NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F050801

Metagenome Family F050801

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050801
Family Type Metagenome
Number of Sequences 144
Average Sequence Length 59 residues
Representative Sequence MAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLLPSFH
Number of Associated Samples 25
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 61.11 %
% of genes from short scaffolds (< 2000 bps) 62.50 %
Associated GOLD sequencing projects 25
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (66.667 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza
(72.222 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(82.639 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.68%    β-sheet: 0.00%    Coil/Unstructured: 69.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 144 Family Scaffolds
PF03732Retrotrans_gag 13.19
PF03641Lysine_decarbox 8.33
PF00078RVT_1 1.39
PF02892zf-BED 0.69
PF00665rve 0.69
PF01536SAM_decarbox 0.69
PF14392zf-CCHC_4 0.69
PF08284RVP_2 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 144 Family Scaffolds
COG1611Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) familyNucleotide transport and metabolism [F] 8.33
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.69
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.69
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.69
COG4584TransposaseMobilome: prophages, transposons [X] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.64 %
UnclassifiedrootN/A17.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300028786|Ga0307517_10005727All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida18600Open in IMG/M
3300028786|Ga0307517_10058490All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera3713Open in IMG/M
3300028786|Ga0307517_10061852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta3533Open in IMG/M
3300028786|Ga0307517_10069557All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta3186Open in IMG/M
3300028786|Ga0307517_10104186All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2211Open in IMG/M
3300028786|Ga0307517_10117428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera1985Open in IMG/M
3300028786|Ga0307517_10319242All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium860Open in IMG/M
3300028786|Ga0307517_10321166All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium856Open in IMG/M
3300028786|Ga0307517_10367330All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica774Open in IMG/M
3300028786|Ga0307517_10368621All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium772Open in IMG/M
3300028786|Ga0307517_10377038All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium760Open in IMG/M
3300028786|Ga0307517_10386011All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica746Open in IMG/M
3300028786|Ga0307517_10392466All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica737Open in IMG/M
3300028786|Ga0307517_10410504All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium713Open in IMG/M
3300028786|Ga0307517_10498066Not Available620Open in IMG/M
3300028786|Ga0307517_10643598All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica516Open in IMG/M
3300028794|Ga0307515_10011706All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta16600Open in IMG/M
3300028794|Ga0307515_10066090All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta5016Open in IMG/M
3300028794|Ga0307515_10069033All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta4841Open in IMG/M
3300028794|Ga0307515_10073034All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera4618Open in IMG/M
3300028794|Ga0307515_10077424All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta4392Open in IMG/M
3300028794|Ga0307515_10084097Not Available4091Open in IMG/M
3300028794|Ga0307515_10122900All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica2924Open in IMG/M
3300028794|Ga0307515_10425899All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica946Open in IMG/M
3300028794|Ga0307515_10905484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica513Open in IMG/M
3300030521|Ga0307511_10008329All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta10377Open in IMG/M
3300030521|Ga0307511_10037632All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta4173Open in IMG/M
3300030521|Ga0307511_10141769All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1409Open in IMG/M
3300030521|Ga0307511_10220302All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium953Open in IMG/M
3300030521|Ga0307511_10277766All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica777Open in IMG/M
3300030521|Ga0307511_10280286All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium771Open in IMG/M
3300030522|Ga0307512_10020852Not Available5922Open in IMG/M
3300030522|Ga0307512_10071135All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera2584Open in IMG/M
3300030522|Ga0307512_10316107Not Available714Open in IMG/M
3300030522|Ga0307512_10411995Not Available562Open in IMG/M
3300030522|Ga0307512_10459858All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica510Open in IMG/M
3300031456|Ga0307513_10006495All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus15271Open in IMG/M
3300031456|Ga0307513_10146578Not Available2277Open in IMG/M
3300031456|Ga0307513_10182274All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1961Open in IMG/M
3300031456|Ga0307513_10381606Not Available1148Open in IMG/M
3300031456|Ga0307513_10476549All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica968Open in IMG/M
3300031456|Ga0307513_10623380All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium787Open in IMG/M
3300031456|Ga0307513_10725357All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium699Open in IMG/M
3300031456|Ga0307513_10955567All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica565Open in IMG/M
3300031507|Ga0307509_10121090All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium2594Open in IMG/M
3300031507|Ga0307509_10160450All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica2147Open in IMG/M
3300031507|Ga0307509_10257166All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1524Open in IMG/M
3300031507|Ga0307509_10328884Not Available1261Open in IMG/M
3300031507|Ga0307509_10611577All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium761Open in IMG/M
3300031507|Ga0307509_10725820All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica659Open in IMG/M
3300031507|Ga0307509_10759228All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium635Open in IMG/M
3300031507|Ga0307509_10843870All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica580Open in IMG/M
3300031507|Ga0307509_10990985All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica507Open in IMG/M
3300031507|Ga0307509_11007446All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium500Open in IMG/M
3300031616|Ga0307508_10007029All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta10497Open in IMG/M
3300031616|Ga0307508_10064701Not Available3223Open in IMG/M
3300031616|Ga0307508_10070456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica3069Open in IMG/M
3300031616|Ga0307508_10133246All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2088Open in IMG/M
3300031616|Ga0307508_10141221All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2012Open in IMG/M
3300031616|Ga0307508_10372715All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1018Open in IMG/M
3300031616|Ga0307508_10402297All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica960Open in IMG/M
3300031616|Ga0307508_10491804Not Available821Open in IMG/M
3300031616|Ga0307508_10504768All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica804Open in IMG/M
3300031616|Ga0307508_10606699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica696Open in IMG/M
3300031616|Ga0307508_10834783All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica541Open in IMG/M
3300031616|Ga0307508_10916461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica504Open in IMG/M
3300031616|Ga0307508_10920506All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica502Open in IMG/M
3300031649|Ga0307514_10111720All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1933Open in IMG/M
3300031649|Ga0307514_10118822All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1850Open in IMG/M
3300031649|Ga0307514_10246687Not Available1062Open in IMG/M
3300031649|Ga0307514_10304644All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica889Open in IMG/M
3300031649|Ga0307514_10386887Not Available722Open in IMG/M
3300031730|Ga0307516_10093649Not Available2829Open in IMG/M
3300031730|Ga0307516_10184005All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1820Open in IMG/M
3300031730|Ga0307516_10220770All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium1604Open in IMG/M
3300031730|Ga0307516_10228897All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1563Open in IMG/M
3300031730|Ga0307516_10321463All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae1218Open in IMG/M
3300031730|Ga0307516_10339140All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1170Open in IMG/M
3300031730|Ga0307516_10508052All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica859Open in IMG/M
3300031730|Ga0307516_10687882All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica679Open in IMG/M
3300031730|Ga0307516_10703651Not Available667Open in IMG/M
3300031730|Ga0307516_10825445All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium589Open in IMG/M
3300031730|Ga0307516_10843487All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica579Open in IMG/M
3300031730|Ga0307516_10885184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica558Open in IMG/M
3300031838|Ga0307518_10282831All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1024Open in IMG/M
3300031838|Ga0307518_10308600All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium955Open in IMG/M
3300031838|Ga0307518_10408034All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica753Open in IMG/M
3300031838|Ga0307518_10421059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica732Open in IMG/M
3300031838|Ga0307518_10421100All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica732Open in IMG/M
3300031838|Ga0307518_10546811All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium575Open in IMG/M
3300032354|Ga0325403_1000808All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta24019Open in IMG/M
3300032354|Ga0325403_1000878All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida23499Open in IMG/M
3300032354|Ga0325403_1003580All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus14221Open in IMG/M
3300032354|Ga0325403_1003999All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida13620Open in IMG/M
3300032354|Ga0325403_1005341All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida12099Open in IMG/M
3300032354|Ga0325403_1005986Not Available11533Open in IMG/M
3300032354|Ga0325403_1006209Not Available11353Open in IMG/M
3300032354|Ga0325403_1010431Not Available8857Open in IMG/M
3300032354|Ga0325403_1015544All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida7088Open in IMG/M
3300032354|Ga0325403_1019307All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium6226Open in IMG/M
3300032354|Ga0325403_1072177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1913Open in IMG/M
3300032354|Ga0325403_1080869All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1640Open in IMG/M
3300032354|Ga0325403_1151409All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica619Open in IMG/M
3300032354|Ga0325403_1170952All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica510Open in IMG/M
3300032355|Ga0325401_1016555Not Available6990Open in IMG/M
3300032355|Ga0325401_1174278All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium785Open in IMG/M
3300032374|Ga0325400_1120146All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1565Open in IMG/M
3300032374|Ga0325400_1189413All Organisms → cellular organisms → Eukaryota951Open in IMG/M
3300032389|Ga0325405_1002714All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta18246Open in IMG/M
3300032389|Ga0325405_1007127All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta11271Open in IMG/M
3300032389|Ga0325405_1007915Not Available10635Open in IMG/M
3300032389|Ga0325405_1034116Not Available3776Open in IMG/M
3300032389|Ga0325405_1091638All Organisms → cellular organisms → Eukaryota983Open in IMG/M
3300032390|Ga0325404_1102551All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica762Open in IMG/M
3300032735|Ga0325410_1124737All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica533Open in IMG/M
3300032740|Ga0325411_1081289All Organisms → cellular organisms → Eukaryota1011Open in IMG/M
3300032741|Ga0325414_1112436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica799Open in IMG/M
3300033160|Ga0325402_1013089All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida7737Open in IMG/M
3300033160|Ga0325402_1033957All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae4115Open in IMG/M
3300033160|Ga0325402_1080137All Organisms → cellular organisms → Eukaryota1625Open in IMG/M
3300033160|Ga0325402_1082277All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1565Open in IMG/M
3300033160|Ga0325402_1130752All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica750Open in IMG/M
3300033160|Ga0325402_1137299All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium682Open in IMG/M
3300033179|Ga0307507_10051406All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera3966Open in IMG/M
3300033179|Ga0307507_10097101All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida2487Open in IMG/M
3300033179|Ga0307507_10265798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1089Open in IMG/M
3300033179|Ga0307507_10325684All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica921Open in IMG/M
3300033179|Ga0307507_10487367All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium668Open in IMG/M
3300033180|Ga0307510_10052491All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida4296Open in IMG/M
3300033180|Ga0307510_10061281All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera3859Open in IMG/M
3300033180|Ga0307510_10063169All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium3774Open in IMG/M
3300033180|Ga0307510_10154230All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1907Open in IMG/M
3300033180|Ga0307510_10227375All Organisms → Viruses → Predicted Viral1371Open in IMG/M
3300033180|Ga0307510_10496856All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica662Open in IMG/M
3300034389|Ga0325419_016090Not Available7195Open in IMG/M
3300034389|Ga0325419_066656All Organisms → cellular organisms → Eukaryota1595Open in IMG/M
3300034689|Ga0325421_033928All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera3608Open in IMG/M
3300034689|Ga0325421_066603All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1702Open in IMG/M
3300034778|Ga0325423_134587All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica528Open in IMG/M
3300034901|Ga0325409_076318All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1288Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza72.22%
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem22.92%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf4.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030522Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031838Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032390Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1Host-AssociatedOpen in IMG/M
3300032735Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3Host-AssociatedOpen in IMG/M
3300032740Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4Host-AssociatedOpen in IMG/M
3300032741Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033160Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M
3300034389Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4Host-AssociatedOpen in IMG/M
3300034689Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R2Host-AssociatedOpen in IMG/M
3300034778Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R4Host-AssociatedOpen in IMG/M
3300034901Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0307517_1000572763300028786EctomycorrhizaMAEEDNQSLHNKNNRVRTLGDHMNPTRTSAPSCIVFPPDASHFNCKKDII
Ga0307517_1005849073300028786EctomycorrhizaMAKEDNQSLYNENNENNRVRTLRNHMNPTRTSAPSCIVFPHDASHFNFKSGIIQHLPSFHGLDLENPYLRMREFEKFVTIIRLKL
Ga0307517_1006185213300028786EctomycorrhizaMAKEDNQSLHNENNENNRARTLRDHMNPTRPSAPSCIVFPSDASYFNFKPGIIQLLPSFM
Ga0307517_1006955723300028786EctomycorrhizaMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPLCIVFPPDASHFNFKPDIIQLLPSFHGLELENPFLQLLMH
Ga0307517_1010418613300028786EctomycorrhizaMVEEDNQSFHNENNENNHVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLLTFHGLDLENPCI
Ga0307517_1011742813300028786EctomycorrhizaAKEDNQSLHNENNENNRVRTLKDHMNPTRTSAPSCIVFPPDAYHFNFKPDII
Ga0307517_1031924213300028786EctomycorrhizaMAEEDNQSLHNENNENIQVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPSFH
Ga0307517_1032116613300028786EctomycorrhizaMAEEDNQSLYNENNENNHVRTLRDHMNPTRISAPSCIFFPPDASHFNFKPDIIQ
Ga0307517_1036733013300028786EctomycorrhizaMAEEDNQSLHNENNENNRVRILRDHMNPIKTSAPSCIVFPPDASHFNFKPSIIQLLPS
Ga0307517_1036862123300028786EctomycorrhizaMAEEDNQLLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKP
Ga0307517_1037703823300028786EctomycorrhizaMAEEDNQSLHNENNENIRVRTLRDHMNPTRTGAPSCIVFPPDASHFNFKPGIIQLLPSF
Ga0307517_1038601113300028786EctomycorrhizaMTKEDNQSLHNENNENNRVRTLRDHMNPTRTSASSCIVFPPDASHFNFKPDIIQLLPSFHGLDLENPSLHLREFKEV
Ga0307517_1039246613300028786EctomycorrhizaMPEKDNQSLHNENNENNHVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLSTF
Ga0307517_1041050413300028786EctomycorrhizaMAEEDNQSLHNENNENIWVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPS
Ga0307517_1049806623300028786EctomycorrhizaMAEEDNQSLHNENNENNHLRTLKDHMNPTRTCAPSCIVFTPDASHFNFKPDIIQLAFKRI
Ga0307517_1064359813300028786EctomycorrhizaMAEEDNQSLHNENNENNRVRTLRDHMNTTRTSAPSCMVFPPDASHFNFKPGIIQLLPSFHGLDLENPYL
Ga0307515_1001170683300028794EctomycorrhizaMAKEDNQSFHNENNENNRARTLRDHMNPTRPSAPSCIVFPSDASYFNFKPGIIQLLPSFM
Ga0307515_1006609013300028794EctomycorrhizaMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSKPSCIVFPPDASHFNFKLDIIQLLPSFHGLNLENPYLHLRGW
Ga0307515_10069033113300028794EctomycorrhizaMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFSPDASQFNFKPDIIQLLPSFM
Ga0307515_1007303483300028794EctomycorrhizaMAEEDNQSLYNENNENNRVRTLRDHMNPTRTSASSCIVFPPDASHLNFNLGII
Ga0307515_1007742413300028794EctomycorrhizaMAEEDIQSLHNDNNENNRVKTLRDHMNPTRTSAPSFIVFPPGASYFNFKPEIIKL
Ga0307515_1008409733300028794EctomycorrhizaMVEEDNQSLYSENNRVRTLRDHTNPTRTSASSCIVFSPNTSHFNFKPDIIQLLSTFMA
Ga0307515_1012290013300028794EctomycorrhizaMAEEDNQSLHNENNENNRVRTLREHMNPTRTSASSCIVFPLDASHFNFKPDIIQLLPSFHGLDLENSYLHLREFKEV
Ga0307515_1042589913300028794EctomycorrhizaMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPSFHGLD
Ga0307515_1090548413300028794EctomycorrhizaMTEEDNQSLYNENNENNRVRTLRDHMNPIRTSAPSCIVFPPDASHFNFKPDIIQLLPSFH
Ga0307511_1000832963300030521EctomycorrhizaMDEEDNQSLYNENNKNNRVRILRDHMNPTRTSAPSCIVFPPDASHFNFKSS
Ga0307511_1003763273300030521EctomycorrhizaMVEEDNQSLHNENNENNHVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKLDIIQLLLTFHGLDLENPCI
Ga0307511_1014176923300030521EctomycorrhizaMAEEDNQSIHNKNNENNHVRTLRDHMNPTRTSAPSCIVFPPGASYFNFKPGIIQLLPIFM
Ga0307511_1022030213300030521EctomycorrhizaMVEEGNQSLHNENYHVRTLRDYINPTRTSARSCIVFPPDASHFNFKLGIIQLLPSFHGLDLE
Ga0307511_1027776613300030521EctomycorrhizaMAEEDNQSLHNKNNENNRVRTLRDHMNPTRTSAPSCIVFPHDASHFNFKPDIIK
Ga0307511_1028028613300030521EctomycorrhizaMAEEDNQSLYNENNHVRILRDHINPTRTSAPSCIVFPPDASHFNFKPV
Ga0307512_1002085213300030522EctomycorrhizaSSFSENMTEENNQSLHNENNRVRTLRDHMNLTRTSAPSCIVFPPDASHFNFKSGVI
Ga0307512_1007113513300030522EctomycorrhizaYENMAKEDNQSLHNENNENNRVRTLKDHMNPTRTSAPSCIVFPPDAYHFNFKPDII
Ga0307512_1031610713300030522EctomycorrhizaMAEKYNQSLHNENNRVRTLRDHMNPTRTNAPLCIVFPPDASHFNFMPDIIQLLPSFHGLDLENPDINDSNYNMNT
Ga0307512_1041199513300030522EctomycorrhizaMAEEDNQSLHNENNHVRTLRDHMNPTRTNAPSCIVFPPDASHFNFK
Ga0307512_1045985813300030522EctomycorrhizaMTEEDNQSLYNENNENNRVRTLRDHMNPIRTSAPSCIVFPPDASHFNFKPDIIQLLPSFHSLDLEN
Ga0307513_1000649523300031456EctomycorrhizaMVEEDNQSLHNENNENNHVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLLTFHGLDLENPCI
Ga0307513_1014657823300031456EctomycorrhizaMAEEYNQSLHNENNRVRTLRDHMNPTRTSAPDIIQLLPTFHGLDLENP
Ga0307513_1018227413300031456EctomycorrhizaMAKEDNQSLHNGYNENNRVRTLRNHLNPIRTSAPSCIVFPPDASHFNFKPDIIQLLPSFH
Ga0307513_1038160623300031456EctomycorrhizaFLENIVEEDNQSIHNDNNHFRTLRDHMNPTRTYALXCIVFPPSASHFNFKLGIIQLLPNVHGLV
Ga0307513_1047654913300031456EctomycorrhizaMAEEDNQSLHNENNENNRVRTLRDHMNPIRTSAPSCIVFPPDASHFNFKP
Ga0307513_1062338013300031456EctomycorrhizaMAEEDNKSLHNENNENIRVRTLRDHMNPTRTSAHSCIVFPPDASHFNFKTGIIQLL
Ga0307513_1072535713300031456EctomycorrhizaMVKKDNQSLHNENNENIRVRTLRDHMNPTRTSAPSYIVFPPDASHFNFKPDIIQLLPSFHGLDLENPYLH
Ga0307513_1095556713300031456EctomycorrhizaMAKEDNQSLHNENNENNRARTLRDHMNPTRPSAPSCIVFPSDASYFNFKPGIIQLLPS
Ga0307513_1109565213300031456EctomycorrhizaMAEEDNQLLHNENNENIRARTLRDHMNPTRTSAPLCIVFPPDASHFNFKP
Ga0307509_1012109033300031507EctomycorrhizaMAEEDNQSLHNENSENNRVRTLIDHINPTRTSAPLCIVFPPDASHFNFKPVIIQLLPSFHGLDLENSYLH
Ga0307509_1016045013300031507EctomycorrhizaMAEEDNYSLHNENNRVRKLKNHMNPTRTSAPSYIVFPPDASHFNFKPGIIQLLPSFHGLDLENPYLHLREFEE
Ga0307509_1025716613300031507EctomycorrhizaMAEEDNQSLHNKNNENNRVRTLRDHMNPIRTSAPSSIIFPLDASHFNFKLYIIQLLH
Ga0307509_1032888413300031507EctomycorrhizaMAEKYNQSLHNENNENNRVRTLRDHMNPTRTNAPLCIVFPPDASHFNFMPDIIQLLPSFHGLDLENPDINDSNYSMNT
Ga0307509_1059730013300031507EctomycorrhizaMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFSPDASHFNFKP
Ga0307509_1061157713300031507EctomycorrhizaMAEEDNQSFYNENNRVRILINHMNPTKTSAPSCIVFPPDASHFNFKS
Ga0307509_1072582013300031507EctomycorrhizaMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQ
Ga0307509_1075922823300031507EctomycorrhizaMAEKDNQSLHNENNENIWVRTLRDHMNPTRTSAPSCIVFPPNASHFNFKTGIIQLLPSF
Ga0307509_1084387013300031507EctomycorrhizaNENNRVRTLKDHMNPIRTSAPSCIVFPPNASHFNFKPGII
Ga0307509_1099098513300031507EctomycorrhizaMAEEDNQSLHNENNKNNYVRTLRDHMNPTRTSAPSCIVFPLDASHFNFKPDIIQLLPSFHGL
Ga0307509_1100744613300031507EctomycorrhizaMTEEDNQSLYNENNENNRVRTLRDHMNPIRTSAPSCIVFPPDASHFNFKPDIIQLLPSFLGL
Ga0307508_1000702933300031616EctomycorrhizaMDEEDNQSLRNENNENNCVRTLRDYMNPTRTSAPSCIVFPPGASYFNFKSDIIQLLPSFHGLDLEIHTCI
Ga0307508_1006470123300031616EctomycorrhizaMAEKDNQSLYNDNNCLRTLRGHMNPIRINAPSCIVSPHDTSHFNFKPSII
Ga0307508_1007045623300031616EctomycorrhizaMPEKDNQSLHNENNENNHVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLSTFHGLDI
Ga0307508_1013324633300031616EctomycorrhizaMAEEDNQSLHNENNHVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPYFHG
Ga0307508_1014122133300031616EctomycorrhizaMAEVDNQSLHNENNENSRVRTLRDHMNPTRTSAPSCIVFPSNASHFNFKSDIIQFLSSFHGLDL
Ga0307508_1037271513300031616EctomycorrhizaMAEKDNQSLHNENNENNRVRILRDHINPTRTSAPSCIVFPPNSSHFNFKPGIIQLLPSFHGLDL
Ga0307508_1040229713300031616EctomycorrhizaMAEEDNQSLHNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPSFHGLD
Ga0307508_1049180413300031616EctomycorrhizaMAEEDNQSIHNENNENNRVRTLRDHINPTRTSTPSYIVLPPDVSHFNFKPGIIQL
Ga0307508_1050476813300031616EctomycorrhizaMAEEDNYSLHNENNRVRKLKNHMNPTRTSAPSYIVFPPDASHFNFKPGIIQLLPSFHGLDLENPYLHLREFE
Ga0307508_1060669913300031616EctomycorrhizaMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPCFHDLDLEN
Ga0307508_1072354613300031616EctomycorrhizaSFSENMAEEDNQSLHNENNENIRVRTLRDHMNATRTSAPSCIVFPPDASHFNFKP
Ga0307508_1083478313300031616EctomycorrhizaMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQ
Ga0307508_1091646113300031616EctomycorrhizaMAEEDNQLLHNENNENIRARTLRDHMNPTRTSAPLCIVFPPDASHFNFKPDIIQLLPSFH
Ga0307508_1092050613300031616EctomycorrhizaMTEEDNQSLYNENNRVRTLRDHMNPIRTSAPSCIVFPPDASHFNFKPDIIQLLPSFH
Ga0307514_1011172053300031649EctomycorrhizaNHSFHNENNRVRILRDHMNPTRTSAPSCIVFPPDTSHFNFKPSIIQLLPSFHGLDL
Ga0307514_1011882213300031649EctomycorrhizaMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPLYIVFPPDASHFNFKPDIIQLLPSFHGLELENPFLQLLMH
Ga0307514_1024668713300031649EctomycorrhizaMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSXIVFPPDASHFNFKPDIIQLLPSFHGLDLENP
Ga0307514_1030464413300031649EctomycorrhizaVVDFVGYPHHFQKNMAEKDIQSLHNENNRVRTFRNHMNPTRTSAPSCIVFSPDASHFNFKSEIIQLLPSCHGLDLENSYLHLR
Ga0307514_1038688713300031649EctomycorrhizaVVDFIGYPHHFHNENNENNRVRTLRDHMNPTRTSAPSCINPPDASHFNFKPGIIQLLPSFLGLDLENLY
Ga0307516_1009364943300031730EctomycorrhizaMAEEDNQSLYNENTRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGITQLLPSLHA
Ga0307516_1018400523300031730EctomycorrhizaMTEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDII
Ga0307516_1022077023300031730EctomycorrhizaMVEEDNQSLHNENNENNHVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDI
Ga0307516_1022889713300031730EctomycorrhizaNENNENNHVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIVQLLLTFHGLDLENPCI
Ga0307516_1032146333300031730EctomycorrhizaAKEDNQSLHNENNRVRTLRDHMNPTKTSAPSXIVFPPDASHFNFKSGIIQLTKKK
Ga0307516_1033914043300031730EctomycorrhizaSSFSENMTEEDNQSLHNENNRVRTLRDHMNPIRTSAPSCIVFPPDASHFNFKSGIIQLYLLFMA
Ga0307516_1050805213300031730EctomycorrhizaMAEEDNQSLHNENNENIRIRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLLPSFHGLDLEN
Ga0307516_1068788213300031730EctomycorrhizaMAEKDNQLLHNENNENNRVRTLRDHMNSTRTSAPSCIVFPPDASHFDFKPDIIQLLPFLWLRSRKSI
Ga0307516_1070365123300031730EctomycorrhizaMAEEDNQSLHNENNKNNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLL
Ga0307516_1082544523300031730EctomycorrhizaMVEEGNQSLHNENYHVRTLRDYINPTRTSARSCIVFPPDASHFNFKLGIIQLLPS
Ga0307516_1084348713300031730EctomycorrhizaMVEEDNQSLHNENNENHRVRTLRDHMNPTKTSAPSCIVFPLDASHFNFKPDIIQLL
Ga0307516_1088518413300031730EctomycorrhizaMAEEDNYSLHNENNRVRKLKNHMNPTRTSAPSYIVFPPDASHFNFKPGIIQ
Ga0307518_1028283113300031838EctomycorrhizaMAVEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPSFH
Ga0307518_1030860013300031838EctomycorrhizaMAKEDNQSLHNENNENNRARTLRDHMNPTRPSAPSCIVFPSDASYFNFKPGIIQ
Ga0307518_1040803413300031838EctomycorrhizaMAEEDNQSLHNENNENNRVRTLRYHMNPARTSAPSCIVFPPDASHFNFKPCIIQLFPSFHGLDLEN
Ga0307518_1042105913300031838EctomycorrhizaMAEEDNQSLHNKNNRVRTLRDHMNPARTSAPSCIVFPPDASHFNFKPCIIQLFPSFHGLDLEN
Ga0307518_1042110013300031838EctomycorrhizaMAEEDNQSLYNENNRVRTPRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPSFH
Ga0307518_1054681113300031838EctomycorrhizaMAEEDNQSLHNENNENNRVRTLRDHMNPIRTTAPSCIVLPPNASHFNFKP
Ga0325403_1000808133300032354XylemMAEKDNQSFHNENNRVKTLKDHMNLTRTSAPSCIVFPPDASHFNFKLDIIQLLPNFSWLRSRKSILAFERI
Ga0325403_1000878153300032354XylemMVEEDNQSLHNENNENSRVRTLRDHMNLTRISAPPCIVFSLDVSHFNFKRDIIQLLPIFM
Ga0325403_100358043300032354XylemMAEKDNQSLHNDNNCLRTLRGHMNPIRTNAPSCIVSSHDTSHFNFKPSII
Ga0325403_100399953300032354XylemMAKEDNQSLHNENNENNRVRTLKDYMNPIRTSARSCIVFPLDASYFNFKSDIIQLLPYLL
Ga0325403_100534173300032354XylemMAEGDNQSLHNENNRVRTIRDHMNPTRTSAVSCIVFPPDASHFNFKPGIIQLLPSQQLET
Ga0325403_100598613300032354XylemMAEEDNQSLHNENNENIRIITLRDHMNPTRTSAHSCIVFPLDASHFNFKPGIIQLLPSFHGLDLENPYLHLIKRI
Ga0325403_100620983300032354XylemMAKEDNQLLHNENNRVRTLKDYMNPTRTSARSCIVFPLDASHFNFKSDIIQLLPYLLA
Ga0325403_1010431133300032354XylemMAKEDNQSLHNENNHVKTLKDHMNPTRTSAPSCIVFSPDVSHFNFKPGII
Ga0325403_101554463300032354XylemMAKEDNESLHNENNENNRVKTLRDHMNPTRTSAPSCIVFPSDASHFNF
Ga0325403_101930713300032354XylemMAEEDNQSLYNENNHVRTLRDHKNPIRTSAPSCIVFPSNTSHFNFKSDIIQLLPSFHGLDLKIRTCI
Ga0325403_107217733300032354XylemMAEEDNQSLHNENNENIRVRILRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPSFYGLDL
Ga0325403_108086923300032354XylemNMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPNASHFNFKPGIIQLLPSFKY
Ga0325403_115140913300032354XylemMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKTGIIQLLPSFHGLD
Ga0325403_117095213300032354XylemMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQ
Ga0325401_101655553300032355XylemMAEEDNQSLHNENNESNRVRTLKDHMNPTRTSAPSCIVFPPNVSHFNLKLGIIQLLHSFHGLDLENPCI
Ga0325401_117427813300032355XylemMAKEDNQSLHNENNKNIRVRTHRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLLPSFHGLDL
Ga0325400_112014613300032374XylemMTEENNQLFHNENNRVRILRDHMNPTRTSAPSCIVFPPNASHFNFKPGIIQLLPSFMA
Ga0325400_118941313300032374XylemMAEEDNQSLHNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPG
Ga0325405_1002714133300032389XylemMAEKDNQSFHNENNRVKTLKDHMNLTRTSAPSCIVFPPDVSHFNFKPDIIQLLPNFSWLRSRKSILAFERI
Ga0325405_100712733300032389XylemMAEGDNQSLHNENNRVRTIRDHMNPTRTSAASCIVFPPDASHFNFKPGIIQLLPSQQLET
Ga0325405_100791573300032389XylemMVEKDNQSLHNDNNCLRTLRGHMNPIRTNAPSCIVSSHDTSHFNFKPSII
Ga0325405_103411663300032389XylemMDEEDNQSLHNENNEDSHVRTLRDHKNPTRTSAPSCIVFPPNASHFNFKPDIIQLLPSFHDLDLEN
Ga0325405_109163823300032389XylemMAEEDNQSLHNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQ
Ga0325404_110255113300032390XylemMAEEDNQSLYNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPD
Ga0325410_112473713300032735XylemMAEEDNQSLYNENNENNXVRTLRDHMNPIRTSAPSCIVFPPDASHFNFKPG
Ga0325411_108128913300032740XylemMAEEDNQSLHNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLLPSFHGLDLE
Ga0325414_111243613300032741LeafMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLLPSFH
Ga0325402_101308933300033160XylemMVEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCMVFPPDASYFNFKPGIIQLLPFFM
Ga0325402_103395753300033160XylemMGQEDNQSLHNENNENNRVKTLRDQMNPTKTSAPSCIVFPP
Ga0325402_108013713300033160XylemMAEEDNQSLHNENNENNRVRTLRDHMNPTRTTAPSCIVFPPDASHFNFKPCIIQLLPSFH
Ga0325402_108227713300033160XylemMTEENNQLFHNENNRVRILRDHMNPTKTSAPSCIVFPPNASHFNFKPGIIQLLPSFMA
Ga0325402_113075213300033160XylemMAEEDNQSLHNENNENIQVRTLRDHMNPTRTSAPSCIVFPLDASHFNFKPGIIQLLPSFH
Ga0325402_113729913300033160XylemMAEEANQSLHNENNENNRVRTLRDHTNPTRTSAPSSIVFPPDASHFNFKPGIIQLLPSF
Ga0307507_1005140623300033179EctomycorrhizaMAEEDNQSLHNENNEDNRVRILRDHMNPTRTSAPSYIVFPPDASHFNFKPDIIQPLPSFHGLDLENPYLHFERI
Ga0307507_1009710113300033179EctomycorrhizaFSKNMVEEDNQSLHNEHNENNRVRTLRHHMNPTRTSAPSCIVFPPDASHFNFKPIIQLYLLFMV
Ga0307507_1026579813300033179EctomycorrhizaMVKKDNQSLHNENNENIRVRTLRDHMNPTRTSAPSYIVFPPDASHFNFKPDIIQLLPSF
Ga0307507_1032568423300033179EctomycorrhizaMAKEDNQSLHNENNENNRARTLRDHMNPTRPSAPSCIVFPSDASYFNFKPDIIQLLPSFM
Ga0307507_1048736713300033179EctomycorrhizaMAEEDNQSLHNENNENNRVRTLRDHMNTTRTSAPSCMVFPPDASHFNFKPGIIQ
Ga0307510_1005249163300033180EctomycorrhizaMAEEDNQSLYNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLL
Ga0307510_1006128123300033180EctomycorrhizaMAKEDNQSLYNENNENNRVRTLRNHMNPTRTSAPSCIVFPHDASHFNFKSGIIQHLPSFHGLDLENPYLRMR
Ga0307510_1006316913300033180EctomycorrhizaMAEKDNQSLHNENNRDRTLRDHMNPTRTSAPSCIFFSHDATHFNFKPDIIQLLPSFHGLDLENP
Ga0307510_1015423013300033180EctomycorrhizaNMAKEDNQSLHNENNENNRARTLRDHMNPTRPSAPSCIVFPFDASYFNFKPGIIQLLPSFMA
Ga0307510_1022737513300033180EctomycorrhizaMAEEDNQTLHNENNRVRTFRDHMNSTRTSAPSYIVFSPDASHFNFKPSIIQLLPIFHGLDLEN
Ga0307510_1049685613300033180EctomycorrhizaMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKSGIIQLLP
Ga0325419_016090_4045_41973300034389LeafMSKEDNQSLHNENNHVKTLKDHMNPTRTSAPSCIVFSPDVSHFNFKPGII
Ga0325419_066656_1005_11813300034389LeafMAEEDNQSLHNENIRVRTLKDHMNPTRTSAPSCIVFPPDASHFNFKSGIIQLLPSFMA
Ga0325421_033928_295_4983300034689LeafMAEEDNQSLHNENNKNNCVRTLRDYMNPIRISASSCIVSPPDASHFNFKPGIIQLLPSFHGLDLENP
Ga0325421_066603_1518_17003300034689LeafAEEDNQSLHNKNNENNCVRTLRYHINPTRTSAPSCIGFPPDTSHFNFKLGIIQFLPSFMA
Ga0325423_083307_406_5523300034778LeafMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNF
Ga0325423_134587_3_1553300034778LeafMAEEDNQSLYNENNENNWVRTLRDHMNPIRTSAPSCIVFPPDASHFNFKPG
Ga0325409_076318_1103_12883300034901XylemMAEEDNQSLHNENIRVRTFKDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLLPSFHGLDLE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.