Basic Information | |
---|---|
Family ID | F050948 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 144 |
Average Sequence Length | 46 residues |
Representative Sequence | LAEYGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD |
Number of Associated Samples | 127 |
Number of Associated Scaffolds | 144 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 33.33 % |
% of genes near scaffold ends (potentially truncated) | 34.72 % |
% of genes from short scaffolds (< 2000 bps) | 88.19 % |
Associated GOLD sequencing projects | 120 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.111 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.611 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.111 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.583 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.00% β-sheet: 0.00% Coil/Unstructured: 52.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 144 Family Scaffolds |
---|---|---|
PF00085 | Thioredoxin | 47.92 |
PF00293 | NUDIX | 22.22 |
PF00133 | tRNA-synt_1 | 14.58 |
PF00144 | Beta-lactamase | 4.86 |
PF01042 | Ribonuc_L-PSP | 1.39 |
PF13098 | Thioredoxin_2 | 0.69 |
PF09678 | Caa3_CtaG | 0.69 |
PF04079 | SMC_ScpB | 0.69 |
PF01048 | PNP_UDP_1 | 0.69 |
PF01747 | ATP-sulfurylase | 0.69 |
COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
---|---|---|---|
COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 14.58 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 14.58 |
COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 14.58 |
COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 14.58 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 4.86 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 4.86 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 4.86 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.39 |
COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.69 |
COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.69 |
COG1386 | Chromosome segregation and condensation protein ScpB | Transcription [K] | 0.69 |
COG2046 | ATP sulfurylase (sulfate adenylyltransferase) | Inorganic ion transport and metabolism [P] | 0.69 |
COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.81 % |
Unclassified | root | N/A | 13.19 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2067725004|GPKC_F5V46DG01A4LT7 | Not Available | 541 | Open in IMG/M |
2170459020|G1P06HT01B3IQK | Not Available | 737 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105757438 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
3300000881|JGI10215J12807_1153667 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300000953|JGI11615J12901_10710374 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300000956|JGI10216J12902_102912800 | All Organisms → cellular organisms → Bacteria | 1609 | Open in IMG/M |
3300001686|C688J18823_10875724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 570 | Open in IMG/M |
3300002568|C688J35102_120500151 | Not Available | 1121 | Open in IMG/M |
3300003316|rootH1_10057121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4247 | Open in IMG/M |
3300003319|soilL2_10007348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1066 | Open in IMG/M |
3300003319|soilL2_10061451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4379 | Open in IMG/M |
3300003321|soilH1_10063496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4285 | Open in IMG/M |
3300003987|Ga0055471_10001102 | All Organisms → cellular organisms → Bacteria | 4030 | Open in IMG/M |
3300003996|Ga0055467_10109322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 794 | Open in IMG/M |
3300003998|Ga0055472_10209115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 603 | Open in IMG/M |
3300004157|Ga0062590_100220771 | Not Available | 1394 | Open in IMG/M |
3300004157|Ga0062590_100489766 | Not Available | 1044 | Open in IMG/M |
3300005294|Ga0065705_10202795 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
3300005329|Ga0070683_100499762 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
3300005336|Ga0070680_100617799 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300005336|Ga0070680_101348243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
3300005338|Ga0068868_101069401 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300005341|Ga0070691_10712393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
3300005343|Ga0070687_100529996 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300005345|Ga0070692_10444216 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300005366|Ga0070659_100715739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 866 | Open in IMG/M |
3300005438|Ga0070701_11255026 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300005441|Ga0070700_100258154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1253 | Open in IMG/M |
3300005455|Ga0070663_101262203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 651 | Open in IMG/M |
3300005526|Ga0073909_10612215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 539 | Open in IMG/M |
3300005577|Ga0068857_101674455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 622 | Open in IMG/M |
3300005713|Ga0066905_100513502 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300005718|Ga0068866_10096339 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
3300005937|Ga0081455_10300742 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
3300006876|Ga0079217_10598663 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300009148|Ga0105243_10136171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2090 | Open in IMG/M |
3300009177|Ga0105248_10796195 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
3300009553|Ga0105249_10146419 | All Organisms → cellular organisms → Bacteria | 2270 | Open in IMG/M |
3300009789|Ga0126307_10000222 | All Organisms → cellular organisms → Bacteria | 36542 | Open in IMG/M |
3300010042|Ga0126314_10040954 | All Organisms → cellular organisms → Bacteria | 2960 | Open in IMG/M |
3300010117|Ga0127449_1137102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
3300010371|Ga0134125_11357779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
3300010400|Ga0134122_11452358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 702 | Open in IMG/M |
3300010400|Ga0134122_12683661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
3300010999|Ga0138505_100009527 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
3300011000|Ga0138513_100003619 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
3300011119|Ga0105246_10021066 | All Organisms → cellular organisms → Bacteria | 4189 | Open in IMG/M |
3300012208|Ga0137376_10583809 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300012212|Ga0150985_100352646 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
3300012212|Ga0150985_121165848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
3300012395|Ga0134044_1201465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
3300012396|Ga0134057_1339240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
3300012400|Ga0134048_1183582 | Not Available | 581 | Open in IMG/M |
3300012402|Ga0134059_1348371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
3300012403|Ga0134049_1193525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
3300012407|Ga0134050_1136526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 791 | Open in IMG/M |
3300012882|Ga0157304_1011960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 988 | Open in IMG/M |
3300012892|Ga0157294_10251331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
3300012895|Ga0157309_10159717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
3300012897|Ga0157285_10271123 | Not Available | 565 | Open in IMG/M |
3300012902|Ga0157291_10259013 | Not Available | 583 | Open in IMG/M |
3300012903|Ga0157289_10132603 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300012913|Ga0157298_10057189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 922 | Open in IMG/M |
3300012916|Ga0157310_10294740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
3300013297|Ga0157378_12501831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
3300014254|Ga0075312_1057409 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300014325|Ga0163163_11771131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 678 | Open in IMG/M |
3300014497|Ga0182008_10079505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1613 | Open in IMG/M |
3300017965|Ga0190266_10001325 | All Organisms → cellular organisms → Bacteria | 4589 | Open in IMG/M |
3300017997|Ga0184610_1256755 | Not Available | 580 | Open in IMG/M |
3300018028|Ga0184608_10054006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1590 | Open in IMG/M |
3300018028|Ga0184608_10308072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 696 | Open in IMG/M |
3300018031|Ga0184634_10422662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
3300018051|Ga0184620_10036032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1327 | Open in IMG/M |
3300018056|Ga0184623_10027968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2530 | Open in IMG/M |
3300018074|Ga0184640_10218997 | Not Available | 861 | Open in IMG/M |
3300018081|Ga0184625_10423122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 685 | Open in IMG/M |
3300018469|Ga0190270_10741701 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300018469|Ga0190270_11403274 | Not Available | 745 | Open in IMG/M |
3300019255|Ga0184643_1341322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 692 | Open in IMG/M |
3300019269|Ga0184644_1552582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
3300019356|Ga0173481_10003239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4207 | Open in IMG/M |
3300019361|Ga0173482_10092170 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300019361|Ga0173482_10176192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 856 | Open in IMG/M |
3300019361|Ga0173482_10238782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 767 | Open in IMG/M |
3300019361|Ga0173482_10351969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
3300019362|Ga0173479_10243308 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300019362|Ga0173479_10585670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
3300019867|Ga0193704_1056674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 758 | Open in IMG/M |
3300019873|Ga0193700_1014792 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
3300021445|Ga0182009_10068595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1551 | Open in IMG/M |
3300021445|Ga0182009_10514011 | Not Available | 632 | Open in IMG/M |
3300022195|Ga0222625_1805518 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300022898|Ga0247745_1079151 | Not Available | 549 | Open in IMG/M |
3300022899|Ga0247795_1022688 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300025567|Ga0210076_1123922 | Not Available | 564 | Open in IMG/M |
3300025792|Ga0210143_1074285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 615 | Open in IMG/M |
3300025899|Ga0207642_10267451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 978 | Open in IMG/M |
3300025904|Ga0207647_10670028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
3300025918|Ga0207662_10544672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 803 | Open in IMG/M |
3300025919|Ga0207657_10248789 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
3300025927|Ga0207687_10083578 | All Organisms → cellular organisms → Bacteria | 2312 | Open in IMG/M |
3300025930|Ga0207701_10951328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 717 | Open in IMG/M |
3300025932|Ga0207690_10318592 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300025934|Ga0207686_10139580 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
3300025972|Ga0207668_10587122 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300026003|Ga0208284_1014416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
3300026023|Ga0207677_10124063 | All Organisms → cellular organisms → Bacteria | 1948 | Open in IMG/M |
3300026118|Ga0207675_100798841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
3300026121|Ga0207683_10054318 | All Organisms → cellular organisms → Bacteria | 3513 | Open in IMG/M |
3300026827|Ga0207591_102427 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300027163|Ga0209878_1035720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
3300028380|Ga0268265_10841164 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300028713|Ga0307303_10014344 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
3300028713|Ga0307303_10034145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1031 | Open in IMG/M |
3300028715|Ga0307313_10162670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 690 | Open in IMG/M |
3300028744|Ga0307318_10374926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
3300028809|Ga0247824_10764790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
3300028814|Ga0307302_10037677 | All Organisms → cellular organisms → Bacteria | 2236 | Open in IMG/M |
3300028824|Ga0307310_10369449 | Not Available | 708 | Open in IMG/M |
3300028881|Ga0307277_10045544 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
3300028881|Ga0307277_10297610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 715 | Open in IMG/M |
3300028885|Ga0307304_10400194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
3300030336|Ga0247826_10166493 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
3300030621|Ga0247655_10194688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
3300030990|Ga0308178_1122780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
3300030990|Ga0308178_1181072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
3300031058|Ga0308189_10411665 | Not Available | 562 | Open in IMG/M |
3300031093|Ga0308197_10222776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
3300031099|Ga0308181_1177426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
3300031548|Ga0307408_100271862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1407 | Open in IMG/M |
3300031548|Ga0307408_100345727 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
3300031562|Ga0310886_10888464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
3300031740|Ga0307468_100946726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
3300031854|Ga0310904_10262120 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300031901|Ga0307406_10044966 | Not Available | 2769 | Open in IMG/M |
3300031995|Ga0307409_102038031 | Not Available | 603 | Open in IMG/M |
3300031995|Ga0307409_102214502 | Not Available | 579 | Open in IMG/M |
3300031996|Ga0308176_10110557 | All Organisms → cellular organisms → Bacteria | 2435 | Open in IMG/M |
3300032017|Ga0310899_10527716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
3300032174|Ga0307470_10787933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
3300032211|Ga0310896_10146844 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
3300033407|Ga0214472_10837965 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300033551|Ga0247830_11395666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 23.61% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.86% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.47% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.47% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.78% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.08% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.08% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 2.08% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.39% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.39% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.39% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.39% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.39% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.39% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.39% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.39% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.39% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.39% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.69% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.69% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.69% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.69% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.69% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.69% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.69% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.69% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.69% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
2170459020 | Litter degradation NP2 | Engineered | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003316 | Sugarcane root Sample L1 | Host-Associated | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026003 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 (SPAdes) | Environmental | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026827 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A4-11 (SPAdes) | Environmental | Open in IMG/M |
3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030621 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db8 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPKC_05587820 | 2067725004 | Soil | LAERGTHRIDDDLTEEWLDAFVDEGLADVESYLRKHADFQSFLEDRD |
2NP_03032400 | 2170459020 | Switchgrass, Maize And Mischanthus Litter | MHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD |
INPhiseqgaiiFebDRAFT_1057574383 | 3300000364 | Soil | MHRIDDDLSEEWLDAFVAEGLTDVESYLRKHADFQTFLEDRD* |
JGI10215J12807_11536671 | 3300000881 | Soil | RIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD* |
JGI11615J12901_107103743 | 3300000953 | Soil | QPSPADNPATLVERGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD* |
JGI10216J12902_1029128005 | 3300000956 | Soil | LAEYGVHRIDEDLAEDWLDAFVADGLADVESYLRKHADFQSFLEDRD* |
C688J18823_108757241 | 3300001686 | Soil | DNPATLAEHGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD* |
C688J35102_1205001513 | 3300002568 | Soil | MHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD* |
rootH1_100571212 | 3300003316 | Sugarcane Root And Bulk Soil | LGLPADNPATLAERGTHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD* |
soilL2_100073482 | 3300003319 | Sugarcane Root And Bulk Soil | LAERGYHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD* |
soilL2_100614512 | 3300003319 | Sugarcane Root And Bulk Soil | MHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD* |
soilH1_100634969 | 3300003321 | Sugarcane Root And Bulk Soil | LGLPADNPATLAERGTHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0055471_100011028 | 3300003987 | Natural And Restored Wetlands | MQDSRPPADNPDTLAERGMHRIDDDLSEEWLEAFVAEGLADVESFLRKHADFQTFLEDRD |
Ga0055467_101093222 | 3300003996 | Natural And Restored Wetlands | MHRIDDDLSEEWLEAFVAEGLADVESFLRKHADFQTFLEDRD* |
Ga0055472_102091152 | 3300003998 | Natural And Restored Wetlands | LAERGLHRIDDDLSEEWLDVFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0062590_1002207714 | 3300004157 | Soil | LPERGLHRIDDDLSEDWFDAFVAEGLRDVESYLRKQADFQTFLEDRD* |
Ga0062590_1004897662 | 3300004157 | Soil | MQIRRPPADNPATLPERGLHRIDDDLTEAWFDAFVAEGLADVESYLRKQADFQTFLEDRD |
Ga0065705_102027951 | 3300005294 | Switchgrass Rhizosphere | MHRIDDDLSEEWLDAFVAEGLSDVESYLRKHADFQTFLEDRD* |
Ga0070683_1004997622 | 3300005329 | Corn Rhizosphere | MHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD* |
Ga0070680_1006177992 | 3300005336 | Corn Rhizosphere | MHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0070680_1013482431 | 3300005336 | Corn Rhizosphere | LAEHGTHRIDDDLTEEWFDAFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0068868_1010694012 | 3300005338 | Miscanthus Rhizosphere | LAERGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD* |
Ga0070691_107123932 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEYGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQS |
Ga0070687_1005299962 | 3300005343 | Switchgrass Rhizosphere | LAERGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRDEVERFLRLD* |
Ga0070692_104442162 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEYDTHRIDDDLTEDWLDAFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0070659_1007157392 | 3300005366 | Corn Rhizosphere | LAERGTHRIDDDLSEEWLDAFVAEGLSDVESYLRKHADFQTFLEDRD* |
Ga0070701_112550262 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEHVTHRIDDDLTEEWFDAFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0070700_1002581545 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEYGMHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQS |
Ga0070663_1012622031 | 3300005455 | Corn Rhizosphere | PPADNRDTLAEHGTHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD* |
Ga0073909_106122152 | 3300005526 | Surface Soil | MHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDKD* |
Ga0068857_1016744553 | 3300005577 | Corn Rhizosphere | GMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0066905_1005135021 | 3300005713 | Tropical Forest Soil | TLAERGTHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD* |
Ga0068866_100963393 | 3300005718 | Miscanthus Rhizosphere | LAEYGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0081455_103007423 | 3300005937 | Tabebuia Heterophylla Rhizosphere | ADNPATLAERGMHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD* |
Ga0079217_105986632 | 3300006876 | Agricultural Soil | LSEHGLHRIDDDLAENWLESFAAAGLDEVEAYLRKHADFQSFLEDRD* |
Ga0105243_101361712 | 3300009148 | Miscanthus Rhizosphere | LAEYGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0105248_107961953 | 3300009177 | Switchgrass Rhizosphere | YGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0105249_101464193 | 3300009553 | Switchgrass Rhizosphere | ADNPATLAEHGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDKD* |
Ga0126307_1000022237 | 3300009789 | Serpentine Soil | LAEHGTHRIDDDLSDDWLDAFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0126314_100409544 | 3300010042 | Serpentine Soil | MHRIDDDLSDDWLDAFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0127449_11371021 | 3300010117 | Grasslands Soil | LAERGTHRIDEDLTDEWLDAFVAEGLADVESYLRKHADFQTFLEDRD* |
Ga0134125_113577792 | 3300010371 | Terrestrial Soil | MHRIDDDLSEEWLDAFVAEGLVDVESYLRKHADFQSFLEDRD* |
Ga0134122_114523582 | 3300010400 | Terrestrial Soil | MHRIDDDLSEDWLDAFVAEGLADVESYLRKHADFQSFLEDKD* |
Ga0134122_126836611 | 3300010400 | Terrestrial Soil | MHRIDDDLTEEWLDAFVAEGLADVESYRRKHADFQSFLEDRD* |
Ga0138505_1000095271 | 3300010999 | Soil | LADRGTHRIDDDLTEEWLDAFVAEGLADVESYLRKYADFQTFLEDRD* |
Ga0138513_1000036193 | 3300011000 | Soil | LAEHGMHRIDDDLSEEWLDTFVAEGLADVESYLRKHADCQSWLEERD* |
Ga0105246_100210663 | 3300011119 | Miscanthus Rhizosphere | MHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRDYFQRF* |
Ga0137376_105838092 | 3300012208 | Vadose Zone Soil | LSEYGLHRIDDDLSENWLEAFIAEGLDEVESFLRKHADFQTFLEDRD* |
Ga0150985_1003526465 | 3300012212 | Avena Fatua Rhizosphere | LVEHGFHRIDDDLTEDWLEAFVAEGLVDVESYLRKHADFQSFLEDRD* |
Ga0150985_1211658482 | 3300012212 | Avena Fatua Rhizosphere | MHRIDDDLSEDWLDAFVAAGLADVESYLRKHADFQSFLEDRD* |
Ga0134044_12014652 | 3300012395 | Grasslands Soil | LSEYGLHRIDDDLSENWLEAFILTRRNSESFLRKHADFQTFLEDRD* |
Ga0134057_13392401 | 3300012396 | Grasslands Soil | NPATLAERGTHRIDEDLTDEWLDAFVAEGLADVESYLRKHADFQTFLEDRD* |
Ga0134048_11835821 | 3300012400 | Grasslands Soil | GLHRIDDDLSETWLDSFIAEGLDEVEAFLRKHADFQTFLEERD* |
Ga0134059_13483712 | 3300012402 | Grasslands Soil | LAERGFHRIDDDLTEEWLDDFVAEGLADVESYLRKHADFQTFLEDRD* |
Ga0134049_11935251 | 3300012403 | Grasslands Soil | LSERGFHLIDDDLNETWLESFVAQGLDEVEAYLRKHSDFQTFLEDRD* |
Ga0134050_11365263 | 3300012407 | Grasslands Soil | LAERGTHRIDEDLTDEWLDAFVAEGLADVESYLRKQADFQTFLEDRD* |
Ga0157304_10119603 | 3300012882 | Soil | LVERGLHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0157294_102513312 | 3300012892 | Soil | LAEYGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD* |
Ga0157309_101597172 | 3300012895 | Soil | MHRIDDDLTEEWLDAFVAEGLADVESYPRKHADFQTFLEDRD* |
Ga0157285_102711232 | 3300012897 | Soil | LAEYGTHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0157291_102590131 | 3300012902 | Soil | MHRIDDDLSEEWLDTFVAEGLADVESYLRKHADFQSFLEDR |
Ga0157289_101326031 | 3300012903 | Soil | VAEYGMHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0157298_100571893 | 3300012913 | Soil | MHRIDDDLSEEWLDTFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0157310_102947402 | 3300012916 | Soil | LAEYGTHRIDDDLPEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD* |
Ga0157378_125018312 | 3300013297 | Miscanthus Rhizosphere | LAERGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0075312_10574091 | 3300014254 | Natural And Restored Wetlands | PDTLAERGMHRIDDDLSEEWLEAFVAEGLADVESFLRKHADFQTFLEDRD* |
Ga0163163_117711312 | 3300014325 | Switchgrass Rhizosphere | LAEYGLHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0182008_100795054 | 3300014497 | Rhizosphere | LVEHGYHRIDDDLTEAWLEAFVAEGLADVESYLRKHADFQSFLEDRD* |
Ga0190266_100013253 | 3300017965 | Soil | LAEHGTHRIDDDLSEEWLDVFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0184610_12567551 | 3300017997 | Groundwater Sediment | LPESGVHRIEDDLVDSWLESFVAEGLDDVEAYLRKHADFQSFLEDRD |
Ga0184608_100540063 | 3300018028 | Groundwater Sediment | LAERGLHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD |
Ga0184608_103080721 | 3300018028 | Groundwater Sediment | MHRIDDDLSEDWLDAFVAEGLADVESYLRKHADFQSFLEDKD |
Ga0184634_104226621 | 3300018031 | Groundwater Sediment | LAEYGTHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0184620_100360323 | 3300018051 | Groundwater Sediment | MHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDKD |
Ga0184623_100279683 | 3300018056 | Groundwater Sediment | LPESGVHRIEDDLVDSWLESFVAEGLDEVEAYLRKHADFQSFLEDRD |
Ga0184640_102189972 | 3300018074 | Groundwater Sediment | MHRIDDDLSEEWLDAFVAEGLADVESYLRKHVDFQTFLEDRD |
Ga0184625_104231222 | 3300018081 | Groundwater Sediment | MHRIDDDLTEAWLDAFVAEGLADVESYLRKQADFQTFLEDRD |
Ga0190270_107417012 | 3300018469 | Soil | MHRIDDDLSEEWLDAFVAEGLSDVESYLRKHADFQSFLEDRD |
Ga0190270_114032742 | 3300018469 | Soil | MHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLE |
Ga0184643_13413222 | 3300019255 | Groundwater Sediment | LSEYGLHRIDDDLSDTWLEAFIAEGLDEVESYLRKHADFQTFLEDRD |
Ga0184644_15525822 | 3300019269 | Groundwater Sediment | MHRIDDDLTEAWLDAFVAEGLADVESYLRKHADFQTFLEDRD |
Ga0173481_100032393 | 3300019356 | Soil | MHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0173482_100921703 | 3300019361 | Soil | MHRIDDDLTEDWLDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0173482_101761922 | 3300019361 | Soil | LVERGLHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD |
Ga0173482_102387822 | 3300019361 | Soil | LADQGVYRIDEDLSEEWLDVFVAEGLADVESYLRKHADFQTFLEDRD |
Ga0173482_103519692 | 3300019361 | Soil | LPERGLHRIDDDLSEDWFDAFVAEGLRDVESYLRKQADFQTFLEDRD |
Ga0173479_102433081 | 3300019362 | Soil | DNPATLVERGLHRIDDDLSEEWLDAFVAEGLADVESYLRQHADFQTFLEDRD |
Ga0173479_105856702 | 3300019362 | Soil | TLADQGVYRVDEDLSEVWLDVFVAEGLADDESYLRKHADFQTFLEDRD |
Ga0193704_10566741 | 3300019867 | Soil | PADNPATLAERGLHRIDDDLTEEWFDAFVAEGLADVESYLRKHADFQTFLEDRD |
Ga0193700_10147922 | 3300019873 | Soil | LSEYGLHRIDDDLSESWLEAFIAEVESYLRKHADFQTFLEDRD |
Ga0182009_100685953 | 3300021445 | Soil | LVEHGYHRIDDDLTEAWLEAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0182009_105140112 | 3300021445 | Soil | PIIQPRLAEYGVHRIDEDLAEDWLDAFVADGLADVESYLRKHADFQSFLEDRD |
Ga0222625_18055182 | 3300022195 | Groundwater Sediment | LAERGLHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDKD |
Ga0247745_10791512 | 3300022898 | Soil | LAEYGTHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDR |
Ga0247795_10226881 | 3300022899 | Soil | DDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0210076_11239221 | 3300025567 | Natural And Restored Wetlands | MHRIDDDLSEEWLEAFVAEGLADVESFLRKHADFQTFLEDRD |
Ga0210143_10742852 | 3300025792 | Natural And Restored Wetlands | LAERGLHRIDDDLSEEWLDVFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0207642_102674512 | 3300025899 | Miscanthus Rhizosphere | LAERGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD |
Ga0207647_106700282 | 3300025904 | Corn Rhizosphere | MHRIDDDLSEEWLDAFVAEGLSDVESYLRKHADFQTFLEDRD |
Ga0207662_105446722 | 3300025918 | Switchgrass Rhizosphere | LAERGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTF |
Ga0207657_102487892 | 3300025919 | Corn Rhizosphere | LAERGTHRIDDDLSEEWLDAFVAEGLSDVESYLRKHADFQTFLEDRD |
Ga0207687_100835783 | 3300025927 | Miscanthus Rhizosphere | THRIDDDLTEEWFDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0207701_109513282 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRIDDDLSEDWLDAFVAEGLADVESYLRKHADFQTFLEDRD |
Ga0207690_103185923 | 3300025932 | Corn Rhizosphere | MHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD |
Ga0207686_101395802 | 3300025934 | Miscanthus Rhizosphere | LAEYGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0207668_105871223 | 3300025972 | Switchgrass Rhizosphere | QRPPADNPATLAERGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD |
Ga0208284_10144162 | 3300026003 | Rice Paddy Soil | LVEHGFHRIDDDLTEDWLETFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0207677_101240633 | 3300026023 | Miscanthus Rhizosphere | RIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0207675_1007988411 | 3300026118 | Switchgrass Rhizosphere | LAERGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLE |
Ga0207683_100543183 | 3300026121 | Miscanthus Rhizosphere | PPPADNPATLAEYGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0207591_1024273 | 3300026827 | Soil | NQSPPADNRGTLAEYGMHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0209878_10357201 | 3300027163 | Groundwater Sand | GVHRIEDDLVDSWLESFVAEGLDDVEAYLRKHADFQSFLEDRD |
Ga0268265_108411641 | 3300028380 | Switchgrass Rhizosphere | PPADNPATLAERGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD |
Ga0307303_100143443 | 3300028713 | Soil | LSEYGLHRIDDDLSESWLEAFIAEGLDEVESYLRKHADFQTFLEDRD |
Ga0307303_100341452 | 3300028713 | Soil | MHRIDDDLTEAWLDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0307313_101626701 | 3300028715 | Soil | QRAPADNPATLAERGLHRIDDDLTEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD |
Ga0307318_103749262 | 3300028744 | Soil | AENGMHRIDDDLTEAWLDAFVAEGLADVESYLRKHADFQTFLEDRD |
Ga0247824_107647903 | 3300028809 | Soil | PSLEDDDLSEDWLDAFVAEGIADVESYLRKHADFQSFLEDKD |
Ga0307302_100376772 | 3300028814 | Soil | LAERGLHRIDDDLTEEWFDAFVAEGLADVESYLRKHADFQTFLEDRD |
Ga0307310_103694492 | 3300028824 | Soil | LAERGLHRIDDDLTEEWLDAFVAEGLADVESYLRKYADFQTFLEDRD |
Ga0307277_100455441 | 3300028881 | Soil | RIEDDLVDSWLESFVAEGLDEVEAYLRKHADFQSFLEDRD |
Ga0307277_102976101 | 3300028881 | Soil | LSEYGLHRIEDDLSETWLDSFIAEGLDEVEAYLRKHADFQ |
Ga0307304_104001941 | 3300028885 | Soil | DNPATLAEHGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0247826_101664931 | 3300030336 | Soil | LSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0247655_101946882 | 3300030621 | Soil | LSEEWLDAFVAEGLSDVESYLRKHADFQSFLEDRD |
Ga0308178_11227802 | 3300030990 | Soil | MHRIDDDLSEEWLDAFVAEGLADVESYIRKHADFQSFLEDKD |
Ga0308178_11810722 | 3300030990 | Soil | PADNPATLAENGMHRIDDDLTEAWLDAFVAEGLADVESYLRKHADFQTFLEDRD |
Ga0308189_104116651 | 3300031058 | Soil | EYGLHRIDDDLSESWLEAFIAEGLDEVESYLRKHADFQTFLEDRD |
Ga0308197_102227761 | 3300031093 | Soil | LSEYGLHRIDDDLSESWLEAFIAEGLDEVESYLRKHAD |
Ga0308181_11774261 | 3300031099 | Soil | NQPPRADNPATLAEHGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQTFLEDRD |
Ga0307408_1002718624 | 3300031548 | Rhizosphere | MHRIDDDLSEDWLDAFVAEGLAEVESYLRKHADFQSFLEDRD |
Ga0307408_1003457271 | 3300031548 | Rhizosphere | MHRIDDDLSEDWLDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0310886_108884642 | 3300031562 | Soil | LAEYGLHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0307468_1009467262 | 3300031740 | Hardwood Forest Soil | LAEYGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRE |
Ga0310904_102621201 | 3300031854 | Soil | RDTLAEYGTHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0307406_100449663 | 3300031901 | Rhizosphere | MHRIDDDLSEDWLDAFVAEGFAEVESYLRKHADFQSFLEDRD |
Ga0307409_1020380312 | 3300031995 | Rhizosphere | MHRIDDDLSEDWLEAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0307409_1022145021 | 3300031995 | Rhizosphere | MHRIDDDLSEEWLDAFVAEGLSDVESYLRKHADFQSFLEERD |
Ga0308176_101105573 | 3300031996 | Soil | MHRINDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0310899_105277161 | 3300032017 | Soil | PPPADNPATLAEHGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDKD |
Ga0307470_107879331 | 3300032174 | Hardwood Forest Soil | DNRDTLAEHGTHRIDDDLTEEWFDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0310896_101468441 | 3300032211 | Soil | ATLAEHGMHRIDDDLSEEWLDAFVAEGLADVESYLRKHADFQSFLEDRD |
Ga0214472_108379651 | 3300033407 | Soil | MDHPGTYRLEDDLSEHWLDRFVADGLEEIQSYLTKHADFQTFLEDRD |
Ga0247830_113956662 | 3300033551 | Soil | LAEHGTHRIDDDLTEEWFDAFVAEGLADVESYLRKHADFQSFLEDRD |
⦗Top⦘ |