NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F050948

Metagenome / Metatranscriptome Family F050948

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050948
Family Type Metagenome / Metatranscriptome
Number of Sequences 144
Average Sequence Length 46 residues
Representative Sequence LAEYGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD
Number of Associated Samples 127
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 33.33 %
% of genes near scaffold ends (potentially truncated) 34.72 %
% of genes from short scaffolds (< 2000 bps) 88.19 %
Associated GOLD sequencing projects 120
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.111 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(23.611 % of family members)
Environment Ontology (ENVO) Unclassified
(36.111 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.583 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.00%    β-sheet: 0.00%    Coil/Unstructured: 52.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 144 Family Scaffolds
PF00085Thioredoxin 47.92
PF00293NUDIX 22.22
PF00133tRNA-synt_1 14.58
PF00144Beta-lactamase 4.86
PF01042Ribonuc_L-PSP 1.39
PF13098Thioredoxin_2 0.69
PF09678Caa3_CtaG 0.69
PF04079SMC_ScpB 0.69
PF01048PNP_UDP_1 0.69
PF01747ATP-sulfurylase 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 144 Family Scaffolds
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 14.58
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 14.58
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 14.58
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 14.58
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 4.86
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 4.86
COG2367Beta-lactamase class ADefense mechanisms [V] 4.86
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 1.39
COG0775Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnBNucleotide transport and metabolism [F] 0.69
COG0813Purine-nucleoside phosphorylaseNucleotide transport and metabolism [F] 0.69
COG1386Chromosome segregation and condensation protein ScpBTranscription [K] 0.69
COG2046ATP sulfurylase (sulfate adenylyltransferase)Inorganic ion transport and metabolism [P] 0.69
COG2820Uridine phosphorylaseNucleotide transport and metabolism [F] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.81 %
UnclassifiedrootN/A13.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725004|GPKC_F5V46DG01A4LT7Not Available541Open in IMG/M
2170459020|G1P06HT01B3IQKNot Available737Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105757438All Organisms → cellular organisms → Bacteria1482Open in IMG/M
3300000881|JGI10215J12807_1153667All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300000953|JGI11615J12901_10710374All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300000956|JGI10216J12902_102912800All Organisms → cellular organisms → Bacteria1609Open in IMG/M
3300001686|C688J18823_10875724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium570Open in IMG/M
3300002568|C688J35102_120500151Not Available1121Open in IMG/M
3300003316|rootH1_10057121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4247Open in IMG/M
3300003319|soilL2_10007348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1066Open in IMG/M
3300003319|soilL2_10061451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium4379Open in IMG/M
3300003321|soilH1_10063496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4285Open in IMG/M
3300003987|Ga0055471_10001102All Organisms → cellular organisms → Bacteria4030Open in IMG/M
3300003996|Ga0055467_10109322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales794Open in IMG/M
3300003998|Ga0055472_10209115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales603Open in IMG/M
3300004157|Ga0062590_100220771Not Available1394Open in IMG/M
3300004157|Ga0062590_100489766Not Available1044Open in IMG/M
3300005294|Ga0065705_10202795All Organisms → cellular organisms → Bacteria1419Open in IMG/M
3300005329|Ga0070683_100499762All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300005336|Ga0070680_100617799All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300005336|Ga0070680_101348243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300005338|Ga0068868_101069401All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300005341|Ga0070691_10712393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300005343|Ga0070687_100529996All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300005345|Ga0070692_10444216All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300005366|Ga0070659_100715739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium866Open in IMG/M
3300005438|Ga0070701_11255026All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300005441|Ga0070700_100258154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1253Open in IMG/M
3300005455|Ga0070663_101262203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales651Open in IMG/M
3300005526|Ga0073909_10612215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales539Open in IMG/M
3300005577|Ga0068857_101674455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales622Open in IMG/M
3300005713|Ga0066905_100513502All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300005718|Ga0068866_10096339All Organisms → cellular organisms → Bacteria1623Open in IMG/M
3300005937|Ga0081455_10300742All Organisms → Viruses → Predicted Viral1151Open in IMG/M
3300006876|Ga0079217_10598663All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300009148|Ga0105243_10136171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2090Open in IMG/M
3300009177|Ga0105248_10796195All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300009553|Ga0105249_10146419All Organisms → cellular organisms → Bacteria2270Open in IMG/M
3300009789|Ga0126307_10000222All Organisms → cellular organisms → Bacteria36542Open in IMG/M
3300010042|Ga0126314_10040954All Organisms → cellular organisms → Bacteria2960Open in IMG/M
3300010117|Ga0127449_1137102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300010371|Ga0134125_11357779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria775Open in IMG/M
3300010400|Ga0134122_11452358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria702Open in IMG/M
3300010400|Ga0134122_12683661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300010999|Ga0138505_100009527All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300011000|Ga0138513_100003619All Organisms → cellular organisms → Bacteria1630Open in IMG/M
3300011119|Ga0105246_10021066All Organisms → cellular organisms → Bacteria4189Open in IMG/M
3300012208|Ga0137376_10583809All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300012212|Ga0150985_100352646All Organisms → cellular organisms → Bacteria1844Open in IMG/M
3300012212|Ga0150985_121165848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300012395|Ga0134044_1201465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300012396|Ga0134057_1339240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300012400|Ga0134048_1183582Not Available581Open in IMG/M
3300012402|Ga0134059_1348371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300012403|Ga0134049_1193525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300012407|Ga0134050_1136526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium791Open in IMG/M
3300012882|Ga0157304_1011960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium988Open in IMG/M
3300012892|Ga0157294_10251331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300012895|Ga0157309_10159717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium677Open in IMG/M
3300012897|Ga0157285_10271123Not Available565Open in IMG/M
3300012902|Ga0157291_10259013Not Available583Open in IMG/M
3300012903|Ga0157289_10132603All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300012913|Ga0157298_10057189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium922Open in IMG/M
3300012916|Ga0157310_10294740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium633Open in IMG/M
3300013297|Ga0157378_12501831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300014254|Ga0075312_1057409All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300014325|Ga0163163_11771131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium678Open in IMG/M
3300014497|Ga0182008_10079505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1613Open in IMG/M
3300017965|Ga0190266_10001325All Organisms → cellular organisms → Bacteria4589Open in IMG/M
3300017997|Ga0184610_1256755Not Available580Open in IMG/M
3300018028|Ga0184608_10054006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1590Open in IMG/M
3300018028|Ga0184608_10308072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium696Open in IMG/M
3300018031|Ga0184634_10422662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria605Open in IMG/M
3300018051|Ga0184620_10036032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1327Open in IMG/M
3300018056|Ga0184623_10027968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2530Open in IMG/M
3300018074|Ga0184640_10218997Not Available861Open in IMG/M
3300018081|Ga0184625_10423122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium685Open in IMG/M
3300018469|Ga0190270_10741701All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300018469|Ga0190270_11403274Not Available745Open in IMG/M
3300019255|Ga0184643_1341322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium692Open in IMG/M
3300019269|Ga0184644_1552582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium601Open in IMG/M
3300019356|Ga0173481_10003239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4207Open in IMG/M
3300019361|Ga0173482_10092170All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300019361|Ga0173482_10176192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria856Open in IMG/M
3300019361|Ga0173482_10238782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium767Open in IMG/M
3300019361|Ga0173482_10351969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria668Open in IMG/M
3300019362|Ga0173479_10243308All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300019362|Ga0173479_10585670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium581Open in IMG/M
3300019867|Ga0193704_1056674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium758Open in IMG/M
3300019873|Ga0193700_1014792All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300021445|Ga0182009_10068595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1551Open in IMG/M
3300021445|Ga0182009_10514011Not Available632Open in IMG/M
3300022195|Ga0222625_1805518All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300022898|Ga0247745_1079151Not Available549Open in IMG/M
3300022899|Ga0247795_1022688All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300025567|Ga0210076_1123922Not Available564Open in IMG/M
3300025792|Ga0210143_1074285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium615Open in IMG/M
3300025899|Ga0207642_10267451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria978Open in IMG/M
3300025904|Ga0207647_10670028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300025918|Ga0207662_10544672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria803Open in IMG/M
3300025919|Ga0207657_10248789All Organisms → cellular organisms → Bacteria1418Open in IMG/M
3300025927|Ga0207687_10083578All Organisms → cellular organisms → Bacteria2312Open in IMG/M
3300025930|Ga0207701_10951328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium717Open in IMG/M
3300025932|Ga0207690_10318592All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300025934|Ga0207686_10139580All Organisms → cellular organisms → Bacteria1673Open in IMG/M
3300025972|Ga0207668_10587122All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300026003|Ga0208284_1014416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300026023|Ga0207677_10124063All Organisms → cellular organisms → Bacteria1948Open in IMG/M
3300026118|Ga0207675_100798841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria957Open in IMG/M
3300026121|Ga0207683_10054318All Organisms → cellular organisms → Bacteria3513Open in IMG/M
3300026827|Ga0207591_102427All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300027163|Ga0209878_1035720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium642Open in IMG/M
3300028380|Ga0268265_10841164All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300028713|Ga0307303_10014344All Organisms → cellular organisms → Bacteria1453Open in IMG/M
3300028713|Ga0307303_10034145All Organisms → cellular organisms → Bacteria → Terrabacteria group1031Open in IMG/M
3300028715|Ga0307313_10162670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium690Open in IMG/M
3300028744|Ga0307318_10374926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300028809|Ga0247824_10764790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300028814|Ga0307302_10037677All Organisms → cellular organisms → Bacteria2236Open in IMG/M
3300028824|Ga0307310_10369449Not Available708Open in IMG/M
3300028881|Ga0307277_10045544All Organisms → cellular organisms → Bacteria1779Open in IMG/M
3300028881|Ga0307277_10297610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria715Open in IMG/M
3300028885|Ga0307304_10400194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300030336|Ga0247826_10166493All Organisms → cellular organisms → Bacteria1472Open in IMG/M
3300030621|Ga0247655_10194688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300030990|Ga0308178_1122780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
3300030990|Ga0308178_1181072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
3300031058|Ga0308189_10411665Not Available562Open in IMG/M
3300031093|Ga0308197_10222776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300031099|Ga0308181_1177426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300031548|Ga0307408_100271862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1407Open in IMG/M
3300031548|Ga0307408_100345727All Organisms → cellular organisms → Bacteria1260Open in IMG/M
3300031562|Ga0310886_10888464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300031740|Ga0307468_100946726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300031854|Ga0310904_10262120All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300031901|Ga0307406_10044966Not Available2769Open in IMG/M
3300031995|Ga0307409_102038031Not Available603Open in IMG/M
3300031995|Ga0307409_102214502Not Available579Open in IMG/M
3300031996|Ga0308176_10110557All Organisms → cellular organisms → Bacteria2435Open in IMG/M
3300032017|Ga0310899_10527716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300032174|Ga0307470_10787933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria735Open in IMG/M
3300032211|Ga0310896_10146844All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300033407|Ga0214472_10837965All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300033551|Ga0247830_11395666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil23.61%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.86%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.47%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.47%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.78%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.08%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.08%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil2.08%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.39%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.39%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.39%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.39%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.39%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.39%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.39%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.39%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.69%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.69%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.69%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.69%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.69%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.69%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.69%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.69%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.69%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725004Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
2170459020Litter degradation NP2EngineeredOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003316Sugarcane root Sample L1Host-AssociatedOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010117Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010999Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012395Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012396Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012400Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012402Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012407Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014254Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019873Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300025567Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025792Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026003Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026827Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A4-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027163Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030621Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPKC_055878202067725004SoilLAERGTHRIDDDLTEEWLDAFVDEGLADVESYLRKHADFQSFLEDRD
2NP_030324002170459020Switchgrass, Maize And Mischanthus LitterMHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD
INPhiseqgaiiFebDRAFT_10575743833300000364SoilMHRIDDDLSEEWLDAFVAEGLTDVESYLRKHADFQTFLEDRD*
JGI10215J12807_115366713300000881SoilRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD*
JGI11615J12901_1071037433300000953SoilQPSPADNPATLVERGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD*
JGI10216J12902_10291280053300000956SoilLAEYGVHRIDEDLAEDWLDAFVADGLADVESYLRKHADFQSFLEDRD*
C688J18823_1087572413300001686SoilDNPATLAEHGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD*
C688J35102_12050015133300002568SoilMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD*
rootH1_1005712123300003316Sugarcane Root And Bulk SoilLGLPADNPATLAERGTHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD*
soilL2_1000734823300003319Sugarcane Root And Bulk SoilLAERGYHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD*
soilL2_1006145123300003319Sugarcane Root And Bulk SoilMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD*
soilH1_1006349693300003321Sugarcane Root And Bulk SoilLGLPADNPATLAERGTHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0055471_1000110283300003987Natural And Restored WetlandsMQDSRPPADNPDTLAERGMHRIDDDLSEEWLEAFVAEGLADVESFLRKHADFQTFLEDRD
Ga0055467_1010932223300003996Natural And Restored WetlandsMHRIDDDLSEEWLEAFVAEGLADVESFLRKHADFQTFLEDRD*
Ga0055472_1020911523300003998Natural And Restored WetlandsLAERGLHRIDDDLSEEWLDVFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0062590_10022077143300004157SoilLPERGLHRIDDDLSEDWFDAFVAEGLRDVESYLRKQADFQTFLEDRD*
Ga0062590_10048976623300004157SoilMQIRRPPADNPATLPERGLHRIDDDLTEAWFDAFVAEGLADVESYLRKQADFQTFLEDRD
Ga0065705_1020279513300005294Switchgrass RhizosphereMHRIDDDLSEEWLDAFVAEGLSDVESYLRKHADFQTFLEDRD*
Ga0070683_10049976223300005329Corn RhizosphereMHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD*
Ga0070680_10061779923300005336Corn RhizosphereMHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0070680_10134824313300005336Corn RhizosphereLAEHGTHRIDDDLTEEWFDAFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0068868_10106940123300005338Miscanthus RhizosphereLAERGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD*
Ga0070691_1071239323300005341Corn, Switchgrass And Miscanthus RhizosphereLAEYGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQS
Ga0070687_10052999623300005343Switchgrass RhizosphereLAERGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRDEVERFLRLD*
Ga0070692_1044421623300005345Corn, Switchgrass And Miscanthus RhizosphereLAEYDTHRIDDDLTEDWLDAFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0070659_10071573923300005366Corn RhizosphereLAERGTHRIDDDLSEEWLDAFVAEGLSDVESYLRKHADFQTFLEDRD*
Ga0070701_1125502623300005438Corn, Switchgrass And Miscanthus RhizosphereLAEHVTHRIDDDLTEEWFDAFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0070700_10025815453300005441Corn, Switchgrass And Miscanthus RhizosphereLAEYGMHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQS
Ga0070663_10126220313300005455Corn RhizospherePPADNRDTLAEHGTHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD*
Ga0073909_1061221523300005526Surface SoilMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDKD*
Ga0068857_10167445533300005577Corn RhizosphereGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0066905_10051350213300005713Tropical Forest SoilTLAERGTHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD*
Ga0068866_1009633933300005718Miscanthus RhizosphereLAEYGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0081455_1030074233300005937Tabebuia Heterophylla RhizosphereADNPATLAERGMHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD*
Ga0079217_1059866323300006876Agricultural SoilLSEHGLHRIDDDLAENWLESFAAAGLDEVEAYLRKHADFQSFLEDRD*
Ga0105243_1013617123300009148Miscanthus RhizosphereLAEYGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0105248_1079619533300009177Switchgrass RhizosphereYGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0105249_1014641933300009553Switchgrass RhizosphereADNPATLAEHGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDKD*
Ga0126307_10000222373300009789Serpentine SoilLAEHGTHRIDDDLSDDWLDAFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0126314_1004095443300010042Serpentine SoilMHRIDDDLSDDWLDAFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0127449_113710213300010117Grasslands SoilLAERGTHRIDEDLTDEWLDAFVAEGLADVESYLRKHADFQTFLEDRD*
Ga0134125_1135777923300010371Terrestrial SoilMHRIDDDLSEEWLDAFVAEGLVDVESYLRKHADFQSFLEDRD*
Ga0134122_1145235823300010400Terrestrial SoilMHRIDDDLSEDWLDAFVAEGLADVESYLRKHADFQSFLEDKD*
Ga0134122_1268366113300010400Terrestrial SoilMHRIDDDLTEEWLDAFVAEGLADVESYRRKHADFQSFLEDRD*
Ga0138505_10000952713300010999SoilLADRGTHRIDDDLTEEWLDAFVAEGLADVESYLRKYADFQTFLEDRD*
Ga0138513_10000361933300011000SoilLAEHGMHRIDDDLSEEWLDTFVAEGLADVESYLRKHADCQSWLEERD*
Ga0105246_1002106633300011119Miscanthus RhizosphereMHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRDYFQRF*
Ga0137376_1058380923300012208Vadose Zone SoilLSEYGLHRIDDDLSENWLEAFIAEGLDEVESFLRKHADFQTFLEDRD*
Ga0150985_10035264653300012212Avena Fatua RhizosphereLVEHGFHRIDDDLTEDWLEAFVAEGLVDVESYLRKHADFQSFLEDRD*
Ga0150985_12116584823300012212Avena Fatua RhizosphereMHRIDDDLSEDWLDAFVAAGLADVESYLRKHADFQSFLEDRD*
Ga0134044_120146523300012395Grasslands SoilLSEYGLHRIDDDLSENWLEAFILTRRNSESFLRKHADFQTFLEDRD*
Ga0134057_133924013300012396Grasslands SoilNPATLAERGTHRIDEDLTDEWLDAFVAEGLADVESYLRKHADFQTFLEDRD*
Ga0134048_118358213300012400Grasslands SoilGLHRIDDDLSETWLDSFIAEGLDEVEAFLRKHADFQTFLEERD*
Ga0134059_134837123300012402Grasslands SoilLAERGFHRIDDDLTEEWLDDFVAEGLADVESYLRKHADFQTFLEDRD*
Ga0134049_119352513300012403Grasslands SoilLSERGFHLIDDDLNETWLESFVAQGLDEVEAYLRKHSDFQTFLEDRD*
Ga0134050_113652633300012407Grasslands SoilLAERGTHRIDEDLTDEWLDAFVAEGLADVESYLRKQADFQTFLEDRD*
Ga0157304_101196033300012882SoilLVERGLHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0157294_1025133123300012892SoilLAEYGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD*
Ga0157309_1015971723300012895SoilMHRIDDDLTEEWLDAFVAEGLADVESYPRKHADFQTFLEDRD*
Ga0157285_1027112323300012897SoilLAEYGTHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0157291_1025901313300012902SoilMHRIDDDLSEEWLDTFVAEGLADVESYLRKHADFQSFLEDR
Ga0157289_1013260313300012903SoilVAEYGMHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0157298_1005718933300012913SoilMHRIDDDLSEEWLDTFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0157310_1029474023300012916SoilLAEYGTHRIDDDLPEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD*
Ga0157378_1250183123300013297Miscanthus RhizosphereLAERGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0075312_105740913300014254Natural And Restored WetlandsPDTLAERGMHRIDDDLSEEWLEAFVAEGLADVESFLRKHADFQTFLEDRD*
Ga0163163_1177113123300014325Switchgrass RhizosphereLAEYGLHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0182008_1007950543300014497RhizosphereLVEHGYHRIDDDLTEAWLEAFVAEGLADVESYLRKHADFQSFLEDRD*
Ga0190266_1000132533300017965SoilLAEHGTHRIDDDLSEEWLDVFVAEGLADVESYLRKHADFQSFLEDRD
Ga0184610_125675513300017997Groundwater SedimentLPESGVHRIEDDLVDSWLESFVAEGLDDVEAYLRKHADFQSFLEDRD
Ga0184608_1005400633300018028Groundwater SedimentLAERGLHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD
Ga0184608_1030807213300018028Groundwater SedimentMHRIDDDLSEDWLDAFVAEGLADVESYLRKHADFQSFLEDKD
Ga0184634_1042266213300018031Groundwater SedimentLAEYGTHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0184620_1003603233300018051Groundwater SedimentMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDKD
Ga0184623_1002796833300018056Groundwater SedimentLPESGVHRIEDDLVDSWLESFVAEGLDEVEAYLRKHADFQSFLEDRD
Ga0184640_1021899723300018074Groundwater SedimentMHRIDDDLSEEWLDAFVAEGLADVESYLRKHVDFQTFLEDRD
Ga0184625_1042312223300018081Groundwater SedimentMHRIDDDLTEAWLDAFVAEGLADVESYLRKQADFQTFLEDRD
Ga0190270_1074170123300018469SoilMHRIDDDLSEEWLDAFVAEGLSDVESYLRKHADFQSFLEDRD
Ga0190270_1140327423300018469SoilMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLE
Ga0184643_134132223300019255Groundwater SedimentLSEYGLHRIDDDLSDTWLEAFIAEGLDEVESYLRKHADFQTFLEDRD
Ga0184644_155258223300019269Groundwater SedimentMHRIDDDLTEAWLDAFVAEGLADVESYLRKHADFQTFLEDRD
Ga0173481_1000323933300019356SoilMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0173482_1009217033300019361SoilMHRIDDDLTEDWLDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0173482_1017619223300019361SoilLVERGLHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD
Ga0173482_1023878223300019361SoilLADQGVYRIDEDLSEEWLDVFVAEGLADVESYLRKHADFQTFLEDRD
Ga0173482_1035196923300019361SoilLPERGLHRIDDDLSEDWFDAFVAEGLRDVESYLRKQADFQTFLEDRD
Ga0173479_1024330813300019362SoilDNPATLVERGLHRIDDDLSEEWLDAFVAEGLADVESYLRQHADFQTFLEDRD
Ga0173479_1058567023300019362SoilTLADQGVYRVDEDLSEVWLDVFVAEGLADDESYLRKHADFQTFLEDRD
Ga0193704_105667413300019867SoilPADNPATLAERGLHRIDDDLTEEWFDAFVAEGLADVESYLRKHADFQTFLEDRD
Ga0193700_101479223300019873SoilLSEYGLHRIDDDLSESWLEAFIAEVESYLRKHADFQTFLEDRD
Ga0182009_1006859533300021445SoilLVEHGYHRIDDDLTEAWLEAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0182009_1051401123300021445SoilPIIQPRLAEYGVHRIDEDLAEDWLDAFVADGLADVESYLRKHADFQSFLEDRD
Ga0222625_180551823300022195Groundwater SedimentLAERGLHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDKD
Ga0247745_107915123300022898SoilLAEYGTHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDR
Ga0247795_102268813300022899SoilDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0210076_112392213300025567Natural And Restored WetlandsMHRIDDDLSEEWLEAFVAEGLADVESFLRKHADFQTFLEDRD
Ga0210143_107428523300025792Natural And Restored WetlandsLAERGLHRIDDDLSEEWLDVFVAEGLADVESYLRKHADFQSFLEDRD
Ga0207642_1026745123300025899Miscanthus RhizosphereLAERGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD
Ga0207647_1067002823300025904Corn RhizosphereMHRIDDDLSEEWLDAFVAEGLSDVESYLRKHADFQTFLEDRD
Ga0207662_1054467223300025918Switchgrass RhizosphereLAERGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTF
Ga0207657_1024878923300025919Corn RhizosphereLAERGTHRIDDDLSEEWLDAFVAEGLSDVESYLRKHADFQTFLEDRD
Ga0207687_1008357833300025927Miscanthus RhizosphereTHRIDDDLTEEWFDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0207701_1095132823300025930Corn, Switchgrass And Miscanthus RhizosphereMHRIDDDLSEDWLDAFVAEGLADVESYLRKHADFQTFLEDRD
Ga0207690_1031859233300025932Corn RhizosphereMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD
Ga0207686_1013958023300025934Miscanthus RhizosphereLAEYGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0207668_1058712233300025972Switchgrass RhizosphereQRPPADNPATLAERGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD
Ga0208284_101441623300026003Rice Paddy SoilLVEHGFHRIDDDLTEDWLETFVAEGLADVESYLRKHADFQSFLEDRD
Ga0207677_1012406333300026023Miscanthus RhizosphereRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0207675_10079884113300026118Switchgrass RhizosphereLAERGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLE
Ga0207683_1005431833300026121Miscanthus RhizospherePPPADNPATLAEYGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0207591_10242733300026827SoilNQSPPADNRGTLAEYGMHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0209878_103572013300027163Groundwater SandGVHRIEDDLVDSWLESFVAEGLDDVEAYLRKHADFQSFLEDRD
Ga0268265_1084116413300028380Switchgrass RhizospherePPADNPATLAERGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD
Ga0307303_1001434433300028713SoilLSEYGLHRIDDDLSESWLEAFIAEGLDEVESYLRKHADFQTFLEDRD
Ga0307303_1003414523300028713SoilMHRIDDDLTEAWLDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0307313_1016267013300028715SoilQRAPADNPATLAERGLHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD
Ga0307318_1037492623300028744SoilAENGMHRIDDDLTEAWLDAFVAEGLADVESYLRKHADFQTFLEDRD
Ga0247824_1076479033300028809SoilPSLEDDDLSEDWLDAFVAEGIADVESYLRKHADFQSFLEDKD
Ga0307302_1003767723300028814SoilLAERGLHRIDDDLTEEWFDAFVAEGLADVESYLRKHADFQTFLEDRD
Ga0307310_1036944923300028824SoilLAERGLHRIDDDLTEEWLDAFVAEGLADVESYLRKYADFQTFLEDRD
Ga0307277_1004554413300028881SoilRIEDDLVDSWLESFVAEGLDEVEAYLRKHADFQSFLEDRD
Ga0307277_1029761013300028881SoilLSEYGLHRIEDDLSETWLDSFIAEGLDEVEAYLRKHADFQ
Ga0307304_1040019413300028885SoilDNPATLAEHGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0247826_1016649313300030336SoilLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0247655_1019468823300030621SoilLSEEWLDAFVAEGLSDVESYLRKHADFQSFLEDRD
Ga0308178_112278023300030990SoilMHRIDDDLSEEWLDAFVAEGLADVESYIRKHADFQSFLEDKD
Ga0308178_118107223300030990SoilPADNPATLAENGMHRIDDDLTEAWLDAFVAEGLADVESYLRKHADFQTFLEDRD
Ga0308189_1041166513300031058SoilEYGLHRIDDDLSESWLEAFIAEGLDEVESYLRKHADFQTFLEDRD
Ga0308197_1022277613300031093SoilLSEYGLHRIDDDLSESWLEAFIAEGLDEVESYLRKHAD
Ga0308181_117742613300031099SoilNQPPRADNPATLAEHGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD
Ga0307408_10027186243300031548RhizosphereMHRIDDDLSEDWLDAFVAEGLAEVESYLRKHADFQSFLEDRD
Ga0307408_10034572713300031548RhizosphereMHRIDDDLSEDWLDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0310886_1088846423300031562SoilLAEYGLHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0307468_10094672623300031740Hardwood Forest SoilLAEYGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRE
Ga0310904_1026212013300031854SoilRDTLAEYGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0307406_1004496633300031901RhizosphereMHRIDDDLSEDWLDAFVAEGFAEVESYLRKHADFQSFLEDRD
Ga0307409_10203803123300031995RhizosphereMHRIDDDLSEDWLEAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0307409_10221450213300031995RhizosphereMHRIDDDLSEEWLDAFVAEGLSDVESYLRKHADFQSFLEERD
Ga0308176_1011055733300031996SoilMHRINDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0310899_1052771613300032017SoilPPPADNPATLAEHGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDKD
Ga0307470_1078793313300032174Hardwood Forest SoilDNRDTLAEHGTHRIDDDLTEEWFDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0310896_1014684413300032211SoilATLAEHGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD
Ga0214472_1083796513300033407SoilMDHPGTYRLEDDLSEHWLDRFVADGLEEIQSYLTKHADFQTFLEDRD
Ga0247830_1139566623300033551SoilLAEHGTHRIDDDLTEEWFDAFVAEGLADVESYLRKHADFQSFLEDRD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.