300021181 | Soil | MDRSRNVTTMSERQGPAVRLSEHELSEIRMLIEERTGIC |
| Ga0210383_102140402 | 3300021407 | Soil | VTTMSDQGSAVRLSEHELSEIRMLIQERTGICFDESRERFF |
| Ga0210394_112597342 | 3300021420 | Soil | MSERQGPTHGLSEHELSEIRMLIEERTGICFDESRARFFSTRVKD |
| Ga0210392_112912281 | 3300021475 | Soil | VTTMSERQGPAVRLSEHELSEIRVLIQERTGICFD |
| Ga0210402_104565182 | 3300021478 | Soil | MMTERREPVNRLSEHELSEIRMLIEERTGICFDESRER |
| Ga0210402_106764962 | 3300021478 | Soil | MSEPFGAAHELSEHELSEIRMLIEERTGIHFDVSRERFFSTRVR |
| Ga0210409_114985901 | 3300021559 | Soil | MSERHGAGHGLTDHELSEIRMLIEERSGIHFDESRERFLST |
| Ga0242661_10918702 | 3300022717 | Soil | MSERQGHGQGLSEHELSEIRMLIEERTGICFDESRER |
| Ga0247672_10940452 | 3300024187 | Soil | MSERQGPAHGLSEHELSEIRMLIEERTGICFDESRTRFFSTR |
| Ga0247666_10604591 | 3300024323 | Soil | MSERQGPAHGLSEHELSEIRMLIEERTGICFDESR |
| Ga0247668_10794611 | 3300024331 | Soil | MSESLGHEISLTEHELSEIRMLIHERTGISFDESRE |
| Ga0207700_116757691 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSESLGHEISLTEHELSEIRMLIHERTGISFDESR |
| Ga0209438_11525922 | 3300026285 | Grasslands Soil | MSERQGGPVSLTEHELSEIRMLIEERTSIRFDESRERFFSTRV |
| Ga0209471_11186692 | 3300026318 | Soil | MSERQGHGQQLSEHELSEIRMLIEERTGICFDESRE |
| Ga0257172_10213351 | 3300026482 | Soil | MKMSERQGPATDLSEHELSEIRMLIEERTGIRFDESRE |
| Ga0257165_10696291 | 3300026507 | Soil | MSERQGQVQGLSEHELSEIRMLIEERTGICFDESR |
| Ga0207730_10228831 | 3300026896 | Tropical Forest Soil | MTMSERHGAGHGLSEHELSEIRMLIEERTGIHFDESRERFFSTR |
| Ga0207800_10257741 | 3300027043 | Tropical Forest Soil | MSDRHGAGHSLSEHELSEIRTMIEERTGIHFDESRERFFSTRV |
| Ga0208724_10374241 | 3300027064 | Forest Soil | MSERHGAGHGLSEHELSEIRMLIEERTGIHFDASR |
| Ga0209331_11100761 | 3300027603 | Forest Soil | VGTMNERQGPVDGLSEHELSEIRMLIEERTGICFDE |
| Ga0209076_11508801 | 3300027643 | Vadose Zone Soil | MSERQGHGQGLSEHELSEIRMLIEERTGICFDESRE |
| Ga0209073_105067651 | 3300027765 | Agricultural Soil | MSERQGPGHGLSEHELSEIRMLIEERTGICFDESRERFFST |
| Ga0209580_101832531 | 3300027842 | Surface Soil | MSERQGPVAGLSEHELSEIRMLIEERTGICFDESRER |
| Ga0209180_107522571 | 3300027846 | Vadose Zone Soil | MSERQGHGQVLSEHELSEIRMLIEERTGICFDESRER |
| Ga0209275_100838302 | 3300027884 | Soil | MSERQGPAHGLSEHELSEIRMLIEERTGICFDESRERFFST |
| Ga0209380_103875782 | 3300027889 | Soil | MSERQGPAVRLSEHELSEIRMLIEERTGICFDESRERFFSTRV |
| Ga0209067_103033551 | 3300027898 | Watersheds | MSERHGSGHGLSGHELSEIRMLIEERTGICFDESRERFFSTRV |
| Ga0209006_109399712 | 3300027908 | Forest Soil | VTTMSDQGSAVRLSEHELSEIRMLIQERTGICFDESRER |
| Ga0209698_111195051 | 3300027911 | Watersheds | MKMSERQGPAAGLSEHELSEIRMLIEERTGICFDESRE |
| Ga0209069_106110762 | 3300027915 | Watersheds | MMMSERQGSAAGLSEHELSEIRMFIEERTGICFDASRERFFSTR |
| Ga0247685_10465412 | 3300028065 | Soil | MSERQGPANGLSEHELSEIRMLIEERTGICFDESRERFFS |
| Ga0302227_101451592 | 3300028795 | Palsa | MSQRHGSTVNLSEHELSELRVLVEQRSGIHFDDSRERFFSTRV |
| Ga0302229_105470561 | 3300028879 | Palsa | MSQRHGSTVNLSEHELSELRVLVEQRSGIHFDDSRERFFST |
| Ga0075377_114771721 | 3300030844 | Soil | MSERHGAGHGLSEHELSEIRGLIETRSGIHFDDSRERFFSTRVV |
| Ga0170824_1112199471 | 3300031231 | Forest Soil | VTTMNERQGPAVRLSEHELSEIRMLIEERTGICFDESRERFF |
| Ga0318574_107608781 | 3300031680 | Soil | MWGKSVITMSERHGTGHGLSEHELSEIRMLIEERTGIY |
| Ga0307474_109259461 | 3300031718 | Hardwood Forest Soil | MNERHGPGHGLSEHELSEIRMLIEERTGIHFDESRAR |
| Ga0307474_113892551 | 3300031718 | Hardwood Forest Soil | VTTMSERQGPAVRLSEHELSEIRMLIEERTGICFDESRERF |
| Ga0307469_104143381 | 3300031720 | Hardwood Forest Soil | MSERHGAGHGLTDHELSEIRMLIEERTGIHFDESRERF |
| Ga0307475_111128641 | 3300031754 | Hardwood Forest Soil | MSERHGAGHGLTDHELSEIRMLIEERTGINFDESRERFLSTR |
| Ga0307475_115255922 | 3300031754 | Hardwood Forest Soil | MSERQGTAAGLNEHELNEIRMLIEERTGICFDESRQRF |
| Ga0306923_121561492 | 3300031910 | Soil | MTMSERHGAGHGLSEHELSEIRMLIEERTGIHFDESRER |
| Ga0307479_103674972 | 3300031962 | Hardwood Forest Soil | MSERQGHGQGLSEHELSEIRMLIEERTGICFDESRERFFS |
| Ga0306922_109937651 | 3300032001 | Soil | MSERHGAGHGLSEHELSEIRMLIEERTGIHFDDSRERFFS |
| Ga0306922_121507612 | 3300032001 | Soil | MSERLGHETSLTEHELSEIRMLIHERTGISFDESRERF |
| Ga0318506_100166831 | 3300032052 | Soil | MSERHGAGHGLSEHELSEIRMLIEERTGIHFDESRERFF |
| Ga0318518_107102631 | 3300032090 | Soil | MSERHGAPHGLSEHELSEIRMLIEERTGIHFDESRERFF |
| Ga0307471_1002928301 | 3300032180 | Hardwood Forest Soil | MNERKETGPGLSEHELSEIRMLIEERTGICFDESRERFLSSRV |
| Ga0335085_121018881 | 3300032770 | Soil | MSVRQGQAVSLSEHELSEIRMLIEERTGIHFDESR |
| Ga0335074_114818532 | 3300032895 | Soil | MSERHGPEHGLSEHELSEIRMLIEERTGIHFDASRERFFSTRV |
| Ga0316620_108809741 | 3300033480 | Soil | MSERQGPAHGLSEHELSEIRMLIEERTGICFDESRTRFFSRVSLKQLA |
| ⦗Top⦘ |