Basic Information | |
---|---|
Family ID | F050962 |
Family Type | Metagenome |
Number of Sequences | 144 |
Average Sequence Length | 43 residues |
Representative Sequence | ASEPASDRTAIESALESLDALTAELGSDPYRRIAALERARLAT |
Number of Associated Samples | 126 |
Number of Associated Scaffolds | 144 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.61 % |
% of genes from short scaffolds (< 2000 bps) | 93.75 % |
Associated GOLD sequencing projects | 124 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.71 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.028 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.500 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.611 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.222 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.70% β-sheet: 0.00% Coil/Unstructured: 49.30% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.71 |
Powered by PDBe Molstar |
SCOP family | SCOP domain | Representative PDB | TM-score |
---|---|---|---|
a.7.12.1: PhoU-like | d1vcta1 | 1vct | 0.83284 |
a.24.19.0: automated matches | d5mawe_ | 5maw | 0.81906 |
a.24.19.0: automated matches | d3iqca_ | 3iqc | 0.80843 |
a.4.5.61: PadR-like | d1yg2a_ | 1yg2 | 0.80678 |
a.7.12.1: PhoU-like | d1sumb_ | 1sum | 0.80614 |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 144 Family Scaffolds |
---|---|---|
PF03795 | YCII | 69.44 |
PF00496 | SBP_bac_5 | 6.25 |
PF01738 | DLH | 2.08 |
PF08031 | BBE | 1.39 |
PF00313 | CSD | 1.39 |
PF05988 | DUF899 | 1.39 |
PF16694 | Cytochrome_P460 | 1.39 |
PF02913 | FAD-oxidase_C | 0.69 |
PF06779 | MFS_4 | 0.69 |
PF05626 | DUF790 | 0.69 |
PF02310 | B12-binding | 0.69 |
PF14535 | AMP-binding_C_2 | 0.69 |
PF01591 | 6PF2K | 0.69 |
PF02780 | Transketolase_C | 0.69 |
PF13581 | HATPase_c_2 | 0.69 |
PF07992 | Pyr_redox_2 | 0.69 |
PF00118 | Cpn60_TCP1 | 0.69 |
PF01243 | Putative_PNPOx | 0.69 |
PF01041 | DegT_DnrJ_EryC1 | 0.69 |
PF08281 | Sigma70_r4_2 | 0.69 |
PF01979 | Amidohydro_1 | 0.69 |
PF00072 | Response_reg | 0.69 |
PF01925 | TauE | 0.69 |
COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
---|---|---|---|
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 69.44 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 2.08 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 1.39 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.69 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.69 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.69 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.69 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.69 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.03 % |
Unclassified | root | N/A | 15.97 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002908|JGI25382J43887_10465292 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300004156|Ga0062589_101441876 | Not Available | 674 | Open in IMG/M |
3300004267|Ga0066396_10115858 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300004463|Ga0063356_103602587 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300004463|Ga0063356_104445179 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300005171|Ga0066677_10411759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 772 | Open in IMG/M |
3300005171|Ga0066677_10445201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
3300005171|Ga0066677_10737800 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005174|Ga0066680_10670415 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300005180|Ga0066685_10685537 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300005295|Ga0065707_10497754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 749 | Open in IMG/M |
3300005332|Ga0066388_100757840 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1569 | Open in IMG/M |
3300005332|Ga0066388_103080287 | Not Available | 852 | Open in IMG/M |
3300005347|Ga0070668_101300793 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300005439|Ga0070711_100244706 | Not Available | 1404 | Open in IMG/M |
3300005451|Ga0066681_10365800 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 886 | Open in IMG/M |
3300005471|Ga0070698_102042928 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300005554|Ga0066661_10813577 | Not Available | 546 | Open in IMG/M |
3300005557|Ga0066704_10630859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 684 | Open in IMG/M |
3300005558|Ga0066698_10633782 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300005574|Ga0066694_10522021 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300005616|Ga0068852_100464466 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
3300005713|Ga0066905_100095928 | All Organisms → cellular organisms → Bacteria | 1999 | Open in IMG/M |
3300005713|Ga0066905_102073054 | Not Available | 529 | Open in IMG/M |
3300005718|Ga0068866_11247788 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300005764|Ga0066903_103423411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 856 | Open in IMG/M |
3300005764|Ga0066903_103693178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
3300005843|Ga0068860_100427278 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
3300005844|Ga0068862_102791818 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300005937|Ga0081455_10410473 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
3300006852|Ga0075433_10307389 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
3300006876|Ga0079217_11449712 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300006914|Ga0075436_101336484 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300006969|Ga0075419_10107991 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
3300009090|Ga0099827_11461976 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300009094|Ga0111539_13240922 | Not Available | 524 | Open in IMG/M |
3300009137|Ga0066709_101091711 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
3300009147|Ga0114129_13119314 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300009553|Ga0105249_10379182 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
3300010043|Ga0126380_11459596 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300010047|Ga0126382_11257834 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300010048|Ga0126373_11093949 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
3300010303|Ga0134082_10479216 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300010323|Ga0134086_10240862 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300010333|Ga0134080_10606205 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300010335|Ga0134063_10356983 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300010336|Ga0134071_10039353 | All Organisms → cellular organisms → Bacteria | 2103 | Open in IMG/M |
3300010358|Ga0126370_11735430 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300010360|Ga0126372_10059143 | All Organisms → cellular organisms → Bacteria | 2653 | Open in IMG/M |
3300010361|Ga0126378_11243718 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300010366|Ga0126379_10286760 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
3300010366|Ga0126379_12877200 | Not Available | 576 | Open in IMG/M |
3300010398|Ga0126383_10166243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2078 | Open in IMG/M |
3300010398|Ga0126383_13228732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 532 | Open in IMG/M |
3300012189|Ga0137388_11097189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
3300012199|Ga0137383_10180915 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
3300012202|Ga0137363_10397477 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300012202|Ga0137363_11208698 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300012203|Ga0137399_11260663 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300012511|Ga0157332_1055776 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300012582|Ga0137358_10859083 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300012685|Ga0137397_10178192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1578 | Open in IMG/M |
3300012685|Ga0137397_10801142 | Not Available | 699 | Open in IMG/M |
3300012906|Ga0157295_10089427 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300012918|Ga0137396_11073007 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300012922|Ga0137394_10745738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 823 | Open in IMG/M |
3300012923|Ga0137359_11234344 | Not Available | 635 | Open in IMG/M |
3300012929|Ga0137404_10574250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1012 | Open in IMG/M |
3300012929|Ga0137404_10881328 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 815 | Open in IMG/M |
3300012930|Ga0137407_10060906 | All Organisms → cellular organisms → Bacteria | 3105 | Open in IMG/M |
3300012944|Ga0137410_10139170 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1839 | Open in IMG/M |
3300012948|Ga0126375_11744449 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300014154|Ga0134075_10104963 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
3300015077|Ga0173483_10457728 | Not Available | 670 | Open in IMG/M |
3300015264|Ga0137403_10457793 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1150 | Open in IMG/M |
3300015356|Ga0134073_10059028 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300015357|Ga0134072_10319025 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300015359|Ga0134085_10355604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
3300015372|Ga0132256_103675774 | Not Available | 516 | Open in IMG/M |
3300015372|Ga0132256_103709199 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300015374|Ga0132255_100866723 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
3300015374|Ga0132255_103339427 | Not Available | 684 | Open in IMG/M |
3300016404|Ga0182037_11538500 | Not Available | 591 | Open in IMG/M |
3300017656|Ga0134112_10353405 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300017939|Ga0187775_10007993 | All Organisms → cellular organisms → Bacteria | 2626 | Open in IMG/M |
3300017994|Ga0187822_10124389 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300018431|Ga0066655_10103544 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
3300018431|Ga0066655_10349985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 969 | Open in IMG/M |
3300018482|Ga0066669_11883887 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300019458|Ga0187892_10468403 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300019890|Ga0193728_1172520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 932 | Open in IMG/M |
3300020012|Ga0193732_1087145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
3300025917|Ga0207660_10337385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1206 | Open in IMG/M |
3300025931|Ga0207644_10098928 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2188 | Open in IMG/M |
3300026023|Ga0207677_10581125 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300026095|Ga0207676_11610399 | Not Available | 647 | Open in IMG/M |
3300026142|Ga0207698_10192324 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1819 | Open in IMG/M |
3300026297|Ga0209237_1057672 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1905 | Open in IMG/M |
3300026301|Ga0209238_1115091 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300026310|Ga0209239_1170810 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300026312|Ga0209153_1311200 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300026326|Ga0209801_1235671 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300026326|Ga0209801_1266514 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300026330|Ga0209473_1141970 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300026334|Ga0209377_1079326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1397 | Open in IMG/M |
3300026361|Ga0257176_1004949 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
3300026481|Ga0257155_1011474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1193 | Open in IMG/M |
3300026528|Ga0209378_1116170 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
3300026547|Ga0209156_10332252 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300027068|Ga0209898_1057458 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300027846|Ga0209180_10252483 | Not Available | 1015 | Open in IMG/M |
3300027873|Ga0209814_10100510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1226 | Open in IMG/M |
3300027874|Ga0209465_10312008 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300027876|Ga0209974_10027511 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
3300028596|Ga0247821_10605698 | Not Available | 707 | Open in IMG/M |
3300028608|Ga0247819_10687185 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300028792|Ga0307504_10079577 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300028792|Ga0307504_10409220 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300028807|Ga0307305_10293801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
3300031543|Ga0318516_10782142 | Not Available | 539 | Open in IMG/M |
3300031547|Ga0310887_11030715 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300031562|Ga0310886_10212812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1061 | Open in IMG/M |
3300031740|Ga0307468_101818513 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300031754|Ga0307475_10982378 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300031768|Ga0318509_10073972 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
3300031770|Ga0318521_10157733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1292 | Open in IMG/M |
3300031777|Ga0318543_10509419 | Not Available | 539 | Open in IMG/M |
3300031779|Ga0318566_10049596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1991 | Open in IMG/M |
3300031782|Ga0318552_10056306 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
3300031794|Ga0318503_10317426 | Not Available | 506 | Open in IMG/M |
3300031798|Ga0318523_10146051 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300031820|Ga0307473_10129443 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
3300031835|Ga0318517_10022929 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2429 | Open in IMG/M |
3300031897|Ga0318520_10948581 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300031908|Ga0310900_10634401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 848 | Open in IMG/M |
3300031959|Ga0318530_10211437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
3300031981|Ga0318531_10486187 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300032013|Ga0310906_10990971 | Not Available | 603 | Open in IMG/M |
3300032060|Ga0318505_10342377 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300032180|Ga0307471_101174926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 932 | Open in IMG/M |
3300032180|Ga0307471_103520972 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300033550|Ga0247829_11019250 | Not Available | 688 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.72% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.64% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.94% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.86% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.86% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.47% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.08% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.08% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.08% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.39% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.39% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.39% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.39% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.39% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.39% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.69% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.69% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.69% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.69% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.69% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027068 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25382J43887_104652922 | 3300002908 | Grasslands Soil | TAIESALESVEALATELGADPYRRMAELERARLAETVTS* |
Ga0062589_1014418761 | 3300004156 | Soil | RLRLLAAEPGSRRATIESALEALETLSAELGSEPYRRIAALERARLAP* |
Ga0066396_101158582 | 3300004267 | Tropical Forest Soil | LLAAELPVDRAALARALESLDGLTAELGSDAYRRIAALER* |
Ga0063356_1036025871 | 3300004463 | Arabidopsis Thaliana Rhizosphere | EPAPNRIATESALASVDALTAELDSDPYRRIAALVRGRLTT* |
Ga0063356_1044451791 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LLASEPAFDRTEGEHALESLDAVTAELGSDPYRRIAALERARLAR* |
Ga0066677_104117593 | 3300005171 | Soil | LLASEPASERAAIDSALGSLDAVTAELGSDPYRRIAALERARLAT* |
Ga0066677_104452011 | 3300005171 | Soil | EPASDRTAIESALESVDAITAELGSDPYRRIAALERARLA* |
Ga0066677_107378001 | 3300005171 | Soil | EPASDRTAIESALESVDAITAELGSDPYRRIAALERARLAT* |
Ga0066680_106704151 | 3300005174 | Soil | ASEPASDRTAIESALESLDALTAELGSDPYRRIAALERARLAT* |
Ga0066685_106855371 | 3300005180 | Soil | EPASDRTAIESALESLDALAAELGSVPYRRLAALERARLAT* |
Ga0065707_104977543 | 3300005295 | Switchgrass Rhizosphere | LASEPGSDRTAIDSALGSLDALTAELGSDPYRRIAALERARLAT* |
Ga0066388_1007578401 | 3300005332 | Tropical Forest Soil | ASAHLVAAEPTSDRAAIESALGSLDAVTAELGSDPYRRIAALERARLIT* |
Ga0066388_1030802872 | 3300005332 | Tropical Forest Soil | TLAWVRLLASEPASDRAAIESALESLDRVTAELGSDPYQRIAALERARPAT* |
Ga0070668_1013007932 | 3300005347 | Switchgrass Rhizosphere | ASDRTAIESALESLDALTAELGSDPYRRIAALERARLAP* |
Ga0070711_1002447061 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDRTAIESALDSVEALAAKLGADPYRRMAELERARLAQ* |
Ga0066681_103658001 | 3300005451 | Soil | PAFDRTAIASALESVDALTAELGSDPYRRIAALERARLA* |
Ga0070698_1020429281 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | SEPASDRTAIESALESLDALTAELGSDPYRRIAGLERARFATQPGTRS* |
Ga0066661_108135771 | 3300005554 | Soil | VRLLTAEPAADRAAIESALESLDALTAELGSVLYGRIAALERARLAT* |
Ga0066704_106308591 | 3300005557 | Soil | RTAIESALESLDALTAELGSDPYRRIAALERARLAT* |
Ga0066698_106337822 | 3300005558 | Soil | SDRRAIESALASVDALTAELGSDPYRRIAALERARLA* |
Ga0066694_105220212 | 3300005574 | Soil | TAIESALESLDALTAELGSDPYRRIAALERARLAT* |
Ga0068852_1004644664 | 3300005616 | Corn Rhizosphere | SRRATIESALEALETLSAELGSEPYRRIAALERARLAP* |
Ga0066905_1000959281 | 3300005713 | Tropical Forest Soil | PDRDALEGALSSLEALAAELDADPYRRMAALERARLAQAPSVARP* |
Ga0066905_1020730542 | 3300005713 | Tropical Forest Soil | SEPGSDRAVVEGALGDLDALAAELGSEPYRHVAARERARLTP* |
Ga0068866_112477883 | 3300005718 | Miscanthus Rhizosphere | SDRTAIESALESLDALTAELGSGPYRRIAALERARLAP* |
Ga0066903_1034234113 | 3300005764 | Tropical Forest Soil | LVASEKAADRTAMESALESLDALSTELGSDPYRRIAASERARLAP* |
Ga0066903_1036931783 | 3300005764 | Tropical Forest Soil | RLLASEPASDRAAVEGALGSLDALTAELGSDPYRRIATLERARLAT* |
Ga0068860_1004272782 | 3300005843 | Switchgrass Rhizosphere | HLLTSEPMADRNAIETALESLDAITAELDSAPYRRIAAFERARLHT* |
Ga0068862_1027918181 | 3300005844 | Switchgrass Rhizosphere | SDRTAIESALKSLDALTADLGSVPYRRIAALERLRLGA* |
Ga0081455_104104731 | 3300005937 | Tabebuia Heterophylla Rhizosphere | ASEPASDRSVIETALESLDALAAELGSDPYRRLAALERARLGTSP* |
Ga0075433_103073894 | 3300006852 | Populus Rhizosphere | RTAIESALESLDALTAELGSVPYRRIAALERARLAA* |
Ga0075425_1028525351 | 3300006854 | Populus Rhizosphere | IESALESVEALATELGAAPYRRMAELERARLAETSANPR* |
Ga0079217_114497121 | 3300006876 | Agricultural Soil | TAIESALESVDALTAELGSDPYRRLAALERARLAT* |
Ga0075436_1013364841 | 3300006914 | Populus Rhizosphere | ASDRTAIESALESVDALTAELGSAPYRRLAAAERARLAS* |
Ga0075419_101079913 | 3300006969 | Populus Rhizosphere | AIAAALTSLDALAAELGSDPYRRIAALERARLAP* |
Ga0099827_114619761 | 3300009090 | Vadose Zone Soil | LLASEPASDRTAIESALESLDALTAELGSDPYRRIAALERARLTT* |
Ga0111539_132409222 | 3300009094 | Populus Rhizosphere | ASEPASGRTATQRALEAMDAITAELGSDPYRRIAALERARLAAP* |
Ga0066709_1010917111 | 3300009137 | Grasslands Soil | RTAIESALESVEALATELGADPYRRMAELERARLAETVTS* |
Ga0114129_131193142 | 3300009147 | Populus Rhizosphere | GIRLLASEPAADRTAISRALESLDALAAELGSDPYRRTAALERARLVR* |
Ga0105249_103791823 | 3300009553 | Switchgrass Rhizosphere | LASEPASDRTAIESALDSLDALTAELGSDPYRRIAALERARLAT* |
Ga0126380_114595962 | 3300010043 | Tropical Forest Soil | ASEPASDRTAIERALDSLDALTAELGSDPYRRIAAFERTRIAT* |
Ga0126382_112578342 | 3300010047 | Tropical Forest Soil | LLASEPASDRAAIESALESLETVTAELGSEPYRRIAALERTRIAP* |
Ga0126373_110939492 | 3300010048 | Tropical Forest Soil | LASEPAPDRALIGSALDSVDALTAELGSDPYRRMAALERARLAT* |
Ga0134082_104792161 | 3300010303 | Grasslands Soil | DRTAIESALESVDALTAELGSAPYRRIAALERARLA* |
Ga0134086_102408623 | 3300010323 | Grasslands Soil | ASEPASDRNAIESALESLDALTAELGSDPYRRIAALERARLADFRA* |
Ga0134080_106062052 | 3300010333 | Grasslands Soil | DRTAIESALESVDALTAELGSDPYRRIAAFERARLATSPFNLP* |
Ga0134063_103569831 | 3300010335 | Grasslands Soil | TAIESALESLDALTAELGSDPYRRIAALERARLADFRA* |
Ga0134071_100393534 | 3300010336 | Grasslands Soil | LASEPASDGTAIESALESLDALTAELGSDPYRRIAAREHARLGT* |
Ga0126370_117354301 | 3300010358 | Tropical Forest Soil | DVARASVRLLAAELPVDRTALARALESLDGLTAELGSDAYRRIAALER* |
Ga0126372_100591431 | 3300010360 | Tropical Forest Soil | DPGAIESALRSLDALTAELGSDAYRRIATLERTRLAT* |
Ga0126378_112437182 | 3300010361 | Tropical Forest Soil | LLAAELPVDRTALAQALESLDGLTAELGSVAYRRIAALEH* |
Ga0126379_102867603 | 3300010366 | Tropical Forest Soil | ASDRTAIESALASLDVLTAELSSVPYRRIAALERARLAT* |
Ga0126379_128772002 | 3300010366 | Tropical Forest Soil | VHLLTSEAVSDRTAIATALESLDAVTAELDSVPYRCIAALERARLHT* |
Ga0126383_101662431 | 3300010398 | Tropical Forest Soil | AEPASDRTAIESALESLDVLTAELGSVPYRRIAALERARLAT* |
Ga0126383_132287321 | 3300010398 | Tropical Forest Soil | LLASETAPDRAAVESALESLDALVAEMDTDHYRRLAELERARLAKTFSTRR* |
Ga0137388_110971893 | 3300012189 | Vadose Zone Soil | DRTAIETALESVDALTAELGSDPYRRIAAVERARLAT* |
Ga0137383_101809151 | 3300012199 | Vadose Zone Soil | DRTAIESALESLDALTAELGSDPYRRIAALQRARLAT* |
Ga0137363_103974771 | 3300012202 | Vadose Zone Soil | RASDHIAIESALESLDALTAELGSDPYRRIVALERARLAT* |
Ga0137363_112086983 | 3300012202 | Vadose Zone Soil | AWVRLLASEPASDRTAIESALESVDALTAELGSDPYRRIAALERARLAT* |
Ga0137399_112606631 | 3300012203 | Vadose Zone Soil | HTAIESALESLDALTAELGSVPYRRIAALERARLAT* |
Ga0157332_10557762 | 3300012511 | Soil | WVRLLASEPASDRAAIESALDSLDALTAELGSDPYRRIAALERARLAT* |
Ga0137358_108590832 | 3300012582 | Vadose Zone Soil | ASEPVPDRTAIESALESVEALATELGADPYRRSAARERARLAT* |
Ga0137397_101781921 | 3300012685 | Vadose Zone Soil | SDRTAIESALESLDALTAELGSDPYRRIAALERARLAT* |
Ga0137397_108011422 | 3300012685 | Vadose Zone Soil | SEPASDRTAIESALESLDALTAELGSDPYRRIAAAERARVGT* |
Ga0157295_100894273 | 3300012906 | Soil | LAGVHLLEESAADRAEIERALASLDALAAELGSAPYRAIAARERARLVT* |
Ga0137396_110730072 | 3300012918 | Vadose Zone Soil | LAWVRLLAAEPASDRAAIQSALESLDALTAELGSVPYRRIAALERARLAT* |
Ga0137394_107457383 | 3300012922 | Vadose Zone Soil | GSDRTAIESALKSLDALTADLGSVPYRRIAALERARLGT* |
Ga0137359_112343441 | 3300012923 | Vadose Zone Soil | DRTAIESAFESLDALTAELGSDPYRRIAALERARLGR* |
Ga0137404_105742501 | 3300012929 | Vadose Zone Soil | LASEPASDRTAVESALESLDALTAELGSDPYRRMAALERARLAGPL* |
Ga0137404_108813281 | 3300012929 | Vadose Zone Soil | LLASEPASDRTAIESALESLDALTAELGSDPYRRIAALERARLAT* |
Ga0137407_100609061 | 3300012930 | Vadose Zone Soil | PDRTAIESALESVEALATELGADPYRRSAARERARLAT* |
Ga0137410_101391703 | 3300012944 | Vadose Zone Soil | VRLLASEPASDRLAIESALESMDALAAELGSVPYRRIAALTRARLAT* |
Ga0126375_117444492 | 3300012948 | Tropical Forest Soil | VRLLASEPASDRAAVEGALGSLDALTAELGSDPYRRIATLERARLAT* |
Ga0134075_101049631 | 3300014154 | Grasslands Soil | AIESALESLDALTAELGSDPYRRIAALQRARLAT* |
Ga0173483_104577282 | 3300015077 | Soil | DVALAGVRLLGEAAADTAEIERALEALDALAAELGSAPYRAIAARERARLVT* |
Ga0137403_104577931 | 3300015264 | Vadose Zone Soil | LAWVRLLASEPSSDRTAVESALQSLDALTAELGSDPFRRIAALERARLAP* |
Ga0134073_100590284 | 3300015356 | Grasslands Soil | VRLLASEPASDRTAIESALESLDALTAELGSDPYRRIAALERARLANFRA* |
Ga0134072_103190251 | 3300015357 | Grasslands Soil | SDRTAIESALESLDALTAELGSDPYRRIAALERARLADFRA* |
Ga0134085_103556041 | 3300015359 | Grasslands Soil | RLLASAPASDRAAIESALGSLDAVTAELGSDPYRRIAALERARLAT* |
Ga0132256_1036757742 | 3300015372 | Arabidopsis Rhizosphere | AWARFLASEPAPDRTEITAALDSLDGVAAELGSDPYRRIAALERSRIAA* |
Ga0132256_1037091992 | 3300015372 | Arabidopsis Rhizosphere | SEPVPERAEVERALESVDAVVAELGSDPYRRLAALERARLGI* |
Ga0132255_1008667235 | 3300015374 | Arabidopsis Rhizosphere | ATIESALEALETLSAELGSEPYRRIAALERARLAP* |
Ga0132255_1033394272 | 3300015374 | Arabidopsis Rhizosphere | WARFLASEPAPDRTEITAALDSLDGVAAELGSDPYRRIAALERSRIAA* |
Ga0182037_115385001 | 3300016404 | Soil | ALAWVRLLTSEPASDRTAIERALASLDAVTAELGSEPYRRMAALERARVVQ |
Ga0134112_103534053 | 3300017656 | Grasslands Soil | ASEPASDRTAIESALESLDALTAELGSDPYRRIAALQRARLAT |
Ga0187775_100079934 | 3300017939 | Tropical Peatland | DVALAWVHLLASESTTDRTTIETALEALDALAAELGSDPYRRIAVLERARLGI |
Ga0187822_101243891 | 3300017994 | Freshwater Sediment | PAPDRPAIESALASLDALTAGLGSDPYRRLVALERARLAP |
Ga0066655_101035445 | 3300018431 | Grasslands Soil | VRLLASEPASDRTAIERALESLDALAAELGSDPYRRIAAFERVRLAT |
Ga0066655_103499851 | 3300018431 | Grasslands Soil | SDRRAIESALESVDALTAELGSDPYRRIAALERARLA |
Ga0066655_112616491 | 3300018431 | Grasslands Soil | RPAIESALEFVEALVTQLGAAPYRRMAELERARLAETSANPR |
Ga0066669_118838871 | 3300018482 | Grasslands Soil | TAIESALESLDALTAELGSDPYRRIAALERARLAT |
Ga0187892_104684032 | 3300019458 | Bio-Ooze | AAELAAGDLTAATSGLESLDALTAEVGSDPCRRIAALERARLAVAAIDFGPR |
Ga0193728_11725202 | 3300019890 | Soil | RPAIEGALESVDALATEFGADPYRRMAELERARLAQ |
Ga0193732_10871452 | 3300020012 | Soil | EPVPDRGAIEAALESVDALATEFGADPYRRMAEIERGRLLQ |
Ga0207660_103373853 | 3300025917 | Corn Rhizosphere | ASEPASDRTAIESALKSLDALTADLGSVPYRRIAALERLRLGA |
Ga0207644_100989281 | 3300025931 | Switchgrass Rhizosphere | ARARLRLLAAEPGSRRATIESALEALETLSAELGSEPYRRIAALERARLAP |
Ga0207677_105811253 | 3300026023 | Miscanthus Rhizosphere | RARLRLLAAEPGSRRATIESALEALETLSAELGSEPYRRIAALERARLAP |
Ga0207676_116103991 | 3300026095 | Switchgrass Rhizosphere | ARAHLLAAEPAADRMALEAALESLDVLTVELGSEPYRRLAAIERARLAT |
Ga0207698_101923241 | 3300026142 | Corn Rhizosphere | AEPGSRRATIESALEALETLSAELGSEPYRRIAALERARLAP |
Ga0209237_10576724 | 3300026297 | Grasslands Soil | VRLLASEPSSDRRAIDSALASVDALTAELGSDPYRRIAALERARLA |
Ga0209238_11150912 | 3300026301 | Grasslands Soil | EPAADRTAIESALESLDALAAELGSVPYRRLAALERARLAT |
Ga0209239_11708102 | 3300026310 | Grasslands Soil | SEPASDRTAIESALESLDALTAELGSDPYRRIAALERARLADFRA |
Ga0209153_13112002 | 3300026312 | Soil | EPAFDRTAIASALESVDALTAELGSDPYRRIAALERARLA |
Ga0209801_12356713 | 3300026326 | Soil | ASEPASDRTAIESALESLDALTAELGSDPYRRIAALERARLADFRA |
Ga0209801_12665143 | 3300026326 | Soil | ASEPASDRTAIESALESLDALTAELGSDPYRRIAALERARLAT |
Ga0209473_11419704 | 3300026330 | Soil | ASEPASDRTAIESALESVDAITAELGSDPYRRIAALERARLAT |
Ga0209377_10793261 | 3300026334 | Soil | RLLASEPSSDRRAIESALASVDALTAELGSDPYRRIAALERARLA |
Ga0257176_10049493 | 3300026361 | Soil | SDRTAIESALESLDALTAELGSDPYRRIAGLERARFATQPGTRS |
Ga0257155_10114741 | 3300026481 | Soil | VPDRTAIESALESVDTLATEFGADPYRRMAELERARLAQ |
Ga0209378_11161702 | 3300026528 | Soil | ASEPASDRNAIESALESLDALTAELGSDPYRRIAALERARLAT |
Ga0209156_103322523 | 3300026547 | Soil | RTAIESGLESLDALTAELGSDPYRRIAALERARLAT |
Ga0209898_10574581 | 3300027068 | Groundwater Sand | LLASEPASDRTAIVRALESLDALTAELGSVPYRRIAALEHARLGT |
Ga0209180_102524832 | 3300027846 | Vadose Zone Soil | SDRTAIEGALEALDALTAELGSDPYRRIGALERARLAT |
Ga0209814_101005101 | 3300027873 | Populus Rhizosphere | VHLVAAEPASDRAAIESALDSLDAVTAELGSDPYRRIAALERERLAT |
Ga0209465_103120081 | 3300027874 | Tropical Forest Soil | EPASDRAVIDSALDSLDALTVELGSVPYRRMAALERARLAI |
Ga0209974_100275114 | 3300027876 | Arabidopsis Thaliana Rhizosphere | ALAGVHLLEESAADRAEIERALASLDALAAELGSAPYRAIAARERARLVT |
Ga0247821_106056981 | 3300028596 | Soil | SEPASDRTAINSALGSLDALTAELGSDPYRRIAALERARLAT |
Ga0247819_106871851 | 3300028608 | Soil | EPAPNRIATESALASVDALTAELDSYPYRRIAALVRGRLTT |
Ga0307504_100795771 | 3300028792 | Soil | AIDGALESLDALTAELGSDPYRRLGALERARLAPGPPF |
Ga0307504_104092203 | 3300028792 | Soil | IESALESLDAVATELGSDPYRRIAALERARLAHSGRAMK |
Ga0307305_102938011 | 3300028807 | Soil | VPDRTAIEGALESVDALATEFGADPYRRMAELERARLAR |
Ga0318516_107821422 | 3300031543 | Soil | VRLLALEPAPDRTGIESALESLDALRAELDADPYQRIAALERARLAT |
Ga0310887_110307151 | 3300031547 | Soil | RFLASEPAPDRPAIERALESLDGLTAELGSAPYRRIAELERARLDT |
Ga0310886_102128121 | 3300031562 | Soil | ASDRTAINSALGSLDALTAELGSDPYRRIAALERARLAT |
Ga0307468_1018185132 | 3300031740 | Hardwood Forest Soil | ASEPASDRAAIAGALDSLDADTAELGSDPYQRIAALERSRLR |
Ga0307475_109823782 | 3300031754 | Hardwood Forest Soil | LLASEPSSDRAAIESALESLDALTAELGSDPCRRIAALERARLAT |
Ga0318509_100739723 | 3300031768 | Soil | LPVDRAALARALESLDGLTAELGSDAYRRIAALER |
Ga0318521_101577333 | 3300031770 | Soil | SEPASDRTAIERALASLDAVTAELGSEPYRRMAALERARVVQ |
Ga0318543_105094191 | 3300031777 | Soil | AWVRLLASEPASDRTAIERALESLDAVTAELGSEPYRRMAALERARVVQ |
Ga0318566_100495963 | 3300031779 | Soil | AWVRLLAAELPVDRAALARALESLDGLTAELGSDAYRRIAALER |
Ga0318552_100563063 | 3300031782 | Soil | LAAERPVDRAALARALESLDGLTAELGSDAYRRIAALER |
Ga0318503_103174262 | 3300031794 | Soil | RTAIERALASLDAVTAELGSEPYRRMAALERARVVQ |
Ga0318523_101460511 | 3300031798 | Soil | ERLDRAALARALESLDGLTAELGSDAYRRIAALER |
Ga0307473_101294431 | 3300031820 | Hardwood Forest Soil | AIESALESLDALTAELGSDPYRRIAALERARFATQPGTRS |
Ga0318517_100229294 | 3300031835 | Soil | AELPVDRAALARALESLDGLTAELGSDAYRRIAALER |
Ga0318520_109485811 | 3300031897 | Soil | AWVRLLASEPASDRTGIERALESLDAVTAELGSEPYRRMAALERARVVQ |
Ga0310900_106344011 | 3300031908 | Soil | PASDRTAINSALGSLDALTAELGSDPYRRIAALERARLAT |
Ga0318530_102114373 | 3300031959 | Soil | ASDRTAIERALASLDAVTAELGSEPYRRMAALERARVVQ |
Ga0318531_104861872 | 3300031981 | Soil | DRTGIESALESLDALRAELDADPYQRIAALERARLAT |
Ga0310906_109909711 | 3300032013 | Soil | RTAIDSALGSLDALTAELGSDPYRRIAALERARLAT |
Ga0318505_103423771 | 3300032060 | Soil | LAAELPVDRAALARALESLDGLTAELGSDAYRRIAALER |
Ga0307471_1011749261 | 3300032180 | Hardwood Forest Soil | SDRAVIESALVSLDGLTAELGSVPYRRIAALERARLGL |
Ga0307471_1035209722 | 3300032180 | Hardwood Forest Soil | RAAIESALESMDALTAELDSDPYRRVAALERARFAT |
Ga0247829_110192502 | 3300033550 | Soil | RLRLLAAEPGSRRATIESALEALETLSAELGSEPYRRIAALERARLAP |
⦗Top⦘ |