| Basic Information | |
|---|---|
| Family ID | F050969 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VGLRDVLFGKKKLAGPARERLFALTTAAVTLDTELGLR |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 46.53 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 97.92 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.806 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.056 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.167 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.056 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.39% β-sheet: 0.00% Coil/Unstructured: 60.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF01435 | Peptidase_M48 | 68.75 |
| PF04012 | PspA_IM30 | 15.28 |
| PF13442 | Cytochrome_CBB3 | 1.39 |
| PF01939 | NucS | 1.39 |
| PF00753 | Lactamase_B | 1.39 |
| PF07883 | Cupin_2 | 0.69 |
| PF13231 | PMT_2 | 0.69 |
| PF00370 | FGGY_N | 0.69 |
| PF08327 | AHSA1 | 0.69 |
| PF00691 | OmpA | 0.69 |
| PF02775 | TPP_enzyme_C | 0.69 |
| PF02403 | Seryl_tRNA_N | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG1842 | Phage shock protein A | Transcription [K] | 30.56 |
| COG1637 | Endonuclease NucS, RecB family | Replication, recombination and repair [L] | 1.39 |
| COG0172 | Seryl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.81 % |
| Unclassified | root | N/A | 38.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908044|A5_c1_ConsensusfromContig60519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1028 | Open in IMG/M |
| 2199352025|deepsgr__Contig_157235 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300000953|JGI11615J12901_11484359 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300001686|C688J18823_10700853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101829263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300004114|Ga0062593_100916805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 888 | Open in IMG/M |
| 3300004463|Ga0063356_101646486 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300004479|Ga0062595_101638722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300004479|Ga0062595_102449550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 519 | Open in IMG/M |
| 3300005332|Ga0066388_101716947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1112 | Open in IMG/M |
| 3300005437|Ga0070710_10203695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1251 | Open in IMG/M |
| 3300005529|Ga0070741_11452241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300005534|Ga0070735_10665745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 616 | Open in IMG/M |
| 3300005538|Ga0070731_10285237 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300005547|Ga0070693_101059400 | Not Available | 616 | Open in IMG/M |
| 3300005556|Ga0066707_10125885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1602 | Open in IMG/M |
| 3300005559|Ga0066700_10706915 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005560|Ga0066670_10516466 | Not Available | 733 | Open in IMG/M |
| 3300005566|Ga0066693_10017860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2109 | Open in IMG/M |
| 3300005568|Ga0066703_10458427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 763 | Open in IMG/M |
| 3300005587|Ga0066654_10638704 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006844|Ga0075428_101855341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300006953|Ga0074063_14014870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 832 | Open in IMG/M |
| 3300007076|Ga0075435_101739379 | Not Available | 547 | Open in IMG/M |
| 3300009012|Ga0066710_102994668 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300009012|Ga0066710_103051915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
| 3300009792|Ga0126374_11345436 | Not Available | 579 | Open in IMG/M |
| 3300009837|Ga0105058_1019776 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300010043|Ga0126380_10073516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1950 | Open in IMG/M |
| 3300010333|Ga0134080_10299280 | Not Available | 721 | Open in IMG/M |
| 3300010362|Ga0126377_12568587 | Not Available | 585 | Open in IMG/M |
| 3300010375|Ga0105239_12410854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300010396|Ga0134126_11478519 | Not Available | 749 | Open in IMG/M |
| 3300010399|Ga0134127_12564154 | Not Available | 590 | Open in IMG/M |
| 3300011269|Ga0137392_10632056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 888 | Open in IMG/M |
| 3300012198|Ga0137364_10917778 | Not Available | 663 | Open in IMG/M |
| 3300012199|Ga0137383_10747713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
| 3300012205|Ga0137362_10480441 | Not Available | 1075 | Open in IMG/M |
| 3300012208|Ga0137376_10377230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1231 | Open in IMG/M |
| 3300012208|Ga0137376_11002264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 715 | Open in IMG/M |
| 3300012210|Ga0137378_10773631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 872 | Open in IMG/M |
| 3300012212|Ga0150985_114829067 | Not Available | 593 | Open in IMG/M |
| 3300012353|Ga0137367_10118437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1945 | Open in IMG/M |
| 3300012386|Ga0134046_1043243 | Not Available | 516 | Open in IMG/M |
| 3300012395|Ga0134044_1116532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
| 3300012497|Ga0157319_1038053 | Not Available | 551 | Open in IMG/M |
| 3300012582|Ga0137358_10463230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 855 | Open in IMG/M |
| 3300012917|Ga0137395_10209033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1361 | Open in IMG/M |
| 3300012924|Ga0137413_11805217 | Not Available | 505 | Open in IMG/M |
| 3300012927|Ga0137416_11817249 | Not Available | 557 | Open in IMG/M |
| 3300012944|Ga0137410_11395597 | Not Available | 608 | Open in IMG/M |
| 3300012948|Ga0126375_11920506 | Not Available | 520 | Open in IMG/M |
| 3300012958|Ga0164299_11436160 | Not Available | 535 | Open in IMG/M |
| 3300012961|Ga0164302_10173095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1298 | Open in IMG/M |
| 3300012961|Ga0164302_10302078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1046 | Open in IMG/M |
| 3300012975|Ga0134110_10583768 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012976|Ga0134076_10242325 | Not Available | 767 | Open in IMG/M |
| 3300012976|Ga0134076_10481680 | Not Available | 564 | Open in IMG/M |
| 3300012986|Ga0164304_11589423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300013307|Ga0157372_11554460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 762 | Open in IMG/M |
| 3300013308|Ga0157375_10416655 | Not Available | 1509 | Open in IMG/M |
| 3300013308|Ga0157375_10490148 | Not Available | 1394 | Open in IMG/M |
| 3300013501|Ga0120154_1138849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 550 | Open in IMG/M |
| 3300014168|Ga0181534_10387372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 771 | Open in IMG/M |
| 3300014654|Ga0181525_10746864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300014827|Ga0120171_1114182 | Not Available | 662 | Open in IMG/M |
| 3300015371|Ga0132258_10313352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 3864 | Open in IMG/M |
| 3300015371|Ga0132258_12800152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1215 | Open in IMG/M |
| 3300015372|Ga0132256_102639842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 602 | Open in IMG/M |
| 3300017936|Ga0187821_10493184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300017944|Ga0187786_10330013 | Not Available | 637 | Open in IMG/M |
| 3300017966|Ga0187776_10565664 | Not Available | 787 | Open in IMG/M |
| 3300017966|Ga0187776_11385358 | Not Available | 535 | Open in IMG/M |
| 3300018064|Ga0187773_11186458 | Not Available | 512 | Open in IMG/M |
| 3300018076|Ga0184609_10444538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
| 3300018433|Ga0066667_10581018 | Not Available | 932 | Open in IMG/M |
| 3300018468|Ga0066662_11456729 | Not Available | 711 | Open in IMG/M |
| 3300018468|Ga0066662_12376891 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300019279|Ga0184642_1668600 | Not Available | 1235 | Open in IMG/M |
| 3300019868|Ga0193720_1046415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
| 3300020012|Ga0193732_1046463 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300020016|Ga0193696_1090052 | Not Available | 792 | Open in IMG/M |
| 3300020022|Ga0193733_1125256 | Not Available | 708 | Open in IMG/M |
| 3300020022|Ga0193733_1184899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300020070|Ga0206356_10751975 | Not Available | 1353 | Open in IMG/M |
| 3300020080|Ga0206350_10239590 | Not Available | 722 | Open in IMG/M |
| 3300020082|Ga0206353_11957235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1964 | Open in IMG/M |
| 3300021363|Ga0193699_10234883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 763 | Open in IMG/M |
| 3300021418|Ga0193695_1084164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 689 | Open in IMG/M |
| 3300022756|Ga0222622_10401886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 965 | Open in IMG/M |
| 3300025544|Ga0208078_1118051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300025899|Ga0207642_10522614 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300025910|Ga0207684_11581576 | Not Available | 531 | Open in IMG/M |
| 3300025911|Ga0207654_10794862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 683 | Open in IMG/M |
| 3300025917|Ga0207660_10305497 | Not Available | 1267 | Open in IMG/M |
| 3300025919|Ga0207657_11490340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300025929|Ga0207664_10199376 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
| 3300025931|Ga0207644_10380022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1152 | Open in IMG/M |
| 3300025937|Ga0207669_11565732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300025942|Ga0207689_11325369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 604 | Open in IMG/M |
| 3300025986|Ga0207658_10607724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 983 | Open in IMG/M |
| 3300026041|Ga0207639_12174206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300026067|Ga0207678_11467783 | Not Available | 602 | Open in IMG/M |
| 3300026300|Ga0209027_1037183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1835 | Open in IMG/M |
| 3300026308|Ga0209265_1178541 | Not Available | 560 | Open in IMG/M |
| 3300026310|Ga0209239_1212923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
| 3300026528|Ga0209378_1122127 | Not Available | 1115 | Open in IMG/M |
| 3300026552|Ga0209577_10229684 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300026552|Ga0209577_10802143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300028563|Ga0265319_1082102 | Not Available | 1023 | Open in IMG/M |
| 3300028707|Ga0307291_1086646 | Not Available | 775 | Open in IMG/M |
| 3300028718|Ga0307307_10192540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300028782|Ga0307306_10229763 | Not Available | 538 | Open in IMG/M |
| 3300028787|Ga0307323_10347782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 531 | Open in IMG/M |
| 3300028811|Ga0307292_10321422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300028814|Ga0307302_10258475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 853 | Open in IMG/M |
| 3300028876|Ga0307286_10042295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1530 | Open in IMG/M |
| 3300028884|Ga0307308_10212323 | Not Available | 927 | Open in IMG/M |
| 3300030336|Ga0247826_10541122 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300030904|Ga0308198_1033838 | Not Available | 741 | Open in IMG/M |
| 3300030989|Ga0308196_1074436 | Not Available | 506 | Open in IMG/M |
| 3300031058|Ga0308189_10418629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300031099|Ga0308181_1068106 | Not Available | 713 | Open in IMG/M |
| 3300031226|Ga0307497_10307304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 729 | Open in IMG/M |
| 3300031239|Ga0265328_10079770 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300031240|Ga0265320_10300729 | Not Available | 709 | Open in IMG/M |
| 3300031344|Ga0265316_10169009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1632 | Open in IMG/M |
| 3300031421|Ga0308194_10123466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300031421|Ga0308194_10315704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300031712|Ga0265342_10560554 | Not Available | 579 | Open in IMG/M |
| 3300031753|Ga0307477_10980384 | Not Available | 555 | Open in IMG/M |
| 3300031938|Ga0308175_100777634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1045 | Open in IMG/M |
| 3300031943|Ga0310885_10173586 | Not Available | 1048 | Open in IMG/M |
| 3300032008|Ga0318562_10641182 | Not Available | 613 | Open in IMG/M |
| 3300032068|Ga0318553_10082232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1624 | Open in IMG/M |
| 3300032090|Ga0318518_10426977 | Not Available | 679 | Open in IMG/M |
| 3300032205|Ga0307472_102609267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300032261|Ga0306920_100479176 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
| 3300032782|Ga0335082_10102944 | All Organisms → cellular organisms → Bacteria | 2828 | Open in IMG/M |
| 3300032828|Ga0335080_10994913 | Not Available | 854 | Open in IMG/M |
| 3300032829|Ga0335070_10241154 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
| 3300033808|Ga0314867_097541 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300034268|Ga0372943_0286101 | Not Available | 1043 | Open in IMG/M |
| 3300034384|Ga0372946_0400836 | Not Available | 666 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.06% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.47% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 3.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.78% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.08% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.39% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.39% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.39% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.39% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.39% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.69% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.69% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.69% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.69% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.69% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.69% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A5_c1_00878910 | 2124908044 | Soil | VGLSNVLFGRKKLKEPARDRLFALTTAAVTLDVGCGL |
| deepsgr_02598970 | 2199352025 | Soil | LTRFGDILFGRKKLQGPAAEKLFALSTAAVTLDTACSLKTAGVGALIFKPLS |
| JGI11615J12901_114843591 | 3300000953 | Soil | VGLADILLGRKKLKGPAQDRLFALSTARVTLDTELGLQT |
| C688J18823_107008531 | 3300001686 | Soil | LGLRDVLFGRKSLAGPAGERLFALTTAAVTLQTELGLRTAG |
| JGIcombinedJ26739_1018292631 | 3300002245 | Forest Soil | VGLRDVLFGKKKLAGPARERLFALTTAAVTLDTELGLRTAGAGGVVFKPLSA |
| Ga0062593_1009168051 | 3300004114 | Soil | LGLRNVLFGRKSLAGPARERLFALTTAAVTLQTELGLRTAGAG |
| Ga0063356_1016464862 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VGLRDVLLGKKKLSAPARDRLFALTTAAVTLDTELGLRTAGVGGV |
| Ga0062595_1016387221 | 3300004479 | Soil | VGLRDVLLGKKKLSAPARDRLFALTTAAVTLDTELGLRTA |
| Ga0062595_1024495501 | 3300004479 | Soil | MGLRDALFGRKKLSEPRDDRLFALTTAAVTLEVELGLKTA |
| Ga0066388_1017169472 | 3300005332 | Tropical Forest Soil | VGLTDILFGRKKLKEASRERLFALTTAAVTLDVELGLKTAGAGALVV |
| Ga0070710_102036951 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LVLGLRDVLLGKKKLAGPARERLFALTTAAVTLDTELGLRTA |
| Ga0070741_114522412 | 3300005529 | Surface Soil | VGLRDVLLGRKKLAEPKEDKLFALTTAAVTLDTELQLKTAGIA |
| Ga0070735_106657452 | 3300005534 | Surface Soil | LGLGDVLFGRKKLKAPASERQFALCTSAVTLDTECSLEPAGV |
| Ga0070731_102852372 | 3300005538 | Surface Soil | MRIGDVLFGRKKLKEPTGERLFALTTAAVTLDTACGLKPAGK |
| Ga0070693_1010594002 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLRDVLFGRKKLSEPKEDKLFALATATVTLDTELNLKSAGV |
| Ga0066707_101258851 | 3300005556 | Soil | MGLADVLLGRKKLKSPAQDRLFALSTARVTLDTELGL |
| Ga0066700_107069151 | 3300005559 | Soil | MGLKDVLFGKKKLAGPARERLFALTTAAVTLDTELGLRTA |
| Ga0066670_105164661 | 3300005560 | Soil | MGLRDVLFGKKKLAGPAQERLFSLTTAAVTLDTELGLRSAGVGGVVFKPLSAGEF |
| Ga0066693_100178603 | 3300005566 | Soil | LGLRDVLLGRKKLAGPARERLFALTTAAVTLDTEL |
| Ga0066703_104584272 | 3300005568 | Soil | LGLRDVLFGRKQLKPPAEERLFALTTAAVTLETEV |
| Ga0066654_106387042 | 3300005587 | Soil | VGLADVLLGRKKLKGAAGDRLFALSTAAVTLDTELGLR |
| Ga0075428_1018553412 | 3300006844 | Populus Rhizosphere | VGLRDVLFGKKKLAAPARERLFALTTAAVTLDTELGLRTAGVGGVVFKPL |
| Ga0074063_140148701 | 3300006953 | Soil | LGLRDVLLGKKKLAAPARERLFALTTAAVTLDTELGLR |
| Ga0075435_1017393792 | 3300007076 | Populus Rhizosphere | MGLRDVLFGRKKLSEPKEDKLFALATATVTLDTELNLKSAGVAAV |
| Ga0066710_1029946681 | 3300009012 | Grasslands Soil | MSLRDVLFGRKKLAEPAAERLFALTTAAVTLETELNLRTAGAGA |
| Ga0066710_1030519151 | 3300009012 | Grasslands Soil | VGLRDVLLGKKKLAGPARERLFALTTAAVTLDTELG |
| Ga0126374_113454361 | 3300009792 | Tropical Forest Soil | LGLRDVLFGKKKLAEPREDRLFALTTAAVTMETEL |
| Ga0105058_10197761 | 3300009837 | Groundwater Sand | MGLRDVLFGKKKLAGPARDRLFALTTAAVTMETEL |
| Ga0126380_100735161 | 3300010043 | Tropical Forest Soil | VGLSNVLFGRKKLKDSAQERLFALSTARVTLDAELGLKSAGSGGIVFKPLSAG |
| Ga0134080_102992801 | 3300010333 | Grasslands Soil | LGLRDVLFGKKKLSSPAGERLFALTTAAVTLDTELGLRAAGVGGVVFKPLSAGEFVR |
| Ga0126377_125685871 | 3300010362 | Tropical Forest Soil | VGIRDVLFGRKKLSDPAADDRLFALTTATVTLETELALKPAGV |
| Ga0105239_124108543 | 3300010375 | Corn Rhizosphere | VGLRDILSGRKKLPGPKDDRLFALTTAAVTLQVDLGLKCAGAAAIT |
| Ga0134126_114785191 | 3300010396 | Terrestrial Soil | VGLADILLGRKKLKAPAQDRVFALSTARVTLDTELGLKTAGS |
| Ga0134127_125641541 | 3300010399 | Terrestrial Soil | VGFRDVLFGRKQLKAPAEERLFALTTAAITLETDV |
| Ga0137392_106320562 | 3300011269 | Vadose Zone Soil | VGLGNVLFGRKKLKGPARDRLFALTTAAVSLDVSCGLKPAGVGA |
| Ga0137364_109177782 | 3300012198 | Vadose Zone Soil | VGLRDILSGRAKLKEPAGERLFALTTAAVTLDVECGLKPSGAG |
| Ga0137383_107477131 | 3300012199 | Vadose Zone Soil | VGLRDVLFGKKKLAAPARERLFALTTAAVTLDTELGLRSAGDAGI |
| Ga0137362_104804411 | 3300012205 | Vadose Zone Soil | LGLRDVLFGRKKLAEPQDDRLFSLTTAAVTMETELGL |
| Ga0137376_103772301 | 3300012208 | Vadose Zone Soil | VGLRDVLLGKKKLSGPARERLFALTTAAVTLDTELGLRTAGAA |
| Ga0137376_110022642 | 3300012208 | Vadose Zone Soil | VGLRDVLFGKKKLAGPARERLFALTTAAVTLDTELGLRTAGDAGI |
| Ga0137378_107736312 | 3300012210 | Vadose Zone Soil | MGLRDVLLGKKKLAGPARERLFALTTAAVTLDTELGLRTAGAGG |
| Ga0150985_1148290671 | 3300012212 | Avena Fatua Rhizosphere | LGLRDVLLGKKKLAGPARERLFALTTAAVTLDTELGLRTAGAGGIC |
| Ga0137367_101184374 | 3300012353 | Vadose Zone Soil | VPFTDILFGRKKLKEPARDRLFALTTAAVTLNVECGLTPAGIGAVVLKPLS |
| Ga0134046_10432431 | 3300012386 | Grasslands Soil | LGLRDVLFGRKKLADPARERLFALTTAAVTLQTEL |
| Ga0134044_11165321 | 3300012395 | Grasslands Soil | VGLADILLGRKKLKGPAQDRLFALSTARVTLDTELGLQTAGSG |
| Ga0157319_10380531 | 3300012497 | Arabidopsis Rhizosphere | LGLRDVLFGRKKLAEPREDRLFGLTTAAVTLETEL |
| Ga0137358_104632301 | 3300012582 | Vadose Zone Soil | LGLGNVLFGRKKLKEPAGDRIFALTTAAVTLDVECGVKPAGAGAVI |
| Ga0137395_102090333 | 3300012917 | Vadose Zone Soil | VGLGNVLFGRKKLKEPAGDRIFALTTAAVTLDVECGVKPAG |
| Ga0137413_118052172 | 3300012924 | Vadose Zone Soil | VGLGDVLFGRKKLKEPAADRLFAITTAAVTLDVDCSLKPAGVG |
| Ga0137416_118172492 | 3300012927 | Vadose Zone Soil | LGLRDVLFGRKKLAEPKDDRLFSLPTAAITLQTELGLKSA |
| Ga0137410_113955971 | 3300012944 | Vadose Zone Soil | VGLGNVLFGRKKLKEPARDRLFALTTAAVTLDVDCGSKPAGV |
| Ga0126375_119205061 | 3300012948 | Tropical Forest Soil | VGLRDVLLGKKKLSAPSRERLFALTTAAVTLDTELG |
| Ga0164299_114361602 | 3300012958 | Soil | MFGRKKLAEPKEDQLFGLTTAAVTLETELGLKPAGVAA |
| Ga0164302_101730951 | 3300012961 | Soil | VGLRDALFGKQKLAGPARERLFALSTAAVTLDTELGLRPAGA |
| Ga0164302_103020782 | 3300012961 | Soil | LGLRDALFGKKKLSEPKDDRLFALTTAAVTLDVELGLKTAGVAALAFKP |
| Ga0134110_105837682 | 3300012975 | Grasslands Soil | LGLRDVLFGKKKLAGPARERLFALTTAAVTLDTELGLRTAGDAG |
| Ga0134076_102423251 | 3300012976 | Grasslands Soil | VGLRDVLFGKKKLSAPSAERLFALTTAAVTLDTELGLKTSGAGA |
| Ga0134076_104816802 | 3300012976 | Grasslands Soil | LGLRDVLFGRKQLAAPADERLFALSTARVTLDTELGLKSGGAAA |
| Ga0164304_115894231 | 3300012986 | Soil | VGLRDVLLGKKKLAGPARERLFALTTAAVTLDAELGLRSA |
| Ga0157372_115544601 | 3300013307 | Corn Rhizosphere | VGLRDILSGRKKLPGPKDDRLFALTTAAVTLQVELG |
| Ga0157375_104166551 | 3300013308 | Miscanthus Rhizosphere | LGLRDALFGKKKLSEPKDDRLFALTTAAVTLDVELGLKTAGVAALAFKPQ |
| Ga0157375_104901481 | 3300013308 | Miscanthus Rhizosphere | VGLRDALFGKQKLAGPARERLFALSTAAVTLDTELGLRS |
| Ga0120154_11388491 | 3300013501 | Permafrost | MGLRDILSGRAKLKEPAGDRLFALTTAAVSLDVECGLKPAGAG |
| Ga0181534_103873722 | 3300014168 | Bog | MGLRDIAFGRKKLPGPRDDRLFALATAAVTLETELGLTT |
| Ga0181525_107468641 | 3300014654 | Bog | MGLRDIAFGRKKLPGPRDDRLFALSTASVTLETEL |
| Ga0120171_11141822 | 3300014827 | Permafrost | VGLSNVLFGRKKLKEPARDRLFALTTAAVTLDIGCGLKPAGVGALVFK |
| Ga0132258_103133524 | 3300015371 | Arabidopsis Rhizosphere | VGIRDVLFGRKKLSDPAADDRLFALTTATVTLETELALKPAGVAAL |
| Ga0132258_128001521 | 3300015371 | Arabidopsis Rhizosphere | VGIRDVLFGRKKLSDPAADDRLFALTTATVTLETELALKPAGVA |
| Ga0132256_1026398422 | 3300015372 | Arabidopsis Rhizosphere | VGLGDVLFGRKKLKGPAGDRLFALTTAAVSLDLQCGLKPA |
| Ga0187821_104931842 | 3300017936 | Freshwater Sediment | MFGRKKLAEPKEDKVFALTTAAVTLQTELGLKTAGVAAV |
| Ga0187786_103300131 | 3300017944 | Tropical Peatland | VGLGDVLFGRKKLKEPAGDRLFALTTAAVTLDTGCG |
| Ga0187776_105656642 | 3300017966 | Tropical Peatland | LGLNDILFGRKKLRAPAGERLFALTTAAVTLDTECSLKAAGVG |
| Ga0187776_113853582 | 3300017966 | Tropical Peatland | LGLRDALFGKKKLSEPRDDRLFALTTAAVTLDTELNLTTAGKAAVTF |
| Ga0187773_111864582 | 3300018064 | Tropical Peatland | MGLRDALFGKKKLSEPRDDRLFALTTAAITLDTELGLKTAGK |
| Ga0184609_104445381 | 3300018076 | Groundwater Sediment | LGLRNVLFGKKKLAAPARDRLFALATAAVTLETELGLRTAGAGAIV |
| Ga0066667_105810181 | 3300018433 | Grasslands Soil | VGLRDILSGRAKLKEPAGERLFALTTAAVTLDVECGLKP |
| Ga0066662_114567291 | 3300018468 | Grasslands Soil | VGLRDVLSGRKKLPAPARERLFALTTAAVTLDTELGL |
| Ga0066662_123768912 | 3300018468 | Grasslands Soil | MGLRDILSGRKKLPPPAAERLFALTTAAITLQTDCNLKTAGVG |
| Ga0184642_16686002 | 3300019279 | Groundwater Sediment | LGLRNVLFGRKKLAAPARDRLFALATAAVTLDTELG |
| Ga0193720_10464153 | 3300019868 | Soil | VGLRDVLFGKKKLAGPARERLFALTTAAVTLDTEL |
| Ga0193732_10464631 | 3300020012 | Soil | VGLRDVLFGKKKLAGPARERLFALTTAAVTLDTELGLRSAGAAGVVF |
| Ga0193696_10900521 | 3300020016 | Soil | VGLRDALFGKQKLAGPARERLFALSTAAVTLDTELGLRPAG |
| Ga0193733_11252562 | 3300020022 | Soil | VGLRDVLLGKKKLAGPARERLFALTTAAVTLDTEL |
| Ga0193733_11848991 | 3300020022 | Soil | VGLRDALFGKQKLAGPARERLFALSTAAVTLDTELGLRSAGAGG |
| Ga0206356_107519751 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | LGLRDVLLGKKKLGEPREDRLFALTTAAVTLQIELG |
| Ga0206350_102395901 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | VGLRDILPGRKKRPGPKDDRLFALTTASVTLDTELGLKT |
| Ga0206353_119572351 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | LGLTDVLFGRKKLKGPARDRLFALTTAAVTLDVECGLKPAGA |
| Ga0193699_102348832 | 3300021363 | Soil | VGLRDVLLGKKKLAGPARERLFALTTAAVTLDTELGLR |
| Ga0193695_10841641 | 3300021418 | Soil | VGLRDVLLGTKKLAGPARERLFALTTAAVTLDTELGLRSAGAG |
| Ga0222622_104018861 | 3300022756 | Groundwater Sediment | VGLRDVLLGKKKLSGPARDRLFALTTAAVTLDTELGLRTA |
| Ga0208078_11180512 | 3300025544 | Arctic Peat Soil | VALRDVLFGRKKLSEPSDDRLFALTTAAVTLQAELGLIT |
| Ga0207642_105226142 | 3300025899 | Miscanthus Rhizosphere | VGLADILLGRKKLKGPAQDRLFALSTARVTLDTELGLETAGSG |
| Ga0207684_115815761 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLTNVLFGRKKLKEPADDRLFALTTAAVTLQTDCNLK |
| Ga0207654_107948621 | 3300025911 | Corn Rhizosphere | VGLGDVLFGRKKLKGPARDRLFALTTAAVSLDVECGLKPAGV |
| Ga0207660_103054973 | 3300025917 | Corn Rhizosphere | VGLRDILSGRKKLPGPKDDRLFALTTAAVTLQVELGLKCAGAAAITFK |
| Ga0207657_114903401 | 3300025919 | Corn Rhizosphere | VGLRDILSGRKKLPGPKDDRLFALTTAAVPLQVELGLTCAGAA |
| Ga0207664_101993761 | 3300025929 | Agricultural Soil | LKFGDVLFGRKKLKEPAGERLFALTTAAVTLDTSCGLRPAGKGAVIFKP |
| Ga0207644_103800221 | 3300025931 | Switchgrass Rhizosphere | LGLRDVLLGKKKLAAPARERLFALTTAAVTLDTELGLRTAGAAGIVFK |
| Ga0207669_115657321 | 3300025937 | Miscanthus Rhizosphere | VGLRDVLLGKKKLAGPARDRLFALTTAAVTLDVELGLRP |
| Ga0207689_113253691 | 3300025942 | Miscanthus Rhizosphere | MGFRDVLFGRKKLAEPRDDRLFALTTAQVTLDDELKLRP |
| Ga0207658_106077241 | 3300025986 | Switchgrass Rhizosphere | VGLRDALFGKQKLAGPARERLFALSTAAVTLDTELGLRSAG |
| Ga0207639_121742062 | 3300026041 | Corn Rhizosphere | LGLTDVLFGRKKLKGPARDRLFALTTAAVTLNVECGLKP |
| Ga0207678_114677832 | 3300026067 | Corn Rhizosphere | MGLRDVLFGRKKLPGPKEDRLFALSTAAVTLQTECG |
| Ga0209027_10371834 | 3300026300 | Grasslands Soil | MGLTDILFGRKKLKEPAGERLFALTTAAVTLDVQCGLKTAG |
| Ga0209265_11785412 | 3300026308 | Soil | VGLADVLLGRKKLKGAAGDRLFALSTAAVTLDTELGLRTAG |
| Ga0209239_12129231 | 3300026310 | Grasslands Soil | VGLRDVLFGKKKLAGPARERLFALTTAAVTLDTELGLRS |
| Ga0209378_11221272 | 3300026528 | Soil | MGLADVLLGRKKLKSPAQDRLFALSTARVTLDTELGLKTAGA |
| Ga0209577_102296841 | 3300026552 | Soil | VGLKDVLFGRKQLKAPAEERLFALTTAAITLETDVGLKFAGAGAIVY |
| Ga0209577_108021431 | 3300026552 | Soil | VGLRDVLFGRKQLKAPAEERLFALTTAAITLETDVGLKFAGAGGIVY |
| Ga0265319_10821021 | 3300028563 | Rhizosphere | VGLTDILFGRKKLKEPAADRLFAITTAAVTLDVECGLKPA |
| Ga0307291_10866461 | 3300028707 | Soil | LGLRNVLFGKKKLAAPARDRLFALATAAVTLDTELGLRTAGSGA |
| Ga0307307_101925401 | 3300028718 | Soil | VGLRDTLFGRKKLKEPAGDRLFALTTAAVTLNIECGLKPAGVGA |
| Ga0307306_102297631 | 3300028782 | Soil | VGLRDVLFGKKKLAGPARERLFALTTAAVTLDTELGLR |
| Ga0307323_103477821 | 3300028787 | Soil | VGLSDVLFGRKKLKGPARDRLFALTTAAVSLDMECGLKPAGVGA |
| Ga0307292_103214221 | 3300028811 | Soil | VGLRDVLFGKKKLAGPARERLFALTTAAVTLDTELGLRSAGAA |
| Ga0307302_102584752 | 3300028814 | Soil | LGLRNVLFGKKKLAAPARDRLFALATAAVTLDTELGLRTAGAGA |
| Ga0307286_100422951 | 3300028876 | Soil | VGLADILLGRKKLKGPAQDRLFALSTARVTLDTELGLQ |
| Ga0307308_102123231 | 3300028884 | Soil | LGLRNVLFGKKKLAAPARDRLFALATAAVTLETELGLR |
| Ga0247826_105411222 | 3300030336 | Soil | VGLADILLGRKKLKGPAQDRLFALSTARVTLDTELGLETAGSGG |
| Ga0308198_10338381 | 3300030904 | Soil | VGLADILLGRKKLKGPAQDRLFALSTARVTLDTELGLQTA |
| Ga0308196_10744361 | 3300030989 | Soil | VGLRDALFGKKKLAEPARERLFALTTAAVTLDTEL |
| Ga0308189_104186292 | 3300031058 | Soil | VGLRDVLLGKKKLAGPARERLFALTTAAVTLDTELGLRSAGAGGV |
| Ga0308181_10681061 | 3300031099 | Soil | VGLRDALFGKQKLAGPARERLFALTTAAVTLDTEL |
| Ga0307497_103073042 | 3300031226 | Soil | VGLGDVLFGRRKLKEPARDRLFALTTAAVTLDVELGL |
| Ga0265328_100797703 | 3300031239 | Rhizosphere | LGLGDILFGRKKLKTPAGERLFALTTAAVTLDTECSLKPAGV |
| Ga0265320_103007292 | 3300031240 | Rhizosphere | VGLTDVLFGRKKLKEPAGDRLFALTTAAVTLDTGC |
| Ga0265316_101690091 | 3300031344 | Rhizosphere | LGLGDVLFGRKKLKSPAGERLFALTTAAVTLDTECSLKPAG |
| Ga0308194_101234661 | 3300031421 | Soil | VGLRDVLLGKKKLAGPARERLFALTTAAVTLDTELGLRTGGAAGVVFKP |
| Ga0308194_103157041 | 3300031421 | Soil | VGLRDVLFGRKQLKAPAEERLFALTTAAITLEADVGLKFGGAGAIV |
| Ga0265342_105605542 | 3300031712 | Rhizosphere | VGIGDVLFGRKKLKEPAADRLFALTTAAVTLDTECG |
| Ga0307477_109803842 | 3300031753 | Hardwood Forest Soil | LGLGDVLFGRKKLKAPASERLFALCTSAVTLDTECSLQTDGVGAVI |
| Ga0308175_1007776343 | 3300031938 | Soil | VGLGDVLFGRKKLKGPAGDRLFALTTAAVSLDISC |
| Ga0310885_101735862 | 3300031943 | Soil | VGFLDVLFGRKRLPEARRDDLFALATAAVTLEVEL |
| Ga0318562_106411822 | 3300032008 | Soil | MGLRDVLFGRKKLAEPKADQLFALTTAAVTLDTELNLKTAGVAAVA |
| Ga0318553_100822321 | 3300032068 | Soil | MGLRDVLFGRKKLAEPKADQLFALTTAAVTLDTELNLK |
| Ga0318518_104269772 | 3300032090 | Soil | VGIRDVLFGRKKLAEPREDRLFGLTTAAVTLDTDLGLKTAGV |
| Ga0307472_1026092672 | 3300032205 | Hardwood Forest Soil | VGLRDVLFGKKKLAGPARERLFALTTAAVTLDTGLGLR |
| Ga0306920_1004791763 | 3300032261 | Soil | LGLRDALFGRKKLSEPRDDRLFALATAAGTLATELNRTTAGQAAGTFKPRT |
| Ga0335082_101029441 | 3300032782 | Soil | MGLRDALLGKKKLSEPREDRLFALTTAAVTLKVELGLTTAGVGAI |
| Ga0335080_109949131 | 3300032828 | Soil | VPLGDIFFGRKKLKEPADDRLFALTTAAVTLDVECGLKPAGVGA |
| Ga0335070_102411541 | 3300032829 | Soil | VPFTDVFFGRKKLKEPAGDRLFALTTAAVTLDVECGLKPA |
| Ga0314867_097541_1_120 | 3300033808 | Peatland | VGLTDVLFGRKKLKEPAGDRLFALTTAAVTLDTGCGLKPA |
| Ga0372943_0286101_900_1043 | 3300034268 | Soil | VGLRDILSGRKKLPGPKDDRLFALTTAAVTLDVELGLKTAGVGAITFK |
| Ga0372946_0400836_545_664 | 3300034384 | Soil | LGIRDALFGKKKLSEPKTDALFALATAAVTLDTELGLKTA |
| ⦗Top⦘ |